current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260198|ref|NP_842575.1| hypothetical protein (BA_0003) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
1 -37.100[S] COG2501 Uncharacterized conserved protein  ali follow..  67  2ANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEPDNRRGRKLYVGDVVEIEGFGSFQV.. 69
2 -22.900[J] COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)  ali follow..  14  5......SSVEVRLDKWLWAARFYKTRAMAREMIEGGKVHYNGQRS-KPSKIVELNATLTLR......... 58
3 -19.700[J] COG0522 Ribosomal protein S4 and related proteins  ali follow..  14  97...........RLDNVVYRMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAK..... 150
4 -17.700[S] KOG4837 Uncharacterized conserved protein  ali follow..  20  74.KVVKTKVNSLRADLLLK-AGLGMARNKVELNFYESKIRVNGKKLPKKSAQLEVGDEIDV.......... 131
5 -17.200[J] KOG3301 Ribosomal protein S4  ali follow..  108...........RLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHID......... 157
6 -16.400[S] COG2302 Uncharacterized conserved protein, contains S4-like domain  ali follow..  15  172WEEMGLTVSSMRLDVIISNA-HHISRQKAKQLVTAGLVKVNWKTVENPDFECEEEDVLSARGYGRVKVLS 240
7 -15.700[A] KOG4655 U3 small nucleolar ribonucleoprotein (snoRNP) component  ali follow..  13  128...........SYNHFPLAVRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVSRNDFVTWVDGS...... 182
8 -13.600[S] COG4332 Uncharacterized protein conserved in bacteria  ali follow..  10  143..........LRLDRLLA-SELGISRSRLQTLAERRLLVVDPDGAKALRKPARQGMTIRID......... 192
9 -12.100[J] COG1187 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases  ali follow..  18  60......LVEGEKLQKVLARAGQG-SRREIEAMIAENRVSVDGKIATLGDRDVHAGVKIRIDGHLINLLHA 123
10 -12.100[J] COG0564 Pseudouridylate synthases, 23S RNA-specific  ali follow..  16  17......EQLTGRLDKGLVSYNGAYSRAFYQQQIELGRVRVNGRVYTRVSHPLSLGDVVEVE......... 71
11 -11.300[J] COG0162 Tyrosyl-tRNA synthetase  ali follow..  15  331.......EGEMGLANLLKEAGLVASTSEANRMVQQGGVKIDGEKVEDAKLVIKASTAVYQVGKR...... 387
12 -10.100[J] COG1471 Ribosomal protein S4E  ali follow..  17  40.......ENSLPLMIIVRILKVADNAREARKIINSGEVLVDGRPRKNYKFPVGFMDVVSIPRTG...... 97

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.