current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260198|ref|NP_842575.1| hypothetical protein (BA_0003) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELENRRGRKLYANDIIEIPGSGSFQVQSLast
1 -17.300sp|P46781|RS9_HUMAN 40S ribosomal protein S9 OS=Homo sapiens GN=RPS9 PE=1 SV=3  ali follow..  109...........RLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHID......... 158
2 -15.400sp|Q9NV31|IMP3_HUMAN U3 small nucleolar ribonucleoprotein protein IMP3 OS=Homo sapiens GN=IMP3 PE=1 SV=1  ali follow..  12  110...........RLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVT......... 159
3 -15.200sp|Q9P0P8|CF203_HUMAN Uncharacterized protein C6orf203 OS=Homo sapiens GN=C6orf203 PE=1 SV=1  ali follow..  15  132YKDLEKAVQSFRYDVVLK-TGLDIGRNKVEDAFYKGELRLNEEKLWKKSRTVKVGDTLDL.......... 190
4 -10.300sp|Q9Y2Z4|SYYM_HUMAN(removed signalp:1-33) Tyrosyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=YARS2 PE=1 SV=2  ali follow..  12  371.......DPGTSVLDTCRKANAIPDGPRGYRMITEGGVSINHQQVTNPESVLIVGQLLKIGKRNFYIIK. 440
5 -9.950sp|P62701|RS4X_HUMAN 40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2  ali follow..  21  39.......RECLPLIIFLRRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTG...... 96
6 -9.570sp|Q8TD47|RS4Y2_HUMAN 40S ribosomal protein S4, Y isoform 2 OS=Homo sapiens GN=RPS4Y2 PE=1 SV=3  ali follow..  21  39.......RECLPLIVFLRRLKYALTGDEVKKICMQHFLKIDGKVRVDITYPAGFIDVISIEKTG...... 96
7 -9.480sp|P22090|RS4Y1_HUMAN 40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens GN=RPS4Y1 PE=2 SV=2  ali follow..  20  39.......RECLPLIVFLRRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIE......... 93
8 -8.510sp|Q8IZ73|RUSD2_HUMAN RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens GN=RPUSD2 PE=1 SV=2  ali follow..  10  161...........SLLHVFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRN.......... 209
9 -8.300sp|Q96JH8|RADIL_HUMAN Ras-associating and dilute domain-containing protein OS=Homo sapiens GN=RADIL PE=1 SV=5 (Range: 151-450)  ali follow..  12  138LSAPDILPLHCTIRRQPLPDSGQAAGRLVLEPIPGAHISVNFSEVGHRTVVLHHGDLLSLGLYYLLLFKD 207
10 -7.520sp|Q96JH8|RADIL_HUMAN Ras-associating and dilute domain-containing protein OS=Homo sapiens GN=RADIL PE=1 SV=5 (Range: 301-600)  ali follow..  13  20................................IPGAHISVNFSEVGHRTVVLHHGDLLSLGLYYLLLFKD 57

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.