current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260202|ref|NP_842579.1| inosine 5`-monophosphate dehydrogenase (BA_0008) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .
# Score Template Links and tools%idFirst MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTPEHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLITAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLLVGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEKGSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENAQFIRMSGAGLLESHPHHVQITKEAPNYSLLast
1 -116.000sp|P20839|IMDH1_HUMAN Inosine-5`-monophosphate dehydrogenase 1 OS=Homo sapiens GN=IMPDH1 PE=1 SV=2  ali follow..  42  27.......ADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITTGTMGSKLVGIVTSRDIDFLAEKDHLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSELKFEKRTMSAQIEGGVHGLHSYEKR..... 512
2 -115.000sp|P12268|IMDH2_HUMAN Inosine-5`-monophosphate dehydrogenase 2 OS=Homo sapiens GN=IMPDH2 PE=1 SV=2  ali follow..  40  27.......GDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRGSRLVGIISSRDIDFLKEEEHLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAELKFEKRTSSAQVEGGVHSLHSYEKR..... 512
3 -84.700sp|P36959|GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens GN=GMPR PE=1 SV=1  ali follow..  37  7.......DLKLDFKDVLLRPKRSSLKSRERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHP------------------------------------------------------------------------------------------------------------------------------ECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVA-----EYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS............... 345
4 -83.900sp|Q9P2T1|GMPR2_HUMAN GMP reductase 2 OS=Homo sapiens GN=GMPR2 PE=1 SV=1  ali follow..  35  5.....DNDVKLDFKDVLLRPKRSTLKSRSRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNP------------------------------------------------------------------------------------------------------------------------------DCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYA-----GGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQ-VNPIFSEA............ 347
5 -13.000sp|Q9NYQ3|HAOX2_HUMAN Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=2 SV=1  ali follow..  22  206.....................................................................................................................................................................................................................................................................NDLSWFQSIT-RLPIILKGILTKEDAELAVKHNVQGIIVSNHGG-----RQLDEV-LASIDALTEVVAAVKG-KIEVYLDGGVRTGNDVLKALALGAKCIFLGRPILWGLACKGE---------------------------------------HG----------VKEVLNILTNEFHTSMALTGCRSVAEINRN.............................. 344
6 -12.900sp|Q9UJM8|HAOX1_HUMAN Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1  ali follow..  24  220.....................................................................................................................................................................................................................................................................EDIKWLRRLT-SLPIVAKGILRGDDAREAVKHGLNGILVSNHGA-----RQLDGV-PATIDVLPEIVEAVEG-KVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGE---------------------------------------KG----------VQDVLEILKEEFRLAMALSGCQNVKVIDKT.............................. 358
7 -10.400sp|Q96G46|DUS3L_HUMAN tRNA-dihydrouridine synthase 3-like OS=Homo sapiens GN=DUS3L PE=1 SV=2 (Range: 451-650)  ali follow..  12  1..............................................................................................................................................................................................................................................................................................LPELRDWGVALVTL--------RSREQRYTKLADWQYIEECVQAASP--MPLFGNGDILSFEDANRAMQTGVTGIMIAR---GALLKP--------TEIKEQRHWDISSSERLDILRDFTNYGLEHWGSD-TQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMPKHK. 195
8 -10.400sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP+] OS=Homo sapiens GN=DPYD PE=1 SV=2 (Range: 601-900)  ali follow..  16  13......................................................................................................................................................................................................ISEKTAAYWCQSVTELKADFPDNIVIASIMNKNDWTELAKKSEDSGADALELNLS-GQDPELVRNICRWVRQAVQIPFLTPNVTDVSIARAAKEGGANGVTAAVGIAKRTTYGGVSGTAIRPIALVTSIARALP--GFPILATGGIDSAESGLQFLHSGASVLQVCSAI----------------------------------------------QNQDF-----------TVIEDYCTGLKALLYLKSIEELQDWDGQS............................. 253
9 -10.200sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 (Range: 601-818)  ali follow..  20  1....................................TGGLEYIVPLMAAVMDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRN-DPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKESQRLVGFALRRDLTIAIESARKKQEGIVDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHN-GRLLGIITKKDILR......................................................................................................................................................................................................................................................................................... 202
10 -10.000sp|Q9UGI9|AAKG3_HUMAN 5`-AMP-activated protein kinase subunit gamma-3 OS=Homo sapiens GN=PRKAG3 PE=2 SV=3  ali follow..  15  189........QEHTCYDAMATSSKLVIFDTMLEIKKALVANGVRAAPLWDSKVGMLTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYL--QGCFKPLVSISPNDSLFEAVYTLIKNRIHRLPVL-DPVSGNVLHILTHKRLPSFLYRTIQDLGIGTFRDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHDMSVGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVDILQALVLSPAGIDALGA................................................................................................................................................................................................................ 489
11 -9.060sp|Q9UGJ0|AAKG2_HUMAN 5`-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens GN=PRKAG2 PE=1 SV=1  ali follow..  14  266........RSHKCYD--IVPTSSKLVVFDTTLQVKLVANGVRAAPLWESKVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQET--FKPLVNISPDASLFDAVYSLIKNKIHRLPVI-DPISGNALYILTHKRI--FMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDV----------------------------------------INLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSI-----------------------------------GIISLSDILQALILTPAGAKQKETET....................................................................................................................... 568

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.