current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260209|ref|NP_842586.1| deoxynucleoside kinase family protein (BA_0015) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGKFYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNVIFASRTLKDSQYDKYMQIYRILTQDMPVPNVIVYLTASLETLQRRIAMRGREFEKNMDPNYLLQLTKDYETAMDAFKKDHPDIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESKLast
1 -71.000sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4  ali follow..  19  47KEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADH-HMERMLELFEQNRDRILTPENRKH. 263
2 -70.200sp|Q16854|DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens GN=DGUOK PE=1 SV=2  ali follow..  22  36.RGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLIHKTTKLMNIPVLVLDVND-DFSEEVTKQEDLMREVNTFVKNL.. 277
3 -67.900sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1  ali follow..  21  19.TRIKKISIEGNIAAGKSTFVNILKQLCEEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKLQEVPILTLDVNE-DFKDKYESLVEKVKEFLSTL..... 260
4 -61.700sp|O95299|NDUAA_HUMAN(removed signalp:1-20) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens GN=NDUFA10 PE=1 SV=1  ali follow..  20  35.ERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHNCSLEKFYDDPRSNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSE----KCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQ 266
5 -40.400sp|P23919|KTHY_HUMAN Thymidylate kinase OS=Homo sapiens GN=DTYMK PE=1 SV=4  ali follow..  13  3ARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTLQKKSDVEDHSVHLLFSANRWEQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFS-----LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQLMKD-----TTLNWKMVDASK----SIEAVHEDIRVLSEDAIRTATE 204
6 -33.000sp|Q5EBM0|CMPK2_HUMAN UMP-CMP kinase 2, mitochondrial OS=Homo sapiens GN=CMPK2 PE=1 SV=3  ali follow..  18  250.GKFQVVAIEGLDATGKTTVTQSVADSLKAVLLKSPPSCIGQWRKIFDDEPT---IIRRAFYSLGNYIVASEIAKES-AKSPVIVDRYWHSTATYAIATEVSGGLQHLPPAHHPVYQDLLKPDLILLLTVSPEERLQRLQGRGMEAELEANSVFRQKVEMSYQRM--------ENPGCHVVDASP----SREKVLQTVLSLIQNSFSEP.. 449
7 -22.600sp|Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 OS=Homo sapiens GN=TAF9 PE=1 SV=1  ali follow..  19  1MLLPN-ILLTGTPGVGKTTLGKELASKSGLKYINGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMRE---------GGVIVDYHGCDFFPERWF------------------------HIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEE------IVHQLPSNKPEELENNVDQILKWIEQWIKDHNS 172
8 -22.300sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali follow..  14  1MAAPGALLVMGVSGSGKSTVGALLASELGWKFY----DADDYHPEENRRKMGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHF---MPPELLQSQ-------FETLEPPAAPENFIQISVDK--------NVSEIIATIMETLKMK.. 187
9 -21.000sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=ITGB1BP3 PE=1 SV=1  ali follow..  13  1MK--LIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQ-------DDFFKPQDQIAVSLDMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLY-----------SRRYFLTVPYEECKWRRSTRNYTVPDPPGL-FDGHVWPMYQKYRQEMEANGVE--VVYLDGMK----SREELFREVLEDIQNSLLNRSQ 196
10 -20.700sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NRK1 PE=1 SV=1  ali follow..  16  2..KTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQ-------DDFFKPESEIETDKNGFL---QYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDT-NRSYFLTIPYEECKRRRSTRVYQ-PPDSPGYFDGHVWPMYLKYRQEMQDITWE--VVYLDGTK----SEEDLFLQVYEDLIQELAKQK. 193
11 -18.900sp|Q15126|PMVK_HUMAN Phosphomevalonate kinase OS=Homo sapiens GN=PMVK PE=1 SV=3  ali follow..  7.APRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQY-EAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSD-------------------IQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDF-----------------WVIE-NHGVEQRLEEQLENLIEFIRSRL..... 192
12 -18.700sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1  ali follow..  15  18.GEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILDSFYRVLTSEQKAFDNELILKTLKEITE--------GKTVQIPVYDFVSRKEETVTVYPADVVLFEGILAFYSQEVRDFQMKLFVDTDADTRLSRISERGRDLEQILS-QYITFVKPAFEEFCLPTKKYAD----VIIPRG----ADNLVAINLIVQHIQDILNGGPS 234
13 -18.200sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1  ali follow..  12  21.QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILDRFYKVLTAEQKAFDNDLMHRTLKNIVE--------GKTVEVPTYDFVTRLPETTVVYPADVVLFEGILVFYSQEIRDFHLRLFVDTDSDVRLSRRVLRDGRDLEQILTQYTTFVKPAFEEFCLPTKKYAD----VIIPRG----VDNMVAINLIVQHIQDILNGDIC 236
14 -17.000sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3  ali follow..  12  2..KPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGF--------------PRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASK--------SVDEVFDEVVQIFDKEG. 196
15 -16.700sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2 (Range: 1351-1650)  ali follow..  14  64......IIIVGPPKSGKTTVAKKITSEYGLKHL----SIGGALRYVLNNHPETELALMLNWHLHKIQALELSLMESVCNTAGVVID------------------YPVTKHQMNLLEARSIIPMVIFELSVPSKEIFKRLLLEKENEQRLPSAQIVAVNNVKYRKNIGEIRQYYQEQ-WYVIDGFH----SKWWVWNEVIKNVQMVNKYMQT 259
16 -16.700sp|Q8IV42|PSTK_HUMAN L-seryl-tRNA(Sec) kinase OS=Homo sapiens GN=PSTK PE=2 SV=2  ali follow..  12  16.RKRGLCVLCGLPAAGKSTFARALAHRLQQEVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFYLLTKTAVSRPLFLVLD--------------DNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQR----PQALPPETIHLMGRKLEK---NPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAED 256
17 -16.400sp|Q96EK9|KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens GN=KTI12 PE=1 SV=1  ali follow..  11  1MP---LVVFCGLPYSGKSRRAEELRVALAAEGRAVYVVDDAAVLGAEDPAVYGDSARE----KALRGALRASVERRLSRHDVVILD--------------SLNYIKGFRYELYCLARAARTPLCLVYCVRPGGPIAGPQVAGANENPGRNVSVSWRPRAEEDGR............................................... 143
18 -16.300sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3  ali follow..  17  5LKKTKIIFVVGGPGSGKGTQCEKIVQKYGYDLLRSEVSSG---SARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGY--------------------VQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEIKKRLETYYKATEPVIAFYEKRGIVRKVNAEG--------SVDSVFSQVCTHLDALK. 194
19 -16.200sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 (Range: 451-750)  ali follow..  11  45.KDCEVVMMIGLPGAGKTTWVTKHAAENPGKY--NILGTNTIMDKMMFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILD----------QTNVSAAAQRRKMCLFAGFQRK------AVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFT--LPEVAECFDE--ITYVELQKEE---AQKLLEQYKEESKKALPPEKK 232
20 -16.000sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2  ali follow..  15  1MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFS-------VSHTTRNPRPGEENGKDYYFVTR-EVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLV----KRLAAAQADMESSK------------EPGLFDVVIINDSLDQAYAELKEALSEEI. 189
21 -15.500sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2  ali follow..  14  96.KEAFAIGLGGGSASGKTTVARMIIEALDVPWV-VLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISKKLKQGKSVKVPIYDFTSRKKDWKTLYGANVIIFEGIMAFADKTLLE-DMKIFVDTDSDIRLVRISERGRDIEGVIK-QYNKFVKPSFDQYIQPTMRLAD----IVVPRGS----GNTVAIDLIVQHVHSQLEERE. 304
22 -14.900sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2 (Range: 1-300)  ali follow..  12  27LSKPVCFVVFGKPGVGKTTLARYITQAWKCIRV----EALPILEEQIAAETESGVMLQSMLISGQIKLMLEKLNSPEVCHFGYIITEI-----------SLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISQRPEDYLENVENI-VKLYKETILQTLEEVMAEHNPQYLIELNGNK--------PAEELFMIVMDRLKYLN. 288
23 -14.800sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2  ali follow..  12  373LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFEELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDG------------------------YPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTIAKRLEAYYRASIPVIAYYETKTQLHKINAEG----TPEDVFLQLCTAIDSIF..... 562
24 -14.500sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2 (Range: 1-300)  ali follow..  14  52LVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVILEKTWNMSVSEKLQDVGN------------EQFLEEEGKAVLNFSASGSVIS----------GSNPMHDASMWHLKK------------GIIVYLDVPLLDLICRLKLKTDRIVGQNSGTSMKDLLKFRRQYYKKWYD-------ARVFCES------GASPEEVADKVLNAIKRYQD 225
25 -14.500sp|Q9BSD7|CA057_HUMAN Nucleoside-triphosphatase C1orf57 OS=Homo sapiens GN=C1orf57 PE=1 SV=1  ali follow..  12  1MAR--HVFLTGPPGVGKTTLIHKASEVLKSSGVP-------YTEEVRQGGRRIGF--DVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLR--------NADCSSGPGQRVCVIMELFSQLFIQAVRQ---STPGTIILGTIPVPKGKPLALVEEIRNR-KDVKVFNVT---------KENRNHLLPDIVTCVQSSRK 190
26 -14.400sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1 (Range: 451-747)  ali follow..  11  3....EVILMVGLPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPKSRLVQQASQCLSKLVQIASRTKRNFILD----------QCNVYNSGQRRKLLLFKTFSRK------VVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFS................................................ 147
27 -13.900sp|Q96MA6|CI098_HUMAN Putative adenylate kinase-like protein C9orf98 OS=Homo sapiens GN=C9orf98 PE=2 SV=1  ali follow..  13  271......VLLLGPVGSGKSLQAALLAQKYRLQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMK------------------VLSQRLDQQDCIQKGWVLH---VPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIIN... 472
28 -13.200sp|Q5TBK1|N42L1_HUMAN NEDD4-binding protein 2-like 1 OS=Homo sapiens GN=N4BP2L1 PE=2 SV=1  ali follow..  14  41..RKHLYLLRGLPGSGKTTLARQLQHDFPRALIFS-------TDDFFFREDG-AYEFNPDFLEEAHEWNQKRARKAMRNGISPI---------IIDNTNLHAWEMKPYAVMALENNYEV----IFREPDTRWKFNVQELARRN---IHGVSREKIHRMKERYEH............................................... 178
29 -13.200sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3 (Range: 301-600)  ali follow..  16  70......ICILGPPAVGKSSIAKELANYYKLDVISEAIAKAIVAPNDVGEGEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMILDGFPKTYDQAKDLFNQEDEEFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYS-----QDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQ.. 300
30 -12.900sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 (Range: 1-300)  ali follow..  10  68.GAAWGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQ-ALAFHFCKAQDSDTLCVGGFIRGLVAQICR--SGLLQGYEDKLRDPAV--QSLLQPGECERNPAEAFKRCVLLPLLGMKPPSLYLLVDSVDEGCNITEGEQTSTSLSGTVAALLAGHHEFFPPWLLLLCSARKQSKAVTFRKISLDDLRKAYIVKDVQQYILHRLDQEEA 279
31 -12.800sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=1 SV=1 (Range: 301-600)  ali follow..  11  112.APYPMLILAGPEACGKRELAHRLCRQFSFRYGACHTTRPP--DVFDEMVNMGKFILTFSYGNHKYGLNRDTVEGIARDGLASCIHMEI--------------------EGVRSLKYSYFEPRYILVVPMNKEKYEGYLRRKGLFSRAEIE----FAVSRVDLYIKINQNFPGYFDEVINAD-------DLDVAYQKLSQLIREYL..... 300
32 -12.600sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 (Range: 301-600)  ali follow..  142.....LVLLRGLPGSGKSFLARTLQEDNPSGVILS-------TDDYFYINGQYQFDVKY--LGEAHEWNQNRAKEAFEKKISPI---------IIDNTNLQAWEMKPYVALSQKHKYKV----LFREPDTWWKFKPKELARRN---IHGVSKEKITRMLEHYQR-VPIIMSSSVPEKIERIELCAYS........................ 300
33 -12.000sp|O95340|PAPS2_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2 (Range: 1-300)  ali follow..  16  40.FRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDG--------DNVRHGLNRNLGFSGDREENIRRIVAKLFADAGLVCITSFI-------------SPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEK---------PETPERVLKTNLSTV---SDCVHQVVELLQEQ...... 213
34 -11.900sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapiens GN=MPP5 PE=1 SV=3 (Range: 451-675)  ali follow..  11  27.NRKRPIILIGPQNCGQNELRQRLMNKEKDRFASA-------VPHTTRSRRDQEVAGRDYHFVSR-QAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYF-----------------DTAIVNSDLDKAYQELLRLINKLD. 213
35 -11.900sp|P27144|KAD4_HUMAN Adenylate kinase isoenzyme 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1  ali follow..  12  3.SKLLRAVILGPPGSGKGTVCQRIAQNFGLQHL----SSGHFLRENIKASTEVGEMAKQYI--EKSLLVPDHVITRLMMSELENRR----QHWLLDGFPRTLGQAEALDKICEV--------DLVISLNIPFETLKDRLSRR---QQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLH----QFSGTETNKIWPYVYTLFSNKITPIQS 219
36 -11.900sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 (Range: 601-900)  ali follow..  67VSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVDHKLIWLPLREAFEEL--FAQTFSKKQNFTFLGHIQTCYRQKRWHDLLRLMQHVHKSAVNKDGKDSETGLLIKEKWEAFGLRLNHAQQQMKMTENTLLFAFVEGT----------LAQAVKKGEWILLD--EINLAAPE-----ILECLSGLLEGSSG 258
37 -11.800sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2  ali follow..  10  13.PKGIRAVLLGPPGAGKGTQAPRLAENFCVCHL----ATGDMLRAMVASGSELGKKLKATM--DAGKLVSDEMVVELIEKN--LETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKL---DSVIEFSIPDSLLIRRITGR---RRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHS--------IDASQTPDVVFASILAAFSKATC 232
38 -11.800sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4  ali follow..  12  5.ARLLRAVIMGAPGSGKGTVSSRITTHFELKHLS---------------------SGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVM-TRLALHELKNLTQYSWLLDGFPRTLPQRAYQIDTVINLNVPFEVIKQRLTAR---QREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLE----TFSGTETNKIWPYVYAFLQTKVPQRSQ 221
39 -11.500sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1 (Range: 301-600)  ali follow..  13  65.PKQKVALLCGPPGLGKTTLAHVIARHAGYSVVEMNASDDRSPEVFRTRIEAATQMESVLGAGGKPNCLVIDEIDGAPVAAINVLLSILNRKGPQEVGPQGPAVPSGGGRRRRAEGGLLMRPIICIFPPTLPSRLVQRLQEVSLRQGMRADPGVLAALCEKTDNDIRACINTLQGQRELSVRDVQATRVGLKDQRRGLFSVWQEVFQLPRA 299
40 -11.500sp|O43252|PAPS1_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2 (Range: 1-300)  ali follow..  17  50.FRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDG--------DNIRQGLNKNLGFSEDREENVRRIVAKLFADAGLVCITSFI-------------SPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEK---------PEAPELVLKTDS---CDVNDCVQQVVELLQE....... 222
41 -11.400sp|P09543|CN37_HUMAN 2`,3`-cyclic-nucleotide 3`-phosphodiesterase OS=Homo sapiens GN=CNP PE=1 SV=2  ali follow..  11  47LECKTLFILRGLPGSGKSTLARVIVDKYRDGTK------------VSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRIL---------VLDDTNHERERLEQLFEMADQYQYQV----VLVEPKTAWRLDCAQLKEKN---QWQLSADDLKKLKPGLEK............................................... 183
42 -11.300sp|Q96T60|PNKP_HUMAN Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens GN=PNKP PE=1 SV=1  ali follow..  13  363.ASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDT-------------------------LGSWQRCVTTCETALKQGKRVAID----------NTNPDAASRARYVQ----CARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVS--DMVMYGYRKQFEAPTLAEGFSAILEIPFRLWVEPRLGRLYCQFSE........... 520
43 -11.300sp|Q92802|N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens GN=N4BP2L2 PE=1 SV=1  ali follow..  12  404.....LILLRGLPGSGKTTLSRILLGQNRDGIVFS-------TDDYFHHQDGYRYNVNQ--LGDAHDWNQNRAKQAIDQGRSPV---------IIDNTNIQAWEMKPYVEVAIGKGYRV----EFHEPETWWKFDPEELEKRN---KHGVSRKKIAQMLDRYEY............................................... 537
44 -11.300sp|Q8WVC6|DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens GN=DCAKD PE=1 SV=1  ali follow..  11  2....FLVGLTGGIASGKSSVIQVFQQVFGTEVLLEDINRKVLGDLIFNQPDRRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILD----IPLLFETKKLLK--------------------KHTVVVYCDRDTQLARLMRRNSLNRKDAEARINAQLPLTDKARMARH----------VLD-NSGEWSVTKRQVILLHTELERSLEYL.. 203
45 -11.200sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 (Range: 1351-1650)  ali follow..  30LEFGEPVLLVGDTGCGKTTICQVFAALANQKLYSVSCHLHMETSDFLRPVRQKPNDKEEIDTSRLFEWHDGPLVQAMKEDGFFLLDEI-LNSVLEVEKSLVLAEKGSPEDKDSEIELLTAGKKFRILATMNPG---------GDFGKKELSPALRNRFTEIWCP------QSTSREDLIQIISHNLRPGLCLGRIDPKGSDIPEVMLDFID 237
46 -11.100sp|Q9C093|SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens GN=SPEF2 PE=1 SV=2 (Range: 601-900)  ali follow..  39FSAGPVSDEVLPETEGETMLSANADKTPKAEEVKS--------DSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNA--INEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVDFVILLDVSDTSSMSRMNDIDKDGDQNLRDQIQHRI-IGFLDNWPLLEQWFSEPELIKINAE----IDKESLCEKVKEILTTEIAKKKN 287
47 -10.900sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2 (Range: 901-1200)  ali follow..  12  94......ICLVGPQGSGKTMCGRQLAEKLNIFHIQQAAKQELEELAIQANVKVEEENTKKQLPEVQLTEEEEVIKSSLMENEPLLSEWWLKEPIRSTGFILDG--FPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPA..................................................................... 263
48 -10.800sp|Q15645|TRP13_HUMAN Thyroid receptor-interacting protein 13 OS=Homo sapiens GN=TRIP13 PE=1 SV=2  ali follow..  15  169ITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSREINSHSLFSKWFSESGK--LVTKMFQKIQDLIDDKDALVFVLIDE----VESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMK........................................ 340
49 -10.700sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 (Range: 151-450)  ali follow..  12  81LAVPRGVLLAGPPGVGKTQLVRAVAREAGAELLAVS-ETEENVRRVFQRARELASRGPSLLFLDEMDALCPQRGSRAPESR-VVAQVLTLLDGASGDREVVVVGATNRPDALDPALRRPGRFDREVVIGTPTLKQRKEILQSKMPISSHVDLGLLAEMTVGYV---ADLTALCREAAMHALLHSEKNQDNPVIDEIDFLEAFKNIQPSSFR 300
50 -10.700sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2 (Range: 1501-1800)  ali follow..  10  8................................................................................................................NLLEARSIIPMVIFELSVPSKEIFKRLLLEKENEQRLPSAQIVAVNNVKYRKNIGEIRQYYQEQNWYVIDGFH----SKWWVWNEVIKNVQMVNKYMQT 109
51 -10.700sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 (Range: 451-750)  ali follow..  1..............SGKSFLARTLQEDNPSGVILS-------TDDYFYINGQYQFDVKY--LGEAHEWNQNRAKEAFEKKISPI---------IIDNTNLQAWEMKPYVALSQKHKYKV----LFREPDTWWKFKPKELARRN---IHGVSKEKITRMLEHYQR............................................... 125
52 -10.500sp|Q9NYR9|KBRS2_HUMAN NF-kappa-B inhibitor-interacting Ras-like protein 2 OS=Homo sapiens GN=NKIRAS2 PE=1 SV=1  ali follow..  11  1MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGL-RDGAELPRHCFSCTDGYV--------LVYS----SRESFQRVELLKKEIDKSKDKKEVTIVV-----------NKCDLQEQRRVDPDVAQHWAKSE--------------KVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSA. 176
53 -10.400sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 (Range: 601-900)  ali follow..  42.SSFKAALLSGPPGVGKTTTASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMDEV--EDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSSKALTYDQAKADSHRAKKDIKMGPFDVARKVFAAGEE 261
54 -10.300sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 (Range: 601-856)  ali follow..  13  12LVTPAGVLLAGPPGCGKTLLAKAVANESGLNFIS--VKGPELLNMYVGESE---------------RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVG.......................................................... 147
55 -10.200sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3 (Range: 151-450)  ali follow..  13  100CKHVKGILLYGPPGCGKTLLARQIGKMLNAREP-KVVNGPEILNKYVGESEA-----NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDE--KGRLQILHIHTARMRGHQLLSADVDIKELAVETKELEGLVRAAQS....... 300
56 -10.200sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 (Range: 601-893)  ali follow..  12  58IQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIK-ESERAVRETFRKARAVAPSIIFFDELDALAVERGSSLGAGNVADRVLAQLLTEMDGIEQLKDVTILAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRREIFKHSMPVSNEVDLDELILQTDAYSG--AEIVAVCREAALLALEEDIQANLIMKRHFTQALSTVTPRIPE... 275
57 -10.100sp|Q9NYS0|KBRS1_HUMAN NF-kappa-B inhibitor-interacting Ras-like protein 1 OS=Homo sapiens GN=NKIRAS1 PE=1 SV=1  ali follow..  11  1MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGL-QEGVELPKHYFSFADGFV--------LVYS---NNLESFQRVELLKKEIDKFKDKKEVAIVV-----------NKIDLSEQRQVDAEVAQQWAKSE--------------KVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSS. 176
58 -10.100sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 (Range: 451-750)  ali follow..  13  162LVTPAGVLLAGPPGCGKTLLAKAVANESGLNFIS--VKGPELLNMYVGESE---------------RAVRQVFQRAKNSAPCVIFFDEVDALCPRRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVG.......................................................... 297
59 -10.000sp|Q68D06|SLN13_HUMAN Schlafen family member 13 OS=Homo sapiens GN=SLFN13 PE=2 SV=1 (Range: 451-750)  ali follow..  12  139LRKNRELFVHGLPGSGKTIMAMKIMEKIRNV---FHCEAHRILYVCENQPLRNFISDRNICRAETRETFLREKFEHI---QHIVID---------EAQNFRTEDGDWYRKAKTITQREKDCPGLWIFLDYF-----QTSHLGHSGLPPLSAQYPREELTRVVRN-------------------------------DEIAEYIQQEMQLIIE 300
60 -10.000sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 (Range: 1801-2100)  ali follow..  22  256VQMSWMVILVGPASVGKTSLVQLLAHLTGHTLKIMAMNSA........................................................................................................................................................................... 295
61 -9.980sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 (Range: 301-600)  ali follow..  19  166......VLLRGPPGCGKTTVVAAACSHLGLHLLK--VPCSSLCAESSGAVET-----KLQAIFSRARRCR---------------------------------------------------PAVLLLTAVDL------GRDRDGLGEDARVMAVLRHL-------LLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQ 300
62 -9.920sp|O95803|NDST3_HUMAN(removed signalp:1-30) Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens GN=NDST3 PE=2 SV=1 (Range: 451-750)  ali follow..  12  112CDRLPKFLVIGPQKTGTTALYLFLVMH---SILSNSPSPKTFEEVQFFNRNNYH---------RGIDWYMDFFPVPSNVTTDFLFE--------------KSANYFHSEEAPKRAASLVPKAKIITILIDPSDRAYSWQHQRSHEDPAALKFSFYEVISAGYASHIERWLVYFPPFQLLIIDGQQL......................... 292
63 -9.910sp|P52848|NDST1_HUMAN(removed signalp:1-35) Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens GN=NDST1 PE=1 SV=1 (Range: 451-750)  ali follow..  12  116CDRFPKLLIIGPQKTGTTALYLFLGMH---DLSSNYPSSETFEEIQFFNGHNYHKGIDWY---------MEFFPIPSNTTSDFYFE--------------KSANYFDSEVAPRRAAALLPKAKVLTILINPADRAYSWQHQRAHDDPVALKYTFHEVITAGYATHIERWLSAYHANQILVLDGKLL......................... 296
64 -9.840sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 (Range: 451-750)  ali follow..  12.PLLSPSSSTSASSTAKTPLGSISAENQRPREDAVKYLASKVVAYHYCQADNTYTCLVPEFVHSIAALLCRSHQLAAYRDLLIKEPQ---LQSMLSLRSCVQDPVAAFKRGVLEPLTNLRNEEYIILIDG-----LNEAEFHKPDYGDTL-SSFITKIISKFPAWLKLIVTVRANFQEIIVKLSLDDFPDNKDIHSDLHAYVQHRVHSSQD 223
65 -9.820sp|O75943|RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens GN=RAD17 PE=1 SV=2 (Range: 1-300)  ali follow..  16  128.QGGSILLITGPPGCGKTTTLKILSKEHGIQVQE----INPVLPDFQKDDFKGMFNTEFLLRATKYNKLQMLGDDLRTDKKIILVEDL----------NQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQR......................................................................... 269
66 -9.800sp|Q08AF3|SLFN5_HUMAN Schlafen family member 5 OS=Homo sapiens GN=SLFN5 PE=1 SV=1 (Range: 451-750)  ali follow..  118LRKTRELFVHGLPGSGKTILALRIMEKI--------------RNVFHCEPANILYICENQPLKKLVSFSKKNICQPVTRKTFMKNNFEHIQHIIIDDAQNFRTEDGDWYGKAKFITQTARDGPGVLWIFLDYF---QTYHLSCSGLPPPSDQYPREEINRVVRNYLQQVMQEARQNPPPNLPPGSLVMLYEPK.................. 299
67 -9.800sp|Q8IYK8|REM2_HUMAN GTP-binding protein REM 2 OS=Homo sapiens GN=REM2 PE=1 SV=2  ali follow..  10  117......VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEE--VTLVVYDIWEQGDAGGWLRDHCLQTGDAFL--------IVFS---TDRRSFSKVPETLLRLRAGRPHHDLPVIL-----------NKSDLARSREVSLEEGRHLAGTLS--------------CKHIETSAALHHNTRELFEGAVRQIRLRRGRNHA 286
68 -9.750sp|A3KMH1|K0564_HUMAN Uncharacterized protein KIAA0564 OS=Homo sapiens GN=KIAA0564 PE=1 SV=2 (Range: 751-1050)  ali follow..  14  27......LLLVGNQGVGKNKIVDRFLHLLNRPREY----------QLHRDTTVQTLTLQPSVKDGLIVYEDSPLVKAVKLGHILVVDEAAPTNVTCILKTLVENGEMILADGRRIVANSANVNGRENVVVIHPD--FRMIVLANRPGFPFLGNDFFGTLGDIFSCHAVDNPKPHSELEMLRQYGPNVP--------EPILQKLVAAFGELRS 214
69 -9.720sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 (Range: 451-750)  ali follow..  10  217VSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVDHKLIWLPLREAFEELFAQTFSKKQNFTFL................................................................................................................................ 299
70 -9.710sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 (Range: 1951-2250)  ali follow..  13  106VQMSWMVILVGPASVGKTSLVQLLAHLTGHTLMNSAMDTTELLGGFEQVDLIRPWRRLLEKVEGTVRALLRDSLLISADDAEVVLRAWSHFLLTYKPKCLGEGGKAITMEIVNKLEAVLLLMQRLNKINSYCKAEFAKLVEEFRSFGVKLTQLASGHSHGTFEWVDSMLVQALKSGDWLLMD--NVNFCNPS................... 300
71 -9.680sp|Q86XH1|IQCA1_HUMAN IQ and AAA domain-containing protein 1 OS=Homo sapiens GN=IQCA1 PE=2 SV=1 (Range: 451-750)  ali follow..  19  121......LLLAGPSGVGKKMLVHAICTETGANLFNLSSSN---IAGKYPGKNGLQMMLHAVFKVARQLQ-----------------------------------------------------PS-VVWIEDTEKTFYKKVPNAEKMNEPKRLKKHLPQILKLLK----------PDDRILIVGTTRRPFDAELQSFCKVYQKI......... 249
72 -9.600sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 (Range: 151-450)  ali follow..  13  85VKPPRGILLYGPPGTGKTLIARAVANETGAFFFL--INGPEIMSKLAGESES---------------NLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIG---------------IPDATGRLEILQIHTKNMKLADDVD.................. 245
73 -9.590sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 (Range: 1651-1950)  ali follow..  12  93TKLKKPILLEGSPGVGKTSLVGALAKASGNTLVRINLSEQTDITDLF------ADLPVEGGKGGEFAWRDGPLLAALKAGHWVVLDE------------LNLASQSVLEGLNACFDHRVQHEKTKIFGCQNP--------FRQGGGRKGLPRSFLNRFTQVFVDPLTV-------------DMEFIASTLFPAIEKNIVKKMVAFNNQIDH 279
74 -9.580sp|O14678|ABCD4_HUMAN ATP-binding cassette sub-family D member 4 OS=Homo sapiens GN=ABCD4 PE=2 SV=1 (Range: 301-600)  ali follow..  10  111ISEGQSLLITGNTGTGKTSLLRVLGGLWTSTRGSVQMLTDFGPHGVL-----------------------------FLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELAGLSNLV---------------ARTEGLDQQVDWNWYDVLSPGEMQRLSFARLFYLQPKYAVLDTSALTEEVESELYRIGQQLGMTFISVGHR 279
75 -9.550sp|Q9NX02|NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens GN=NLRP2 PE=1 SV=1 (Range: 151-450)  ali follow..  11  54.PFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLS--CRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRP-RALRDLRILAEEPIYIRVEGFLEEDRRAYLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGED 267

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.