current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260204|ref|NP_842581.1| pyridoxal biosynthesis lyase PdxS (BA_0010) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAIMALERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDESEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVRHMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADAALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEISTLLPEQRMQERGWLast
1 -3.300PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152  ali follow..  14  10..........RPGLFEVHRTGVVATSLVDGKRINANARNQVSLLS------EINIYGLEKEVPLQEVLTMIHTKEE----KQCSVKPKSPADELEAYFFDVFQD............................................................................................................................................................................................... 97
2 -3.200HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  16  23...KKNSFKVPEGYFENLTSEVMGKLPEKEGPAFEEVYMAAMFIGA......................................................................................................................................................................................................................................................... 78
3 -3.030PB092941 Q45777_BACTN/1-139 PB092941; Pfam-B_92941;  ali follow..  1..........................................MAKIQIKSEQITPFGGIFCVME-EFDALLSNIIDSTLGPRTKTFGYQYSEIFRSLMCVYFCGGSCVEDISTHLMSHLSFHPVLRSCSADTILRAIKELTVPNITYTSSVSGKSYDFNMADRMNELLRQGTHIYRRIKRGT................................................................................................................. 139
4 -2.770PB071107 _Gut.Meta.Jp.0066071_ gi|162701604|dbj|BAAY01026246.1||2 (+ 344:749~0 complete)  ali follow..  12  17.........LKQYAVETEEGSVVRIFPLTEEIENVEWLPGAIVLLTQDELKELDTNSPLVNAPQNYSKTSAEFYYNSTRILVKFPQNLLMACQLLPVYFSNFDITTMLPAAGTRHRL.................................................................................................................................................................................. 132
5 -2.760PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  10  1MRKELHNTKVTVRLRKSAYRNLYIESGKSEPQRVREYLN----RIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVI-QCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWK---------RAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTA...................................................................................................... 188
6 -2.570PB053244 _HOMD.0087087_ pint_c_2_2642 Prevotella intermedia 17 [158005 - 157583] (REVERSE SENSE) ORF  ali follow..  14  4.........YAIGGLLMAVGTGLAFFIIQDVACIVMLIGAICFATMQMRQQYLGTNLTIRRLRKIMVLADIGFILAGLFM....................................................................................................................................................................................................................... 75
7 -2.540HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  20  14MFFDRAVNAQRSQLLTVMADAVSECRTAADQAAELNETGQVGLLRLAEVWSAIRAKEGMGGLTEAKILSDVVAQFYAYLS....................................................................................................................................................................................................................... 97
8 -2.480PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  45.......FMLQQFIGELKESSFIMEQEKDTGQMITDQGKKTLTYFISRIPEEKRLK--IDHLLNIKKEEFVRNTEIKGEYEKLTDNEYLVKLSVIEQGTPIFNLKLSVGNVKQAKDMCEK............................................................................................................................................................................... 157
9 -1.930PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  18  2..SVREGELLDEAVDFCRKRGLEFYAVNSNPEEEADMSALRSRKVSADMYIDDRNLGGLPDWG--VIYEMVHNRWSYN......................................................................................................................................................................................................................... 76
10 -1.640PB039305 _Gut.Meta.Jp.0057508_ gi|162726131|dbj|BAAY01002830.1||2 (- 1092:1581~0 complete)  ali follow..  20  20MTVMESSVRFSKGVTEALGCPAYVKLVNDKQKKIAXDENAIKFCKTKRVDSDAAGKASSVTVRTTDVLVAVQKYFTFP......................................................................................................................................................................................................................... 109

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 9 7 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.