current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260198|ref|NP_842575.1| hypothetical protein (BA_0003) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELENRRGRKLYANDIIEIPGSGSFQVQSLast
1 -5.920sp|Q8IUI8|CRLF3_HUMAN Cytokine receptor-like factor 3 OS=Homo sapiens GN=CRLF3 PE=1 SV=2 (Range: 281-442)  ali follow..  49......RRDSIGVCAEKQDGYDSLQRDQAVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAV..... 107
2 -5.220tr|F8WCP3|F8WCP3_HUMAN Uncharacterized protein OS=Homo sapiens GN=C7orf46 PE=4 SV=1 (Range: 1-114)  ali follow..  15  1MERLTLPLGGAAVDEYLEYRRIVGEDDGGKLF...................................... 33
3 -4.280sp|Q6ZUI0|TPRG1_HUMAN Tumor protein p63-regulated gene 1 protein OS=Homo sapiens GN=TPRG1 PE=2 SV=1 (Range: 173-275)  ali follow..  18  65.KKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSI................................ 101
4 -4.270sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 (Range: 820-895)  ali follow..  20  13....TVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIET----KLIKGDIYKTRGGGQSVQ.. 72
5 -4.250sp|Q5H9I0|TFDP3_HUMAN Transcription factor Dp family member 3 OS=Homo sapiens GN=TFDP3 PE=1 SV=1 (Range: 1-100)  ali follow..  20  1...............MAKYVSLTEANEELKVLMDERPVAVHTSTVNPLGKQLLP................ 43
6 -4.240sp|Q9H7D7|WDR26_HUMAN WD repeat-containing protein 26 OS=Homo sapiens GN=WDR26 PE=1 SV=3 (Range: 124-301)  ali follow..  18  1......DEDVIRL-QHLNGLGLNQT---VDLLMQESGCRLEHPSATKFRNHVMEGD.............. 48
7 -3.760sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 2665-2774)  ali follow..  19LTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQ 88
8 -3.740sp|P38435|VKGC_HUMAN Vitamin K-dependent gamma-carboxylase OS=Homo sapiens GN=GGCX PE=1 SV=2 (Range: 505-613)  ali follow..  17  42.......................EDLGNTSIQLLQGEVTVE---AEQKNQTLREGEKMQLPAGEYHKVYT 87
9 -3.740sp|Q5SQN1|SNP47_HUMAN Synaptosomal-associated protein 47 OS=Homo sapiens GN=SNAP47 PE=2 SV=3 (Range: 49-139)  ali follow..  12  21...........................TGQLSLTSLSLRFMTDSTGEILVSFPLSSIVEIKKEASHFI.. 61
10 -3.730sp|Q5RHP9|CA173_HUMAN Uncharacterized protein C1orf173 OS=Homo sapiens GN=C1orf173 PE=2 SV=1 (Range: 1-84)  ali follow..  12  21..................LAGYFNNTRIRRHLLRSGLITRSGRILSEKEYK................... 53

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.