current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260198|ref|NP_842575.1| hypothetical protein (BA_0003) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELENRRGRKLYANDIIEIPGSGSFQVQSLast
1 -36.6001p9k_A mol:protein length:79 orf, hypothetical protein  ali model follow..  23  17......KHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQVVA. 79
2 -23.8005z81_A mol:protein length:127 Heat shock protein 15  ali model follow..  15  2..AMSSSAEEVRLDKWLWAARFYKTRSLARNMVEGGKVHYNGQRA-KPSKSVEIGAQITLR......... 59
3 -23.2001dm9_A mol:protein length:133 HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA INTERGENIC REGION  ali model follow..  12  5......PAVEVRLDKWLWAARFYKTRALAREMIEGGKVHYNGQRS-KPSKIVELNATLTLR......... 58
4 -21.8001c05_A mol:protein length:159 RIBOSOMAL PROTEIN S4 DELTA 41  ali model follow..  52...........RLDNLVYRLGLARTRRQARQLVTHGHILVDGSRVNIPSYRVKPGQTIAVREKS...... 104
5 -21.4002k6p_A mol:protein length:92 Uncharacterized protein HP_1423  ali model follow..  14  1..........MRIDKFLQSVGLVKRRVLATDMCNVGAVWLNGSCA-KASKEVKAGDTISLH......... 50
6 -20.6005nd8_d mol:protein length:200 30S ribosomal protein S4  ali model follow..  93...........RLDAVVYSLGLARTRRQARQLVNHGHILVDGKRVDIPSYSVKPGQTISVREKSQ..... 146
7 -20.3006ha1_d mol:protein length:200 30S ribosomal protein S4  ali model follow..  93...........RLDNVVYKLGLARTRRQARQLVNHGHILVDGSRVDIPSYLVKPGQTIGVREKS...... 145
8 -20.3005o5j_D mol:protein length:201 30S ribosomal protein S4  ali model follow..  14  92...........RLDNVVYRAGLARTRRMARQLVSHGHFLVNGVKVDIPSYRVSQYDIIDVKEKSL..... 145
9 -20.2005mmj_d mol:protein length:201 30S ribosomal protein S4, chloroplastic  ali model follow..  13  90...........RLDNILFRLGMAPTIPGARQLVNHRHILVNGRIVDIPSYRCKPQDTIMARDEQ...... 142
10 -20.2005v93_d mol:protein length:201 30S ribosomal protein S4  ali model follow..  14  92...........RLDNVIYRAGLARTRRMARQLVSHGHFNVNGVHVNVPSYRVSQYDIVDVRDKSL..... 145
11 -19.9003j9y_d mol:protein length:206 30S ribosomal protein S4  ali model follow..  14  97...........RLDNVVYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAK..... 150
12 -19.6001fjg_D mol:protein length:209 30S RIBOSOMAL PROTEIN S4  ali model follow..  100...........RLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKS...... 152
13 -19.0001vio_A mol:protein length:243 Ribosomal small subunit pseudouridine synthase A  ali model follow..  13  3..........LRLDKFIAENVGL-TRSQATKAIRQSAVKINGEIVKSGSVQISQEDEIYFEDELLTWIEE 61
14 -18.9001ksk_A mol:protein length:234 RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE SYNTHASE A  ali model follow..  14  1.......GSHMRLDKFIAQQLGV-SRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPL..... 57
15 -18.2005wxm_A mol:protein length:159 U3 small nucleolar ribonucleoprotein protein IMP3  ali model follow..  16  86...........RLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVT......... 135
16 -17.9001jh3_A mol:protein length:107 TYROSYL-TRNA SYNTHETASE  ali model follow..  20  22VPSFVHEGGDVPLVELLVSAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRLE........... 80
17 -17.6002cqj_A mol:protein length:71 U3 small nucleolar ribonucleoprotein protein IMP3 homolog  ali model follow..  15  9...........RLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSDFVTWVDSS...... 63
18 -17.5005xyi_J mol:protein length:185 Uncharacterized protein  ali model follow..  10  106...........RLQTQVHKRALANSVHHARTLVSHRHISVENQLVNQPAFLVWKESEKNIK......... 155
19 -17.4005oql_r mol:protein length:190 40S ribosomal protein s9-like protein  ali model follow..  106...........RLQTLVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFMVRLDSQKHID......... 155
20 -17.3004d5l_J mol:protein length:194 40S RIBOSOMAL PROTEIN US4  ali model follow..  109...........RLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHID......... 158
21 -17.3005jpq_u mol:protein length:197 uS4  ali model follow..  108...........RLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHID......... 157
22 -17.3005jb3_D mol:protein length:180 30S ribosomal protein S4  ali model follow..  104...........RLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTITYARTSPFAN 162
23 -17.2005xxu_J mol:protein length:188 Ribosomal protein uS4  ali model follow..  108...........RLQTKVFKLGLAKSIHHARVLIRQRHIRVGKHIVDIPSFMVRVDSEKHVDYAITSPFGG 166
24 -17.2003j7a_E mol:protein length:189 40S ribosomal protein uS4  ali model follow..  108...........RLQTKVFKLGLAKSVHHARVLIRQRHIRVGKQMVDIPSFLVRVDSEKHID......... 157
25 -17.0006GSN Entity 35(prereleased)  ali follow..  107...........RLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLESEKHID......... 156
26 -16.9003j80_J mol:protein length:188 uS4  ali model follow..  108...........RLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLESEKHID......... 157
27 -16.9005opt_b mol:protein length:190 40S ribosomal protein S9, putative  ali model follow..  107...........RLQTVVFKHGLAKSVHHARVLILQRHIAVAKQIVTIPSFIVRVSSEHHIA......... 156
28 -16.7005t2a_6 mol:protein length:190 uS4  ali model follow..  10  107...........RLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIA......... 156
29 -16.0003dh3_A mol:protein length:290 Ribosomal large subunit pseudouridine synthase F  ali model follow..  10  2.....LPDSSVRLNKYISESGIC-SRREADRYIEQGNVFLNGKRAT-IGDQVKPGDVVKVNGQLI..... 59
30 -15.9005jpq_b mol:protein length:183 Imp3  ali model follow..  14  110...........RLPVVMTRLRMAETVQAATKLIEQGHVRVGVEEVRDPAFLVTRNMEDFVT......... 159
31 -13.6002ktl_A mol:protein length:164 Tyrosyl-tRNA synthetase  ali model follow..  10  50..........KTFSKVLWSAGLVASKSEGQRIINNNGAYVGSRPGVKKNEPGGGMP.............. 95
32 -13.4004lab_A mol:protein length:255 Ribosomal large subunit pseudouridine synthase B  ali model follow..  15  3......GSMSEKLQKVLARAGHG-SRREIESIIEAGRVSVDGKIAKLGDREVTPGLKIRIDGHLI..... 61
33 -13.2003hp7_A mol:protein length:291 Hemolysin, putative  ali model follow..  14  5........PKERVDVLAYKQGLFETREQAKRGVMAGLVVINGERYDKPGEKIDDGTELKLKGEKLRYVS. 67
34 -12.2001h3e_A mol:protein length:432 TYROSYL-TRNA SYNTHETASE  ali model follow..  10  359IPASELKEGRIWVARLFTLAGLTPSNAEARRLIQNRGLRLDGEVLTDPMLQVDLSRILQRGKDRFVRVR. 429
35 -12.1001qyu_A mol:protein length:349 Ribosomal large subunit pseudouridine synthase D  ali model follow..  15  27..TVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVCDKPKEKVLGGEQVAIN......... 85
36 -11.8003kbg_A mol:protein length:213 30S ribosomal protein S4e  ali model follow..  19  5.......DQSVTLLSIIRYLKLSDKEREAARILANGLVKVDGKTVREKKFAVGFMDVIEINGESYRVV.. 66
37 -11.5006byq_A mol:protein length:410 Tyrosine--tRNA ligase  ali model follow..  15  340.......DEGVGILDVLKQIGFCPSTSQARRDIQGGGVKINQEVIKDESYRFVKGNYVIQLGKK...... 396
38 -11.5001jii_A mol:protein length:420 tyrosyl-tRNA synthetase  ali model follow..  13  343VPQVTLSNDTTNIVEVLIETGISPSKRQAREDVNNGAIYINGERQQDVNYALAPEDKID........... 401
39 -11.4002jan_A mol:protein length:432 TYROSYL-TRNA SYNTHETASE  ali model follow..  15  353.......GSPDGIVDLLVASGLSASKGAARRTIHEGGVSVNNIRVDNEEWVPQSSDFLH........... 404
40 -11.3002ts1_A mol:protein length:419 TYROSYL-TRNA SYNTHETASE  ali model follow..  20  342VPSFVHEGGDVPLVELLVSAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRLE........... 400
41 -10.7006bqy_A mol:protein length:408 Tyrosine--tRNA ligase  ali model follow..  15  337.......GGEIFIATILRVAGLNPNAAAAKDAVARGAVKVDWNVVDASFSVKENGTFIIQSGKK...... 393
42 -10.5004oud_A mol:protein length:425 Tyrosyl-tRNA synthetase  ali model follow..  13  355.......EKGADLMQALVDSELQPSRGQARKTIASNAITINGEKQSDPEYFFKEEDRLF........... 406
43 -10.0005t2a_1 mol:protein length:273 eS4  ali model follow..  17  36.......RECLPLLVIIRRLKYALNAREGEMILRQGLVHVDNHPRRDGKYPAGFMDVVEIPKTG...... 93
44 -10.0005opt_L mol:protein length:273 40S ribosomal protein S4  ali model follow..  19  36.......RECMTLMIIIRRLKYALNAAEAQMILRQGLVCVDGKPRKDTKYPVGFMDVVEIPRTG...... 93
45 -9.9505a2q_E mol:protein length:263 RIBOSOMAL PROTEIN ES4  ali model follow..  21  39.......RECLPLIIFLRRLKYALTGDEVKKICMQRFIKIDGKVRTDITYPAGFMDVISIDKTG...... 96
46 -9.8501wv3_A mol:protein length:238 similar to DNA segregation ATPase and related proteins  ali model follow..  27  133.................................KNTDVYINYELQEQLTNKAYIGDHIYVEGIWLEVQAD 169
47 -9.8105jb3_E mol:protein length:243 30S ribosomal protein S4e  ali model follow..  17  40.......RTSIPLLYIVRYLGYAKTAREARKILNEGKFLVDGRVRKDYKFPVGIMDVVSIPETG...... 97
48 -9.4804d5l_E mol:protein length:263 40S RIBOSOMAL PROTEIN ES30  ali model follow..  20  39.......RECLPLIVFLRRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIE......... 93
49 -9.4805xxu_E mol:protein length:263 Ribosomal protein eS4  ali model follow..  16  39.......RESAPLVVLLRRLRYALTYREVMMIVMQRLIKVDNKVRTDQCYPAGFMDVISIE......... 93
50 -9.4603j7a_F mol:protein length:261 40S ribosomal protein eS4  ali model follow..  24  39.......LESIPLVILLRRLKYALTFDEVKMILIQKIVKVDNKVRTDCTFPVGLMDVIHITKSN...... 96
51 -9.4205oql_m mol:protein length:264 40S ribosomal protein S4  ali model follow..  14  39.......RDCMPLIVFVRRLKYALNYRETKAIMMQRLVKVDGKVRTDITYPAGFMDVITIE......... 93
52 -9.3805ll6_S mol:protein length:261 40S ribosomal protein S4-A  ali model follow..  22  39.......RESLPLIVFLRRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLD......... 93
53 -9.2205xyi_E mol:protein length:255 40S ribosomal protein S4  ali model follow..  14  39.......RECLPINIFLRRLKYALTAKEAVAIVKRRLVKVDGKVRTNYRYPTGLMDVIGLG......... 93
54 -9.0904kzx_E mol:protein length:263 40S ribosomal protein S4X  ali model follow..  21  39.......RECLPLIIFLRKLKYALTGDEVKKICMQRFIKIDGKVRADITYPAGFMDVISIDKTG...... 96
55 -9.0303j80_E mol:protein length:261 eS4  ali model follow..  22  39.......RESLPLIVFLRRLKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVITLE......... 93
56 -9.0006GSN Entity 31(prereleased)  ali follow..  22  38.......RESLPLIVFLRRLKYALNGREVKAILMQRHVKVDGKVRTDTTFPAGFMDVITLE......... 92

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 2 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.