current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260204|ref|NP_842581.1| pyridoxal biosynthesis lyase PdxS (BA_0010) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAIMALERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDESEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVRHMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADAALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEISTLLPEQRMQERGWLast
1 -109.000[H] COG0214 Pyridoxine biosynthesis enzyme  ali follow..  80  1MEKKVGTDRVKRGMAQMQKGGVIMDVVNAEQAKIAEEAGAVAVMALERVPSDIRAAGGVARMADPRIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDESEVLTPADDEFHLLKSDFTVPFVCGCRDIGEALRRIGEGAAMLRTKGEPGTGNIVEAVRHMRQVNGQIRQIASMTDDELMVAAKNFGAPYELVKEIKTLGKLPVVNFAAGGVATPADAALMMELGADGVFVGSGIFKSDNPAKFASAIVQATTYYTDYELIGKLSKELGSPMKGIEMSRLNPEDRMQDRSF 295
2 -108.000[H] KOG1606 Stationary phase-induced protein, SOR/SNZ family  ali follow..  65  3.AEIKGSTQVKAGLAQMLKGGVIMDVVNAEQARIAEAAGACAVMALERVPADIRAQGGVARMSDPSMIKEIQAAVSIPVMAKVRIGHFVEAQILESIGVDYIDESEVLTPADDINHIEKSKFTVPFVCGSRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHTRQMQGELRRVKSMSPDELYTYAKEIAAPIDLVKECAQLGRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIFLSGDPAKRARAIVRAVTHYNDPKILAEVSENLGAAMVGRSVSSLEEKEKLATRGW 296
3 -31.200[H] COG2022 Uncharacterized enzyme of thiazole biosynthesis  ali follow..  13  1.................MSSGRNISCRMATRSYFFRLLQGVEMLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRVDLRLEPLIAAGVTLLPNTSGAKTAEEAIFAAKLEIHPDARWLLPDPIETLKAAETLVQQGFVVLPYCGADPVLC-----------KRLEEVGCAAVMPLGAPIGSNQGLETLEIIIQQATVPVVVDAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVNMAKAFRLAVEAGLLAPQSGPGSRSATSPLTGF................ 276
4 -17.700[G] COG3010 Putative N-acetylmannosamine-6-phosphate epimerase  ali follow..  12  6..........HPQVLEQIKYGLIASCQPVDNAQASVIGGAAGL-----------------RIEGIENLKATRNVVNVPIIGIVK---------------RDLPDSPVRISPFLQDIEELAAAGADIIAFDGTDRVRPTTREAIIKRIKELGCLAMAD-CSNFEEGMYCHNLGVEIIGSTMSGYTGGEIPAEPDYQLVKDLNAAG---CRVMAEGRYNTPELAKTAIEIGAYSVTVGSALTRLEHIVSWFADAVKSAK...................................... 228
5 -16.100[R] COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold  ali follow..  15  3......KMKVEDYFHDILRERIHLTLIDPEEARAAIRGGTDGIML-----------GGS-SSELDNTARALRENIDVPIILFPGNTTGV------SRYADAIFFMSLLNSTNPYWIIGAQALGAATVMGIEALPMGYLVVEPGGTVGWVGDTKPVPRNKPDIAAAYAMAAEFLGMRLF-----LEAGSGAPEHVPEEMIALVKRCTDQILIVGGGIRSGEDAARVAGAGADVVVTGTVVENSDNVEDKIREIVEGMGS..................................... 247
6 -13.200[E] COG0134 Indole-3-glycerol phosphate synthase  ali follow..  19  59........EIKK--ASPSKGVLREDFRPAEIAISYELGGASCLSVL----TDVHFFKG-----HDDYLSQARDACTLPVLRKDFTIDPYQVYEARVLGADCI------------------------------LIVAALDDAQLVDLSGLALQLGMDVLVEVIDELERAIQISAPLIGINNRNLSTFNVSLETTLTMKGLVPR----DRLLVSESGILTSADVQRLRAAGVNAFLVGEAFMRATEPGESLREMF.......................................... 261
7 -12.000[E] KOG4201 Anthranilate synthase component II  ali follow..  18  185........EVKK--ASPSRGILKENFDPVEIAQAYEKGGAACLSVL----TDQKYFQG-----GFENLEAIRSAGKCPLLCKEFVVDPWQIYYARTKGADAV------------------------------IAAVLLEITFLLKICKKLSLAALVEVHDEREMGRVLGIEGIELVGINNRSLETFEVDISNTKKLLEGEHGRQIREMIVVGESGLFTPDDIAYVQAAGVKAVLVGESIVKQNDPEKGIAGLF.......................................... 395
8 -10.400[R] COG0434 Predicted TIM-barrel enzyme  ali follow..  13  14LPPLPGSPGYKGELDEVID-------RAISDAAKYQEAGFDAIILENYGDFPYSKTVGKETVSA-VVANEVKREIALPLIAAYSIAYSIKADFIRVNVLTAFTDQGIVEGCARELAELRTRLPSRIDVLADVHVKHATHFSNFENALLDTIERGGADAVIVTGSRTGSEVDIQELITA------------------------KRISPVPVLVGSGV-NPRNIKLFWRY-SDGFIVGTWVKEGGRSIERATKLAKLVKSLREG................................. 259
9 -9.630[G] COG0269 3-hexulose-6-phosphate synthase and related proteins  ali follow..  13  8.....................VALDNQTMDSAETTRLIGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQ----------------------------------------------------AAGVAWGEADITAIKRLSDMGFKVTVTGGL-ALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAE..................................... 213
10 -9.530[K] COG1954 Glycerol-3-phosphate responsive antiterminator (mRNA-binding)  ali follow..  11  4.............LHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISQIVKKIKNAGKYAF------IHVDLLEGASNKEVVIQFLKLVTEADGI--STKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVT----------------------------------------EKIRQPLIAGGLVCDEEDARNAINAGVVALSTTN.......................................................... 180
11 -9.450[I] COG4981 Enoyl reductase domain of yeast-type FAS1  ali follow..  13  25VEHVDGTPRLVTKFTELTLAGMTPTTVDPAIVAAAANGGHWAEL-------------AGGGQVTPELLETHIANAQFNSMMQIGGKRLVPKARANGASIDGIVITAGIPEKDEAV-------------------ALVKELMRDGFPWIAFKPGAIKQVNSVLAIAKEVPELPIIIQIEGGVAGGHHSWEDLDELLIATYGKVRALDNVVLCVGGGIGSPERAADYVTMPVDGILVGTAAMATKESQAVKELLVSTVPAGGAKNGMASGRSQLGADIHEIDNSFAKAGRLLDE... 328
12 -9.370[S] COG1891 Uncharacterized protein conserved in archaea  ali follow..  14  3.....................LLISPINTEEALEAIEGGA--IVDVKN-------AEGSLGANFPWVIRRVREMTPEDMLVSATLGDVLAAMGALVSGADYI------------------KVGLYGTRNYDEAVDVMKNVVRAVKD------------QSDAIVVAAGYADAHRVGAVEPMEIPRVAADSGAD-KLESFVSAARDHGLKSALAGSV-GREHLKPLHEIGCDVVGIRGAACVGGDHRDAVRELKELLDS..................................... 235
13 -9.350[E] COG0107 Imidazoleglycerol-phosphate synthase  ali follow..  16  13.................VDNGRVVKGVKVEIARRYDEQGADEITFLD-------TASVDGRDTTLHTVERMASQVFIPLTVGGGVRSVQDIRNLLNAGADKVSINTAAVFNPEFVGEAADRFGSQCIVVAIDAKKVSAPGEAPRWEIFTHGGRKPTGL--------DAVLWAKKMEDLGAGEILLTSDGVKSGYDLGVTRAISEAVNVPVIASGGVGNLEHLAAGILEGADAVLAASIFHFGEYTVPEAKAYLAS........................................ 250
14 -9.150[R] COG2070 Dioxygenases related to 2-nitropropane dioxygenase  ali follow..  12  1MQNIFDPLVIRGKSLPIVQGGMGVGVSASGLSSAVARENGIGTIASVDLRHLEEKYTSLNCTALDREIQKAKSASEGK-VMKAVKDHAAYVRQACESGADAVVMGAGL-PLDLPEMTEGYHKDVALLPILSESRGINIVLKRWMKKGILPDAIVVEHPAHAAGHLGASTVEGVNDAKFDFKRVIEETFEVFKSL-------GLESEKIPLILAGGMANFEKVKTALNWGASAVQIGTAFAVTEEHLNFKKTLAGA........................................ 270
15 -9.070[R] COG1411 Uncharacterized protein related to proFAR isomerase (HisA)  ali follow..  13  1MFRVVFVMDIFNRNVVLAKGG----CRTSAPLEIVEALRPREVYIAD-------LNALQGKGPLDINAEVIRESLKADTMLDFGVSCLGDVDRALSIAGTAVLGTETGKLSVIRDAVARCP------------GRISVSIDVKYGKLLKQDPEIPEDPFEIVKLLNELPLKDLIFLDLDRV-------GTASGFDPEFLHKLAETSIHDVLLAGGVRGMEDLFTLDRLGIKGALVATAIHSGEVPLEVMNLGLEQIKRDD................................... 245

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.