current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|30260198|ref|NP_842575.1| hypothetical protein (BA_0003) [Bacillus anthracis str. Ames], from B.anthracis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# E-value Template Links and tools%idFirst MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELENRRGRKLYANDIIEIPGSGSFQVQSLast
1 1.000e-24UniRef50_A0A0C7NN12 RNA-binding S4 domain n=2 Tax=Moorella group TaxID=42857 RepID=A0A0C7NN12_9THEO  ali  36  28.KNVPITTPSIRLDQFLKWAGIAATGGQAKEMIAGGLVRVNGQTEKRRSHTLGPGDEVEVKGASYK.... 92
2 4.000e-24UniRef50_A0A1C5X0V6 Ribosome-associated protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1C5X0V6_9CLOT  ali  50  1MMEITIDTEYIKLDQFLKLVDFASTGGHAKFLIQEGVVKVNGEVETRRGKKIRPGDIVEVEGQKIKVV.. 68
3 1.000e-23UniRef50_A0A2W4MUK0 RNA-binding S4 domain-containing protein n=2 Tax=Caldicoprobacter TaxID=715222 RepID=A0A2W4MUK0_9FIRM  ali  44  1MQEIRIHTEYIKLTQFLKWANIAATGSEANQMIRSGMVKVNGQVELRRGRKLYPGDCVEVKGAGLYCVIG 70
4 4.000e-23UniRef50_A0A1H0ZF35 Ribosome-associated protein YbcJ, S4-like RNA binding protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1H0ZF35_9ACTN  ali  41  45MEDVEIRDETIRLGQLLKLAGVVEHGAEAKSLVQAGEVRVNQEVETRRGRQLVPGDEVSVGGQTLRVSTG 114
5 4.000e-23UniRef50_R8VWL0 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=R8VWL0_9CLOT  ali  35  1MREIQIQSEFIKLDALLKFANLVSSGGEAKIRISEGEVLVNGEPCLMRGKKLRPGDTVTLDGETVKII.. 68
6 5.000e-23UniRef50_A0A2G3PXY5 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2G3PXY5_9FIRM  ali  37  1MKEIKINTEFIKLDQLMKFANLVQSGGEAKGLIAQELVLVNGEICTQRGKKIRPGDQVEFDGEVVCV... 67
7 9.000e-23UniRef50_E3EDS5 RNA-binding protein S4 n=34 Tax=Bacteria TaxID=2 RepID=E3EDS5_PAEPS  ali  57  1MKAISIQTEYIKLDQFLKLADCVSTGGMAKALLQEGQVRVNGEPEERRGRKLYPGDTVEVEDIGRFEVTA 70
8 1.000e-22UniRef50_A0A1W9Z3W4 RNA-binding protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1W9Z3W4_9MYCO  ali  41  1MEDVPIRDESIRLGQFLKLAGLIDTGADAKSVIADGLVSVNGEVDTRRGRQLHPGDEVSFAGRSARV... 67
9 2.000e-22UniRef50_A0A2M7G1R8 RNA-binding protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2M7G1R8_9BACT  ali  44  1MSECAIQTEVIELAQFLKLADLCQTGGEAKYAIQNGEVMLNGELETRRSKKLHPGDVVAYQGREVKVVKA 70
10 2.000e-22UniRef50_B0A626 Ribosome-associated protein n=5 Tax=root TaxID=1 RepID=B0A626_9FIRM  ali  50  1MLELKIESEYIKLDQFLKLADIASTGGHAKYLIQEGVVKVNGEVEMRRGKKLVPGDIVEVEGNQIKVI.. 68
11 3.000e-22UniRef50_A0A255INH5 RNA-binding protein n=2 Tax=Firmicutes TaxID=1239 RepID=A0A255INH5_9FIRM  ali  45  1MIEITIDSEYIKLDQFLKFVDIASTGGHAKFLIQEGLVKVNGEIELRRGKKIRTGDVVEVEGNTIKVV.. 68
12 3.000e-22UniRef50_A0A2K2F7J9 RNA-binding protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2K2F7J9_9FIRM  ali  46  1MKLVKIETEYIRLDQFLKWAGIADTGSHAKILIAEQNVKVNGQVETQRGKKLRKGDTVEINGNVLQV... 67
13 4.000e-22UniRef50_E4RNG8 RNA-binding S4 domain protein n=14 Tax=Bacteria TaxID=2 RepID=E4RNG8_HALHG  ali  37  1MEKIEINTDTINLDQFLKWANIAMSGGEAKYLIQEGEVTVNGEVETQRGKTLKVGDVVSLNDKKYIVSRG 72
14 7.000e-22UniRef50_C6IWT8 S4 domain protein YaaA n=148 Tax=Bacteria TaxID=2 RepID=C6IWT8_9BACL  ali  58  1MKIIPISSEYIKLDSFLKLADCVPTGGMAKAILQEGAVKVNGKPEERRGRKLYPGDSVEVEGCGSFQVAG 70
15 7.000e-22UniRef50_A0A0C7QPN2 RNA-binding mediating protein n=36 Tax=Bacteria TaxID=2 RepID=A0A0C7QPN2_PAESO  ali  50  1MLEIKIDSEFIKLDQFLKLVDIASTGGHAKFLIQEGLVKVNGEIETRRGKKLRSNDIVEVEGNTIKI... 67
16 7.000e-22UniRef50_G4KPV8 Uncharacterized protein n=32 Tax=root TaxID=1 RepID=G4KPV8_OSCVS  ali  43  1MKTIIINTEYVKLQDLLKLANLVSSGGEAKERIQAGEVMVNGEICTQRGKKLRPGDVARIDGQD...... 64
17 8.000e-22UniRef50_A0A1Y4RXC3 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4RXC3_9FIRM  ali  44  4.KEIKISTEFIKLEAFLKFAGAVSTGGEAKNLIQDSLVKVNGEVCTMRGKKLRPGDTVELGGQSLTVV.. 70
18 8.000e-22UniRef50_D1AIS8 RNA-binding S4 domain protein n=3 Tax=Bacteria TaxID=2 RepID=D1AIS8_SEBTE  ali  44  1MKEVEIKTEFIKLDQLLKWAGMVGDGGEARYHILEGNVRVNGETEKRRGKKIYENDIIELDGEKIKIVRG 70
19 1.000e-21UniRef50_A0A1C6J3D0 Ribosome-associated protein n=84 Tax=Bacteria TaxID=2 RepID=A0A1C6J3D0_9FIRM  ali  34  1MKEIPIHTPFIKLDALLKFAGLCATGGEAKIRITQGEVTVGGQVCTQRGKKIYPGDTVCLQGREIEV... 68
20 2.000e-21UniRef50_B6G1U5 S4 domain protein YaaA n=4 Tax=cellular organisms TaxID=131567 RepID=B6G1U5_9FIRM  ali  51  1MIEIKIDSEYIKLDQALKLADIASTGGHAKFLIAEELVKVNGEVETRRGKKLFDGDIIEVEGEMIKVV.. 68
21 2.000e-21UniRef50_A0A1Y4T9K1 Uncharacterized protein n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4T9K1_9FIRM  ali  32  1MERVVIHTDYIKLDALLKFAGLCETGGEAKERIQAGQVLLNGQVCTMRGKKCVPGDTVELEGRAVRIAEG 70
22 2.000e-21UniRef50_R5VIT5 S4 domain protein n=4 Tax=Clostridiales TaxID=186802 RepID=R5VIT5_9FIRM  ali  35  7..TVTIHTPFIKLDALLKFAGLCDTGGFAKELVQQGVVSVNGSVCTMRGKKIYPNDVITVDHFEVQV... 71
23 3.000e-21UniRef50_A0A1C6HB91 Ribosome-associated protein n=10 Tax=Bacteria TaxID=2 RepID=A0A1C6HB91_9CLOT  ali  38  1MESIHLKDEFIKLGQALKLAGLVGSGVDAKFVIQDGLVKVNGEVETQRGKKLYPGDTVSYDGKTFKV... 67
24 4.000e-21UniRef50_A0A0B2YEY5 tRNA synthetase RNA-binding protein n=116 Tax=Bacteria TaxID=2 RepID=A0A0B2YEY5_9MYCO  ali  42  4.EDVPIRDESIRLGQFLKLASLIDSGADAKAVIADGLVSVNGEVELRRGRQLRPGDEVSLGGSSARVVTG 72
25 4.000e-21UniRef50_A0A2N5I1F9 S4 domain-containing protein YaaA n=3 Tax=Bacillales TaxID=1385 RepID=A0A2N5I1F9_9BACI  ali  64  1MKEIQISTEYITLGQFLKVADIIQSGGMAKWFLSEHEVFINGELDTRRGRKLRAGDRIEIPNAGNFLITG 70
26 4.000e-21UniRef50_L0K4U5 Uncharacterized protein n=11 Tax=Terrabacteria group TaxID=1783272 RepID=L0K4U5_HALHC  ali  41  1MKKIEIKTDTINLDQFLKWANLVSTGGEAKVIIQAGKVKVNGEIETQRSKTLTSGDKIEYGGTNYQI... 67
27 6.000e-21UniRef50_A0A017HCW8 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit n=16 Tax=Alphaproteobacteria TaxID=28211 Re  ali  22  15........ETIRLDKWLFQARFLKSRGLAADLIGEGKVRVNGQPTDKPARAVGPGDVLTFALHGRVRVV. 75
28 6.000e-21UniRef50_K4ZPK8 S4 domain protein YaaA n=105 Tax=Bacteria TaxID=2 RepID=K4ZPK8_PAEAL  ali  52  1MNDIEIRTEFITLGQFLKLANCASTGGHAKIMLAENMVKVNGEDEARRGRKLYPGNVVTVDGCGEFRIVS 70
29 7.000e-21UniRef50_A0A0J1DLV3 Uncharacterized protein n=4 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1DLV3_9FIRM  ali  34  1MQEVRIKTETIQLDQLLKWANVVSSGAEAKIMIQSGLVSLNGVVETRRAKKVMPGDEVTVEGYGTIKVAA 70
30 1.000e-20UniRef50_E2S5G3 S4 domain protein n=6 Tax=Corynebacteriaceae TaxID=1653 RepID=E2S5G3_9CORY  ali  40  1MLDIPINGDSIKLGQFIKLASLVATGGEAKELIAEGVVTVNGEPETRRGAMLHPGDEVCIEDACARV... 67
31 1.000e-20UniRef50_C5UW13 S4 domain protein YaaA n=15 Tax=Firmicutes TaxID=1239 RepID=C5UW13_CLOBO  ali  39  5MNKIEINTEIIKLDAFLKWSGIASLGSEAKIYIQEGLIKVNGEICLQRGKKLKAGDIIEFEDEKFEIV.. 72
32 1.000e-20UniRef50_A0A1V5J0I4 Ribosome-associated protein n=1 Tax=Firmicutes bacterium ADurb.BinA052 TaxID=1852896 RepID=A0A1V5J0I4_9FIRM  ali  46  6MKDLVIRTEYIQLDQALKLAGLVGSGGEAKAAIQGGSVLVNGATETRRGRKLRPQDVIEFDGIVMRI... 72
33 2.000e-20UniRef50_A0A2V2DUS0 RNA-binding S4 domain-containing protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2DUS0_9FIRM  ali  38  1MKQISIDTPFIRLCDLLKYSGAAETGGQAKLVIQSGEVLVNGEVCTMRGKKLYHGDVAAYGGAEYEV... 68
34 2.000e-20UniRef50_F5LHF2 S4 domain protein YaaA n=78 Tax=Terrabacteria group TaxID=1783272 RepID=F5LHF2_9BACL  ali  63  1MKEVTIRTEYITLGQFLKLADCIQTGGQAKSFLQEAHIEVNGEIENRRGRKLYSGDKVAVEGCGEFVV.. 68
35 2.000e-20UniRef50_G2MSF8 S4 domain protein YaaA n=37 Tax=Terrabacteria group TaxID=1783272 RepID=G2MSF8_9THEO  ali  49  1MIEVPIETEYITLGQFLKYMKICQTGGQAKKFILEGKVKVNGAIELKRGKKLHKNDIIEVEGKTYII... 67
36 2.000e-20UniRef50_F8FH09 YaaA n=166 Tax=Bacteria TaxID=2 RepID=F8FH09_PAEMK  ali  62  1MKTVSIHTDYITLGQFLKLADCISTGGQAKPFLEETPITVNGEPENRRGRKLRPSDIIKVQGCGEFQVV. 69
37 3.000e-20UniRef50_V5XCM8 tRNA synthetase RNA-binding protein n=141 Tax=Bacteria TaxID=2 RepID=V5XCM8_MYCNE  ali  38  1MDNVPIRDGSIRLGQFLKLAGLIDSGADAKSVIAEGLVTVNGEVDLRRGRQLRPGDEVSFADRSARV... 67
38 3.000e-20UniRef50_A0A1S2GIQ0 RNA-binding protein n=16 Tax=Bacteria TaxID=2 RepID=A0A1S2GIQ0_9MICC  ali  34  9...LQIRDESIRLGQLLKLASFAEDGFHAKQMIEDGLVKVNGEIETRRGAQIRNGDTVSVNGESITV... 72
39 3.000e-20UniRef50_A0A0P7JLA2 tRNA synthetase RNA-binding protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0P7JLA2_9RHOB  ali  16  1..........MRADKWLWHARFFKTRGLATKLIAAGHLRVNGEKISKPAFQIGPGDVLTFPQARLVRVV. 59
40 5.000e-20UniRef50_A0A2I0N1J7 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0N1J7_9CLOT  ali  27  2MEQIVIDSDFIRLDALMKLANWANSGGEAKHLIQEGGVRVNGTACLERSKKIRPGDRVSFAAKTLLVTRA 72
41 5.000e-20UniRef50_A1SHC1 RNA-binding S4 domain protein n=27 Tax=Actinobacteria TaxID=201174 RepID=A1SHC1_NOCSJ  ali  36  8..DVPIRDESIRLGQFLKLANLVESGADAKPVIADGLVRVNGEVETRRGRQLVVGDVVTLGPAAARV... 72
42 5.000e-20UniRef50_U5MN19 S4 domain protein YaaA n=297 Tax=Bacteria TaxID=2 RepID=U5MN19_CLOSA  ali  36  1MNKIKINTEIIKLDAFLKWAAIVSSGSEAKLYIQDGLVKVNNEICTQRGKKLKIGDVVSFEDSDFEII.. 68
43 5.000e-20UniRef50_D8FNG4 S4 domain protein YaaA n=19 Tax=Bacteria TaxID=2 RepID=D8FNG4_LACDE  ali  42  4IETFAINGEFITLGQFLKDECIVSSGGQAKWYLKDSPVLVNGDKEDRRGRKLYPGDRLSVAGKEYELVQG 73
44 7.000e-20UniRef50_J9RE58 Uncharacterized protein n=33 Tax=Bacteria TaxID=2 RepID=J9RE58_9ACTN  ali  39  7..DVTIRDESIRLGQFLKLANLIESGAEAKEVIADGLVSVNDEVETRRGRQLAIGDVVSVGGMSVRVVSG 74
45 8.000e-20UniRef50_A0A1K1PXY9 Ribosome-associated protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1K1PXY9_RUMFL  ali  35  5...IKINTEFIKLDSLLKFASLVNSGGEAKQLIQNGEVLVNGEVCTMRGKKIRPGDAVYVNCQEVIV... 68
46 8.000e-20UniRef50_D4ZTV5 Uncharacterized protein n=24 Tax=Bacteria TaxID=2 RepID=D4ZTV5_ARTPN  ali  37  3...VKVTEQNIKLDKFLKRSGLVQSGGQAKAFIQSGYVMVNGEIETRRGRKLIEGDRVTFNGETFPV... 66
47 9.000e-20UniRef50_A3DHZ6 S4 domain protein YaaA n=26 Tax=Bacteria TaxID=2 RepID=A3DHZ6_CLOTH  ali  44  1MENIKINTEFIKLDQFLKWTKTVSMGSEAKLMIRSGLVKVNGEVELRRGRKLRTGDIVEINDKKFQIV.. 68
48 9.000e-20UniRef50_A0A150LIR3 RNA-binding protein n=4 Tax=Bacillales TaxID=1385 RepID=A0A150LIR3_9BACI  ali  63  1MKTVNIDTEYITLGQFLKLTDLISTGGAAKRFLQTEEVYVNGERETRRGRKLRDGDEVFVPGSGKFFIK. 69
49 9.000e-20UniRef50_C9MZV9 S4 domain protein YaaA n=107 Tax=Bacteria TaxID=2 RepID=C9MZV9_9FUSO  ali  40  8IEEVVINTEFIKLDQLLKWANFTGSGVEAKMFIQNGEVKVNNAVETRRGKKIYDGDIVEFAGEKVLV... 74
50 1.000e-19UniRef50_A0A2N6BHV5 S4 domain-containing protein YaaA n=104 Tax=root TaxID=1 RepID=A0A2N6BHV5_9DELT  ali  47  1MIEVSITTEYIKLDQLLKLADLVAGGGEAKVIIQGGEVRVNGEVETRRGRKLRPGDSVELGGTEVLV... 67
51 1.000e-19UniRef50_F6BKV3 RNA-binding S4 domain protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=F6BKV3_THEXL  ali  40  2MEEVKINTEYITLDQFLKYVGIAETGGKGKQMILEGLVKVNGNIELKRGKKLRKGDTVIVDEKKFVI... 68
52 1.000e-19UniRef50_D0GPF2 S4 domain protein YaaA n=3 Tax=Bacteria TaxID=2 RepID=D0GPF2_9FUSO  ali  44  12......NTEFIKLDQFLKWTNFVISGAEAKLFIQEGQVKVNGDTETRRGKKLYSGDIVEFKGEKVKI... 72
53 1.000e-19UniRef50_A0A078KPW9 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A078KPW9_9FIRM  ali  38  5.KKIKINTEYIKLDQLLKFAGLTMTGGEAKTAVASGSVMVNGAPCLLRGKKIRAGDTVSYNGVVIEVI.. 71
54 2.000e-19UniRef50_C0ZL90 Uncharacterized protein n=42 Tax=Actinobacteria TaxID=201174 RepID=C0ZL90_RHOE4  ali  41  45IPAVPIRDEMIRLGQFLKLANLIESGAEAKEVIADGMVSVNGEVEDRRGRQLRDGDVVEIGGMAAKV... 111
55 2.000e-19UniRef50_A0A265Q2V0 RNA-binding protein n=1 Tax=Tissierella sp. P1 TaxID=1280483 RepID=A0A265Q2V0_9FIRM  ali  50  1MKEISIETDYIKLDQFLKLAGITQTGGQAKIMISEGSIIVNNEVTLQRGKKIMKNDIVEIKGYGYFVV.. 68
56 2.000e-19UniRef50_C6WCR0 RNA-binding S4 domain protein n=18 Tax=root TaxID=1 RepID=C6WCR0_ACTMD  ali  35  3IREVEIADDMIRLGQFLKLAGLAEHGAHARELVEEGEVTVNGRPESRRGAQLKNGDVVAVDGEKARLV.. 70
57 3.000e-19UniRef50_V8D4M3 RNA-binding protein S4 n=24 Tax=Actinobacteria TaxID=201174 RepID=V8D4M3_9ACTN  ali  40  4.ETVPIRDNSIRLGQFLKLANLIESGAEAKEVIADGLVSVNGETETRRGRQLVTGDVVEIGGTEAVV... 69
58 3.000e-19UniRef50_Q0F1Y6 Uncharacterized protein n=10 Tax=root TaxID=1 RepID=Q0F1Y6_9PROT  ali  31  1MRNVEISEEPIELYKLLKFENLASSGGEAKHVIAEGLVKLNGRLETQKRKKIVVGDIVEFAGEKICI... 67
59 3.000e-19UniRef50_A0A1V2SKV3 Uncharacterized protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1V2SKV3_9BACI  ali  64  1METIVIQTDTITLGQFLKLADLIDSGGMAKWFLSEHTVLVNGEPEQRRGRKLYEGDRIEVQGAGSFLV.. 69
60 3.000e-19UniRef50_D5UDU7 RNA-binding S4 domain protein n=18 Tax=Terrabacteria group TaxID=1783272 RepID=D5UDU7_CELFN  ali  40  7...VTRSDDPIRLGQFLKLVNLAESGGHARALLDDGAVTVNGEPETRRGRQLRPGDVVEVDGVESATVEG 76
61 3.000e-19UniRef50_A0A1I3G0H7 Ribosome-associated protein n=9 Tax=cellular organisms TaxID=131567 RepID=A0A1I3G0H7_9PLAN  ali  36  10.......EESLRLDQFMKITGLAQTGGQAKLVIQGGEVTVNGQVETRRRRKLVPGDLVSFDGHELEV... 69
62 3.000e-19UniRef50_C3PJ32 Uncharacterized protein n=39 Tax=Terrabacteria group TaxID=1783272 RepID=C3PJ32_CORA7  ali  37  11MLEVSIRGESIKLGQFLKLASLVATGGEAKELIEQGQVTVNGEVTKQRGATLALGDVICVSDTCARVVED 80
63 4.000e-19UniRef50_UPI000A05DDB9 RNA-binding S4 domain-containing protein n=1 Tax=Patulibacter minatonensis TaxID=298163 RepID=UPI000A05DDB9  ali  37  49.RDVEIRGDMVRLGQLLKLSGAVDSGGEAKAALQEGLVTVNGEPEERRGRQLRDGDVVAFQDEVLRIVAA 117
64 4.000e-19UniRef50_A0A174UNP1 Ribosome-associated protein n=7 Tax=Clostridiales TaxID=186802 RepID=A0A174UNP1_9FIRM  ali  43  37METIILRGEYIKLGQALKAAGMVESGVEAKEVIQEGLVMVNGETDTRRGRKLYGGDIVLFDGEEIRI... 103
65 4.000e-19UniRef50_A0A1E4LFX5 Uncharacterized protein n=1 Tax=Clostridium sp. SCN 57-10 TaxID=1660094 RepID=A0A1E4LFX5_9CLOT  ali  23  4..EVSVRPPFIRLDALLKLCNLVQSGGEAKTLIQEGQVCLNGAICTERSKKIREGDVVILGDELIRV... 68
66 4.000e-19UniRef50_P05650 Probable ribosome maturation protein RlbA n=415 Tax=Bacteria TaxID=2 RepID=RLBA_BACSU  ali  68  5...ISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEPDNRRGRKLYVGDVVEIEGFGSFQVVN 71
67 4.000e-19UniRef50_A0A1G3FXB3 Uncharacterized protein n=1 Tax=Rhodobacteraceae bacterium GWF1_65_7 TaxID=1802013 RepID=A0A1G3FXB3_9RHOB  ali  17  1MKQVVAPRATIRLDKWLWQARFFKSRPVACAEIAEGHLRLNGMRCMKPGHQVGEGDTLTFPGRRIRLIR. 70
68 5.000e-19UniRef50_A0A174DAC3 Ribosome-associated protein n=80 Tax=Bacteria TaxID=2 RepID=A0A174DAC3_9FIRM  ali  42  1MEEIKIRDEFIKLGQLLKLADMVQDGVEAKYVITDGLVKVNGEVDDRRGRKVYEGDIVSYDGKEIKVIR. 69
69 6.000e-19UniRef50_D1BR77 RNA-binding S4 domain protein n=74 Tax=Bacteria TaxID=2 RepID=D1BR77_XYLCX  ali  38  7.EAVPIRDDMIRLGQFLKLAGLADSGNEARDLIADGEVSVNGEVETRRGRQLGRGDVVAVRGERAAVV.. 76
70 6.000e-19UniRef50_I3VST5 RNA-binding S4 domain protein n=25 Tax=Terrabacteria group TaxID=1783272 RepID=I3VST5_THESW  ali  39  2MEEVKISTVYITLDQFLKYVGIAETGGKGKQMILDGLVRVNGNIELKRGKKLYRGDTVSVNDRQFVII.. 69
71 6.000e-19UniRef50_A0A097AN55 S4 domain-containing protein YaaA n=10 Tax=Terrabacteria group TaxID=1783272 RepID=A0A097AN55_THEKI  ali  46  1MIEVAITTDYITLGQFLKYVKVCETGGQAKQLILDGKVKVNGAIELKRGKKLRKNDIIEVEGKIYVI... 67
72 7.000e-19UniRef50_A0A1C7IDP0 RNA-binding protein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1C7IDP0_9FIRM  ali  40  1MEIIKLKDEFIKLGQALKAANLVEDGVEAKYVIQDGLVKVNGETDTRRGRKLYDGDLVAYDGQEIKIVK. 69
73 7.000e-19UniRef50_A0A133ZSD9 S4 domain protein YaaA n=2 Tax=Gemella haemolysans TaxID=1379 RepID=A0A133ZSD9_9BACL  ali  55  32MKEVFINSEYITLAQFLKLEGFIGSGGEAKYFLQEVEVELNGELENRRGKKLYSNDVIKLEGNEFIII.. 99
74 8.000e-19UniRef50_A0A1B1S851 Pseudouridine synthase n=2 Tax=Muribaculaceae TaxID=2005473 RepID=A0A1B1S851_9BACT  ali  27  275...IPDPNEQIRLNKFMANAGIC-SRREADEFIQQGLVKVNGEVVTELGTKISHNDVVEYDEKVV..... 335
75 9.000e-19UniRef50_A0A1M6LU81 Ribosome-associated protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A1M6LU81_9BACT  ali  34  1MQEFQLKTEYIELLKLLKRLGFAETGGHAKVLVEEGEISLNGQPEFRKRAKLRDGDEVEIMGEKIII... 67
76 1.000e-18UniRef50_A0A174SF70 Uncharacterized conserved protein n=2 Tax=Anaerotruncus colihominis TaxID=169435 RepID=A0A174SF70_9FIRM  ali  30  2..QVTITTPFIKLDALLKFAGAVQTGGQAKEWITGGMVRVNGELCAMRGKKIRPGDLVNVGELEIEV... 66
77 1.000e-18UniRef50_W4P3X7 Ribosomal large subunit pseudouridine synthase B n=1 Tax=Bacteroides pyogenes JCM 6292 TaxID=1235809 RepID=W4P3X7_9BACE  ali  21  66.EQYVDPNEPIRLNKFLANAGIC-SRREADEFITAGVVSVNGEVVTELGTKIKRSDVVKFHDEPVSI... 130
78 1.000e-18UniRef50_A0A174EGE3 Ribosome-associated protein n=15 Tax=Clostridiales TaxID=186802 RepID=A0A174EGE3_9FIRM  ali  43  12MEIIKLRDEFIKLGQALKAAGLVDSGVEAKEAVQDGLVKVNGETDTRRGRKLYDGDRVEFDGQEIKI... 80
79 1.000e-18UniRef50_A0A2N6RBP7 S4 domain-containing protein YaaA n=46 Tax=Bacilli TaxID=91061 RepID=A0A2N6RBP7_9BACI  ali  59  3.KPVKIDSEFITLGQFLKLADVIQSGGMAKWFLSEYEIFVNNEPENRRGKKLRDGDVLYIPDFGTYIVKN 71
80 1.000e-18UniRef50_Q31S56 RNA-binding S4 n=49 Tax=Terrabacteria group TaxID=1783272 RepID=Q31S56_SYNE7  ali  37  4......ETATIRLDQFLKWMGAAQTGGEAKLYIQDGQVEVNGMVETRRGRQLREGDRVNFAGQVFLV... 64
81 1.000e-18UniRef50_A0A094Y0A6 RNA binding protein involved in ribosome maturation n=44 Tax=Terrabacteria group TaxID=1783272 RepID=A0A094Y0A6_LACSK  ali  54  3.QEIKLEAEFVTLGQLLKEAGIIETGGKAKWFLRENTVLVNGEPDDRRGRKLYPEDVIEVPDNGQFIVK. 70
82 2.000e-18UniRef50_A0A0K0XAN5 tRNA synthetase RNA-binding protein n=22 Tax=Bacteria TaxID=2 RepID=A0A0K0XAN5_MYCGD  ali  44  1MKDVPIRDESIRLGQFLKLAALIDTGADAKAVIADGQVTVNGEIELRRGRQLHPGDEVALGGRSARV... 69
83 2.000e-18UniRef50_D5UPZ8 RNA-binding S4 domain protein n=58 Tax=Actinobacteria TaxID=201174 RepID=D5UPZ8_TSUPD  ali  42  13..DVEISDEVIRLGQFLKLAGLIDSGAEAKGVIADGEVSVNGEVDTRRGRQLAVGDVVEVFGRSARVARG 80
84 2.000e-18UniRef50_A0A1G7LII2 Heat shock protein Hsp15 n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1G7LII2_9PROT  ali  17  1MSAPNPQGETIRLDKWLWFTRFFKSRSIAGQVCKAGKVRVSGTKVTKPSHALRVGDVLTFPGNQLHVVR. 70
85 2.000e-18UniRef50_A0A132PRW5 tRNA synthetase RNA-binding protein n=33 Tax=Terrabacteria group TaxID=1783272 RepID=A0A132PRW5_9MYCO  ali  40  1MEDVPISDESIRLGQFLKLAALIDSGADAKAAIADGLVTVNGDVELRRGRQLRPGDDVSLGSRSARVSRS 72
86 2.000e-18UniRef50_O66484 30S ribosomal protein S4 n=495 Tax=cellular organisms TaxID=131567 RepID=RS4_AQUAE  ali  17  99...........RLDNVVYRLGFASTRRQARQLVAHGHVLVNGKKVNIPSYLVEPGDVIEIKEKSRDI... 154
87 2.000e-18UniRef50_A0A1X7BKU6 Heat shock protein 15 n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1X7BKU6_9RHOB  ali  20  5.......SEKIRLDKWLWQARFFKTRSLAAKVASAGHVRVNGERVGKSAHQVLVGDVLTFPQARVIRVV. 66
88 3.000e-18UniRef50_A0A1B6YBQ7 Pseudouridine synthase n=10 Tax=Bacteria TaxID=2 RepID=A0A1B6YBQ7_9BACT  ali  22  34......QDEEIRINKFIAHAGLC-SRREADQYIADGLVKVNGKKVTEMGTKVRRQDVIEVNGQKIQ.... 92
89 3.000e-18UniRef50_K6Y029 Ribosome-associated protein n=25 Tax=Bacteria TaxID=2 RepID=K6Y029_9ALTE  ali  37  7.KNIEINAEPIALYQILKFEALVSSGGEAKAAIDDGRVLVNGEVETRRRKKIMSGDIVEFEGERFNVV.. 73
90 3.000e-18UniRef50_C2ENW3 S4 domain protein YaaA n=38 Tax=Lactobacillus TaxID=1578 RepID=C2ENW3_9LACO  ali  46  4IKDFTIEGEYITLGQFLKEESIISSGGQAKFYLQDNPVTLNGELEDRRGKKLHVGDHLQVNGQEY..... 68
91 3.000e-18UniRef50_A0A136WIH4 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A136WIH4_9FIRM  ali  42  1MQEVEIHTEFIKLQQVLKLAGMIGQGSDVKSFLADGVVYVNGQPVTERGKKIRPDDVIEVKGFEAVKVV. 69
92 3.000e-18UniRef50_UPI00093005FA RNA-binding S4 domain-containing protein n=1 Tax=Ndongobacter massiliensis TaxID=1871025 RepID=UPI00093005FA  ali  37  1MENLVIHTPYIRLDQAMKLASFVASGAEAKALVQEGAVAVNGTVCMQRGKKLYDGDCFSFGD........ 62
93 3.000e-18UniRef50_A0A1U4M6J8 RNA-binding S4 domain-containing protein n=1 Tax=Mycobacteroides abscessus subsp. bolletii TaxID=319705 RepID=A0A1U4M6J8_9MYCO :_  ali  34  45IEPVFIRDEMIRLGQFLKLANLVENGTHARDVIQDGLVKVNDEICEQRGKQLNPGDVVELNGMAVQV... 111
94 4.000e-18UniRef50_D4MX57 RNA-binding protein n=73 Tax=Bacteria TaxID=2 RepID=D4MX57_ANAHA  ali  41  2..EIKLKDEFIKLGQALKAAGLVDSGVVAKIVIQDGEVLVNGEVETRRGKKLYGGEVVSFDGQEIHIVK. 68
95 4.000e-18UniRef50_A0A2N6S850 S4 domain-containing protein YaaA n=4 Tax=Bacilli TaxID=91061 RepID=A0A2N6S850_9STRE  ali  55  1MKEVFINSEYITLAQFLKVEGFIGSGGEAKYFLQEVEVELNGELENRRGKKLYSNDIIKLEGNEFIII.. 68
96 4.000e-18UniRef50_A0A235B6J5 RNA-binding protein n=2 Tax=Thermoactinomycetaceae TaxID=186824 RepID=A0A235B6J5_9BACL  ali  55  1MQQILIHTEYITLGQLLKKLNLLDTGGQAKIYLAENQVRVNGELETRRGRKVYPQDSIEIEGDTVRLVRS 71
97 4.000e-18UniRef50_A0A1B1NEI0 Uncharacterized protein n=1 Tax=Serinicoccus sp. JLT9 TaxID=1758689 RepID=A0A1B1NEI0_9MICO  ali  28  105..TVEIRDQSIRLGQLLKLAGLVQDGAMARMVIENGEVTVDGETVMRRGTQVRPGQVVTYAGESVSPV.. 170
98 4.000e-18UniRef50_A0A1C5KXL1 Pseudouridine synthase n=17 Tax=Bacteroidales TaxID=171549 RepID=A0A1C5KXL1_9BACE  ali  23  200.......DEPIRLNKFLANAGIC-SRREADEFITAGVVSVNGEIVTELGTKVKRSDEVKFHDQPVSI... 258
99 4.000e-18UniRef50_A0A173WZ06 Ribosome-associated protein n=66 Tax=Bacteria TaxID=2 RepID=A0A173WZ06_9FIRM  ali  41  1MEIIKLRDEFIKLGQALKAAGLVESGVDAKEVIVQGLVVVNGEIETRRGRKLYDGDEVEFDGDKISI... 67
100 4.000e-18UniRef50_B0MRG2 S4 domain protein n=7 Tax=root TaxID=1 RepID=B0MRG2_9FIRM  ali  32  7..NVNVKPPFIKLEQFLKFSGACETGGEAKNAIQGGYVHVNGEICTMRGKKIADGDIVELDEQQYK.... 70
101 4.000e-18UniRef50_F5RJS2 Uncharacterized protein n=49 Tax=Firmicutes TaxID=1239 RepID=F5RJS2_9FIRM  ali  37  1MTEVEIHTDTIQLDQFLKLAGAVPSGGMVKELIAAGAILRNGAVETARRRKLLVGDVITIEGEDTYCVV. 69
102 4.000e-18UniRef50_A0A0P0LLL2 Pseudouridine synthase n=286 Tax=Bacteria TaxID=2 RepID=A0A0P0LLL2_BACVU  ali  23  249.......NEPIRLNKFLANAGIC-SRREADEFITAGVVSVNGEVVTELGTKIKRTDEVKFHDEPVSI... 307
103 5.000e-18UniRef50_A0A1Y5SSM5 Heat shock protein 15 n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5SSM5_9RHOB  ali  15  10...........RIDKWLWQARFFKTRSLSAKQVSGGHVRVNGNRVLKPSYGVSPGDVLTFPQAKVVRVV. 67
104 5.000e-18UniRef50_E8RDD3 RNA-binding S4 domain protein n=4 Tax=Desulfobulbus TaxID=893 RepID=E8RDD3_DESPD  ali  29  14.QQARIDTDYIELDKLLKRENLTASGGEARYLISQGLVLVNGIVELRKRRKLRSGDVVTC-GETTLRVEG 81
105 5.000e-18UniRef50_E3DLI4 RNA-binding S4 domain protein n=53 Tax=root TaxID=1 RepID=E3DLI4_HALPG  ali  40  1MESIKIKSNTIKLDQFLKWGNIVMSGGEAKHLIQAGEVKVNGEVELKRGRKLEVGDIVTLTDKKYKVSQG 72
106 5.000e-18UniRef50_A0A1Q4STW1 tRNA synthetase RNA-binding protein n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q4STW1_9MYCO  ali  39  5..DVPIRDDTIRLGQFLKLAALIDTGADAKAVIADGQVTVNGEVELRRGRQLHPGDRVAIGPRSARVTRA 72
107 6.000e-18UniRef50_A0A2N1PYM5 S4 domain-containing protein YaaA n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2N1PYM5_9BACT  ali  47  1MKKFQIYEDYITLGQFLKATNHIGSGGEAKFFLYENEVLLNQERRIERGKKLYPGDYIQIGNESYVIVRD 70
108 6.000e-18UniRef50_F0P2I5 Pseudouridine synthase n=18 Tax=Bacteroidetes TaxID=976 RepID=F0P2I5_WEEVC  ali  17  60......DDGTIRLNKYIANAGI-SSRREADELILTGVVTVNGKVITEMGYKVQPTDEVRFDGKKI..... 117
109 6.000e-18UniRef50_F0SSL3 RNA-binding S4 domain protein n=16 Tax=Bacteria TaxID=2 RepID=F0SSL3_RUBBR  ali  37  1METDPNERDPLRLDHFLKLAGFVDTGGQAKMLIQSGEVLVNGQLETRRRRQLQPGDVIQLGEYEASV... 69
110 6.000e-18UniRef50_A0A1V6I953 Pseudouridine synthase n=5 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6I953_9BACT  ali  21  103........EGIRLNKYIANAGIC-SRREADTFISAGLVSVNGEIVTELGIKVMPGDEVKFNDKKI..... 158
111 7.000e-18UniRef50_A0A0N8VY54 S4-like RNA binding protein n=23 Tax=Bacilli TaxID=91061 RepID=A0A0N8VY54_PEDPE  ali  52  3.KDVEINTEFITLGQLLKEEGIIGTGGQAKWFLRENTVLVNGEHDDRRGKKLYEDDVVEVPDEGSFKIT. 70
112 7.000e-18UniRef50_A0A0H4KAT0 Uncharacterized protein n=7 Tax=Bacillaceae TaxID=186817 RepID=A0A0H4KAT0_9BACI  ali  61  3.QEVQISTDFITLGQFLKLADVIQSGGMAKWFLSEHEVFVNGESEDRRGRKLRTGDQVDIPTVGQFVV.. 69
113 7.000e-18UniRef50_A0A1G4FPD3 Ribosome-associated protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G4FPD3_9FIRM  ali  42  1MKEVTIDTEYIKLSQILKLAGIVQTGGQSKILISSGKIEVNGETVKERGKKIRKGDKIKIEGIDEFVVV. 69
114 7.000e-18UniRef50_A0A2A4VZS3 Uncharacterized protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4VZS3_9GAMM  ali  32  4IRPITITSEPIELCKLLKIADLVSGGGEAKVVITQGYVFLNGEVEYQKRKKIRDNDVIEFNGEVVQVVVN 73
115 7.000e-18UniRef50_A0A1M5AND1 Ribosome-associated protein n=1 Tax=Caldanaerobius fijiensis DSM 17918 TaxID=1121256 RepID=A0A1M5AND1_9THEO  ali  39  2..NVKINTDYIKLEQVLKLANVVPTGGQAKLMIKDGHVKVNGSVCLQRGKKIRKGDVISVEGQDIFVI.. 68
116 8.000e-18UniRef50_A0A2K8L8S2 Ribosome-associated protein n=12 Tax=Bacteria TaxID=2 RepID=A0A2K8L8S2_9PROT  ali  34  1MREVTISSEPIELNKLLKYESMVASGGEANQVITEGQVRVNGQVETRRRKKIVAGDIIEYRSEKIRI... 67
117 8.000e-18UniRef50_A0A246GK58 Pseudouridylate synthase n=47 Tax=Bacteroidetes TaxID=976 RepID=A0A246GK58_9FLAO  ali  22  51.....LEEEEIRLNKYISNSGIC-SRRDADIYIQSGNVRVNGEVVTEMGYKVKTGDVVNFDGSVV..... 109
118 9.000e-18UniRef50_K0JV18 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=K0JV18_SACES  ali  33  3IREVEIADDMIRLGQFLKLAGLAENGAHARELVEEGDVTVNGRPESRRGAQLHHGDVIAVGEEKARLV.. 70
119 9.000e-18UniRef50_A0A1Y5SBP9 Heat shock protein 15 n=10 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y5SBP9_9RHOB  ali  16  18........PTIRIDKWLWYARFFKTRSLATKLVSAGHVRVNAQRIAKPAFAVGAGDTLTFQGNDIRVIR. 79
120 9.000e-18UniRef50_A0A2N0XJ46 rRNA pseudouridine synthase (Fragment) n=1 Tax=Chryseobacterium sp. PMSZPI TaxID=1033900 RepID=A0A2N0XJ46_9FLAO  ali  14  161........DSIRLNKYIANSGIC-SRREADELITQGLVEVNGKVVTEMGYQVQKTDRVIFDGQSI..... 216
121 9.000e-18UniRef50_A0A1G6LZ26 Ribosome-associated protein n=19 Tax=Bacteria TaxID=2 RepID=A0A1G6LZ26_9NOCA  ali  40  6..DVPIRDESIRLGQFLKLASLIESGAEAKEVIADGMVSVNGEVEVRRGRQLKRGDVVSIGETSARV... 70
122 9.000e-18UniRef50_A0A0M8PSC8 tRNA synthetase RNA-binding protein n=46 Tax=Actinobacteria TaxID=201174 RepID=A0A0M8PSC8_RHORH  ali  43  6..EVPIRDESIRLGQFLKLASLIESGAEAKEVIAEGLVSVNGEVEVRRGRQLHVGDVVEIGAAAARV... 70
123 9.000e-18UniRef50_UPI000DCE03FC RNA-binding S4 domain-containing protein n=2 Tax=Corynebacterium heidelbergense TaxID=2055947 RepID=UPI000DCE03FC  ali  45  40...VSIRDEEIRLGQFLKLANLVDTGGLVKELIAEGAVRVNGQLCTQRGKVLRDGDVASV.......... 96
124 1.000e-17UniRef50_B6VSK0 Pseudouridine synthase n=33 Tax=Bacteroidetes TaxID=976 RepID=B6VSK0_9BACE  ali  23  5.......NEPIRLNKFLANAGIC-SRREADEFITAGVVSVNGEVVTELGTKIKRTDEVKFHDEPVSI... 63
125 1.000e-17UniRef50_A0A0A8WV11 Uncharacterized protein n=29 Tax=Bacteria TaxID=2 RepID=A0A0A8WV11_9DELT  ali  41  2....KIDGEFIKLDSFLKAVNAVSSGGEAKIAIQDGFVIVNGETETRRGRKLRPGDTVEVRGGKRYGVE. 66
126 1.000e-17UniRef50_A0A1H4JHM6 Ribosome-associated heat shock protein Hsp15 n=8 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1H4JHM6_9RHOB  ali  20  41...........RLDKWLWQARFFKTRTLAALVVEEGHIRVNGTPVSRPSREVGPGDVLTFPGRNIRLIR. 99
127 1.000e-17UniRef50_B9Y5K4 S4 domain protein YaaA n=2 Tax=Holdemania TaxID=61170 RepID=B9Y5K4_9FIRM  ali  50  35...IKIDTEFITLGQLLKMTDWISSGGEAKLAVKELKITVNGEKEDRRGRKLYPGDQISIEDKRYTI... 98
128 1.000e-17UniRef50_A0A126ZZ95 tRNA synthetase RNA-binding protein n=57 Tax=Actinobacteria TaxID=201174 RepID=A0A126ZZ95_9MICC  ali  35  22.ETVEIREGTIRLGQLLKLASLVEDGVEAAELIRHGLVKVNGEIEERRGRQLGVGDSVEVNGQRVRLV.. 88
129 1.000e-17UniRef50_A0A1I0BSC5 Ribosome-associated protein YbcJ, S4-like RNA binding protein n=1 Tax=Thalassotalea agarivorans TaxID=349064 RepID=A0A1I0BSC5_THA  ali  36  8..EVQLESEPIELYKLLKIADLVSGGGEAKIVISEGYVYLNGEVETQKRKKIYNGDVIEFNG........ 67
130 1.000e-17UniRef50_A0A2S7UXB3 Uncharacterized protein n=2 Tax=Psychrosphaera saromensis TaxID=716813 RepID=A0A2S7UXB3_9GAMM  ali  30  7...VEITTEYIELNKFLKFENLVESGGHAKLVIADGQVRLNGKVVVQTRRKVRDGDIVTLAGEQYQIVV. 72
131 1.000e-17UniRef50_A0A2E4QFP8 30S ribosomal protein S4 n=2 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E4QFP8_9GAMM  ali  13  98...........RLDNIVYRMNFASTRAQARQLVSHGHVTVNGKLLDIPSYQVSPGDVVSIREKSLLIIKA 158
132 1.000e-17UniRef50_G0VMG3 S4 domain protein n=20 Tax=Firmicutes TaxID=1239 RepID=G0VMG3_MEGEL  ali  37  2METVTITTAMIQLDQFLKWASILQSGGEIRFLLDEKKIFVNGNLCTAKRKKLYPGDKIEIKGIGTYLIKG 71
133 1.000e-17UniRef50_A0A0C2R2F5 tRNA synthetase RNA-binding protein n=47 Tax=Bacteria TaxID=2 RepID=A0A0C2R2F5_9CYAN  ali  40  1MET---SASTIKLDQFLKFVGIAPTGGQAKLLIQAGDVKVNGTLETRRGRKLVSGDKVTVGGETFEV... 64
134 1.000e-17UniRef50_H6LEA3 RNA-binding protein containing S4 domain n=9 Tax=Firmicutes TaxID=1239 RepID=H6LEA3_ACEWD  ali  34  1MQIIEINTEFIKIDQLLKYAGIVGNGSDVKFMILDGLIRVNGELCTQRNKKIRDGDLVEIEDYEPLQVKG 70
135 1.000e-17UniRef50_E2Z9J7 Uncharacterized protein n=7 Tax=Veillonellaceae TaxID=31977 RepID=E2Z9J7_9FIRM  ali  41  1MKEIKIQTETIQLDQFLKWADITESGGQTSMLIANKMIFVNGESCTVKRKKLYPNDIVKVENVGQFRVVG 70
136 1.000e-17UniRef50_A0A076HN38 tRNA synthetase RNA-binding protein n=39 Tax=Bacteria TaxID=2 RepID=A0A076HN38_9SYNE  ali  39  8.........PMKLDQFLKWKGWVSTGGEAKQRIQMGEVEVNGRVETRRGRQLSPGDRVVLSGEESVV... 65
137 1.000e-17UniRef50_UPI000BA920D2 RNA-binding S4 domain-containing protein n=1 Tax=Paraferrimonas sedimenticola TaxID=375674 RepID=UPI000BA920D2  ali  31  41......DQAFIELYKLLKAVDWAGSGGEAKQVIDAGWVQVNQEVETRKRKKIAAGDVVEYQHQQVRVVSA 104
138 1.000e-17UniRef50_U5S6G6 RNA-binding protein n=67 Tax=Bacilli TaxID=91061 RepID=U5S6G6_9LACT  ali  47  3.KTIKIDREFITLGQFLKHVNIISSGGMAKWYLSEHTILLDNEVENRRGKKIYPGSVVEIPDEGTYFIQA 71
139 1.000e-17UniRef50_E8LE20 S4 domain protein n=4 Tax=Firmicutes TaxID=1239 RepID=E8LE20_9FIRM  ali  28  4.ETVEITTEFITMDKLLKFSGVADTGGQAFLMVEDGVVRLNGQLVTEKRKKVHPGDVVNIDDQIELTV.. 70
140 2.000e-17UniRef50_A0A1V5FQS9 30S ribosomal protein S4 n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5FQS9_9BACT  ali  14  90..EVMLQLLEQRLDNVLYRAGLAATRAQARQLIVHGHARVNGQKVDRPSYQVRVGDQVSISDKVR..... 152
141 2.000e-17UniRef50_A0A0J6C1L3 S4 domain-containing protein YaaA n=89 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0J6C1L3_BREBE  ali  57  1MREVSISTDYIALGQFLKLAEIIDTGGMAKAFLAEVPIQINGELDNRRGRKLYPGDEVAIEGYGRYQVV. 69
142 2.000e-17UniRef50_A0A1B1FTH3 Pseudouridine synthase n=6 Tax=Flammeovirga TaxID=59739 RepID=A0A1B1FTH3_9BACT  ali  18  93..EVKTKSASTRLNKYISNAGVC-SRREADQLIAEGKIKINGKVVTEMGYKVQPKDRVEYEGK....... 152
143 2.000e-17UniRef50_A0A1G9HS61 Ribosome-associated protein n=1 Tax=Natronincola ferrireducens TaxID=393762 RepID=A0A1G9HS61_9CLOT  ali  36  3.KELKLDGEFIKLDQLLKFVDVAGSGGHAKILILNGEVKVNGEVVTQRGKKIRTGDIVEVEDLQVKV... 68
144 2.000e-17UniRef50_A0A1Z8XLT1 Uncharacterized protein n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Z8XLT1_9BACT  ali  34  7.TTITIQSDVIELCQILKFEGLVSSGGEAKQIIVNELVKVNGETETRKRRKISHGDTIEYQGSSYLV... 72
145 2.000e-17UniRef50_A0A1M5U4V6 Ribosome-associated protein YbcJ, S4-like RNA binding protein n=2 Tax=Desulfofustis glycolicus TaxID=51195 RepID=A0A1M5U4V6_9DELT  ali  39  19MKEVEIGGYPIRLGQFLKHASVVSDGAAAKELIRTHRIEVNGVIETRRGRQLQPGDRVCFD......... 81
146 2.000e-17UniRef50_A0A239WHF9 Pseudouridine synthase n=64 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A239WHF9_9FLAO  ali  14  146..EKDIHKDTIRLNKYIANSGIC-SRREADELITQGLVEVNGKVVTEMGYQVQKTDRVVFDGQSI..... 207
147 2.000e-17UniRef50_K1T2K8 Ribosomal large subunit pseudouridine synthase B (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1T2K8_9ZZZZ  ali  20  37......QTGEMRLNRFLAQSGIC-SRREADDFITAGLVSVNGQIVTELGTKVLPTDEVKFNDSRVQ.... 95
148 2.000e-17UniRef50_A0A2H5XXG8 Pseudouridine synthase n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5XXG8_9BACT  ali  20  11......EDQRIRLNKFLADAGIA-SRRKADELIARGAVKVNGRIVTELGTKVHPGDLVTVEGKPV..... 68
149 2.000e-17UniRef50_Q1GJ59 RNA-binding S4 n=73 Tax=Alphaproteobacteria TaxID=28211 RepID=Q1GJ59_RUEST  ali  15  4......HADKMRVDKWLWHARFFKTRSLAAKQVGAGHVRVNGSKAAKPSQNVSIGDVLTFPGHQVRVVR. 67
150 2.000e-17UniRef50_G8RYU9 Uncharacterized protein n=22 Tax=root TaxID=1 RepID=G8RYU9_MYCRN  ali  41  1MDDVPIRDETIRLGQFLKLSGLIDSGADAKAVVADGLVVVNDTVERRRGRQLRSGDIVEFDGRRARV... 67
151 3.000e-17UniRef50_A0A2V2C6H8 RNA-binding S4 domain-containing protein n=1 Tax=Escherichia coli TaxID=562 RepID=A0A2V2C6H8_ECOLX  ali  39  18.ETIYISTEFIRLDSLLKFEGIAETGGIAKMMIFDGEIKINGEVCTARGRKVKAGDIVT........... 75
152 3.000e-17UniRef50_A0A2E2EL27 Pseudouridine synthase n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2EL27_9FLAO  ali  22  39.KRXKSDDGSMRLNQYLAHAGIC-SRREADQLIEAGVVAVNGKAVTQMGYRVQESDIVKFNGRTLK.... 102
153 3.000e-17UniRef50_A0A2G4GU54 Uncharacterized protein n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G4GU54_9FLAO  ali  32  1METIPIHTPFIQLNQALKLLGWAESGSMANDMITEGLVVVDGVQEFRKRNKLYPGAVIEFEGQKATV... 67
154 3.000e-17UniRef50_A0A2N5G5D1 S4 domain-containing protein YaaA n=32 Tax=Bacteria TaxID=2 RepID=A0A2N5G5D1_9BACI  ali  67  4..QIKIDTEYITLSQFLKLAEVIQTGGMAKWFLSEHEVYVNGELDQRRGRKLRNGDEIHIPNFGDFIVT. 70
155 3.000e-17UniRef50_A0A1I5IC97 Pseudouridine synthase n=1 Tax=Prevotella sp. tf2-5 TaxID=1761889 RepID=A0A1I5IC97_9BACT  ali  23  238.EENYDPNEPIRLNKFLANAGVC-SRREADEFIQAGVVTVNGQVVTELGTKVLRTDEVKFHDAPV..... 300
156 3.000e-17UniRef50_A0A0R2T8B0 Pseudouridine synthase (Fragment) n=4 Tax=unclassified Cryomorphaceae TaxID=253244 RepID=A0A0R2T8B0_9FLAO  ali  20  209.EEFAPSTDDMRLNRFLAHAGIC-SRREADALIADGMVTVNGKIITEMGFKVLPVDDVRYAGERLK.... 272
157 3.000e-17UniRef50_A0A1T4M8W8 Pseudouridine synthase n=4 Tax=Porphyromonas cangingivalis TaxID=36874 RepID=A0A1T4M8W8_PORCN  ali  23  338......ENEPIRLNKYLANSGVC-SRREADELIQNGTVLVNGEVVTELGTKITLKDSVVVDGKEVK.... 396
158 3.000e-17UniRef50_C0BJ48 RNA-binding S4 domain protein n=4 Tax=Flavobacteriia TaxID=117743 RepID=C0BJ48_FLABM  ali  20  20.......SETVRLNKFLSNAGLC-SRREADSHIEMGLVHVNGKIITEMGYQVKPTDEVKFDGARVQQ... 78
159 3.000e-17UniRef50_A0A1C6G486 Ribosome-associated protein n=72 Tax=root TaxID=1 RepID=A0A1C6G486_9CLOT  ali  40  2..EIKLREEYIKLGQALKAAGLVESGVDAKEVILNGEVKVNGEVERQRGKKLYGGDTVTFDGEQIEI... 66
160 3.000e-17UniRef50_B2IY27 RNA-binding S4 domain protein n=22 Tax=Terrabacteria group TaxID=1783272 RepID=B2IY27_NOSP7  ali  43  1MK--KIRDNTIKLNQYLKLMGIVPTGGQAKLMIQGGDVQVNGMLETRRGRRLVPGDKVTIEGKTLEV... 65
161 3.000e-17UniRef50_R6FK00 S4 domain protein YaaA n=4 Tax=Clostridiales TaxID=186802 RepID=R6FK00_9FIRM  ali  38  1MEDITIKDDFIKLGQAMKLAGIVGSGVDAKFLIQDGQVKVNGEVDTRRGKKLYPGDTFEFEGTVVLV... 69
162 3.000e-17UniRef50_A0A220VHC7 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A220VHC7_9GAMM  ali  38  1MIEIKINQEPIELSKILKLANIVSGGGEAKVLISEGLVCVNGDIESRKRKKIYVNDVIQFQENTYLVV.. 68
163 3.000e-17UniRef50_A0A1C5RI02 Ribosome-associated protein n=20 Tax=Firmicutes TaxID=1239 RepID=A0A1C5RI02_9CLOT  ali  37  1MHTIRLKDDYIKLGQALKAAGVVESGVDAKFAVQDGLVKVNGQTELQRGKKLVSGDKVEYDGETIVI... 67
164 3.000e-17UniRef50_A0A0B8N6K4 tRNA synthetase RNA-binding protein n=379 Tax=Bacteria TaxID=2 RepID=A0A0B8N6K4_9NOCA  ali  41  6..DVPIEDDVIRLGQFLKLANLIDSGSEAKTVIAQGLVRVNDEVELRRGRQLHAGDVVALAGHKARV... 70
165 3.000e-17UniRef50_A0A2N6SEJ8 S4 domain-containing protein YaaA n=26 Tax=Firmicutes TaxID=1239 RepID=A0A2N6SEJ8_9BACL  ali  56  1MKKIFINSEYITLSQFLKIEGFIASGGEAKYFLQEVEVVLNGNLENRRGKKLYSNDVIEIENQKYII... 67
166 3.000e-17UniRef50_A0A086YD03 tRNA synthetase RNA-binding protein n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A086YD03_9RHOB  ali  19  6......TRETMRLDKWLWHARFFRTRTLASEVVEAGHVRVNARRVQKPAFGIGEGDTLTFPQAGRIRVV. 68
167 3.000e-17UniRef50_A0A2N5FGU4 S4 domain-containing protein YaaA n=12 Tax=Bacteria TaxID=2 RepID=A0A2N5FGU4_9BACI  ali  65  4.KPVEIQTEFITLGQFLKLAEVIQTGGMAKWFLQEYAIFVNGEPENRRGKKLVANDTVDIPDFGSFIVKN 72
168 3.000e-17UniRef50_A0A2N1Q994 S4 domain-containing protein YaaA n=12 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2N1Q994_9BACT  ali  44  1MNKFKINTDFITLGQFLKATDHIGSGGEAKFFLFENDVFVNGEKRTERGKKLFHGDKVIVKNSEYYII.. 68
169 4.000e-17UniRef50_A0A1H7ZFS6 Pseudouridine synthase n=22 Tax=Bacteroidales TaxID=171549 RepID=A0A1H7ZFS6_9BACT  ali  23  202.......NEPLRLNKFLANAGIC-SRREADEFIQAGVVTVNGEVVTELGTKILRTDEVKFHDQPVTI... 260
170 4.000e-17UniRef50_A8CPS8 RNA-binding protein S4 n=14 Tax=Cyanobacteria TaxID=1117 RepID=A8CPS8_9CYAN  ali  40  8.........MIKLDQFLKWVGVVSTGGEAKLLIQDGEVQVNGTVETRRGRKLVPGDVVLARGQSYEVAED 68
171 4.000e-17UniRef50_A0A239LGU2 Ribosome-associated protein n=1 Tax=Ekhidna lutea TaxID=447679 RepID=A0A239LGU2_9BACT  ali  28  1MQTFELEGDFIELNKLLKIMQLVGSGGEAKQFIDEGLVQVNGQVEKQRRKKLRKGDKVLFEGGEVVI... 68
172 4.000e-17UniRef50_D5AP16 Heat shock protein n=84 Tax=Bacteria TaxID=2 RepID=D5AP16_RHOCB  ali  15  3......EGDRIRIDKWLWQARFAKSRALAVDLVTAGRVRVNGQKLEKPGRAVGPGDVLTVLGAEVRVLR. 66
173 4.000e-17UniRef50_K6DNL9 Uncharacterized protein n=3 Tax=Bacillus TaxID=55087 RepID=K6DNL9_9BACI  ali  53  3.EKVKLNTEFITLGQFLKLAEVIQTGGMAKWFLSEHDIFINGEQDQRRGRKLRAGDKVQITGFGEFVITA 71
174 4.000e-17UniRef50_A0A0P8AJH5 Pseudouridine synthase n=1 Tax=Bacteroidetes bacterium HLUCCA01 TaxID=1666909 RepID=A0A0P8AJH5_9BACT  ali  18  149.KTISDTDDSYRLNKYIANSGVC-SRREADTLIAEGKVAINGTVVTELGTKVSRKDVVTVDGATVNPV.. 214
175 4.000e-17UniRef50_A0A099Y002 Pseudouridine synthase n=21 Tax=Bacteroidetes TaxID=976 RepID=A0A099Y002_9FLAO  ali  26  39IKPIQKSDESIRLNKYIANSGVC-SRREADTYIEHGSVEVNGKLVTEMGYKVQPNDIVRFDGTSI..... 104
176 4.000e-17UniRef50_A0A2H0Y0P4 RNA-binding protein n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A2H0Y0P4_9BACT  ali  35  1MQKIKIQPPFIKLDSLLKLASISSTGGQMKQFISSGGILVNGNVVIQRGKKIFPGDVVRV.......... 60
177 4.000e-17UniRef50_G9X0C1 Uncharacterized protein n=2 Tax=Peptoanaerobacter stomatis TaxID=796937 RepID=G9X0C1_9FIRM  ali  28  1MEKINIDTPYIKLDQLLKLSSIVSSGAEAHALITSGKVKVNGNVEIQKRKKITDGDIVDAMNKQIQVIQ. 69
178 4.000e-17UniRef50_A0A2N5MFW6 S4 domain-containing protein YaaA n=15 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2N5MFW6_9BACI  ali  61  1MTEIQIDTEYITLGQFLKVADIIQSGGMDKWFLSEHEVFVNDELDTRRGRKLREGDRVFIPKIGSFVI.. 68
179 5.000e-17UniRef50_D5P1E7 S4 domain protein n=16 Tax=Corynebacterium TaxID=1716 RepID=D5P1E7_CORAM  ali  43  5..EVPITGESIKLGQFIKLASLVATGGEAKTAIAEGAVTVNGEVDTRRGASLRAGDKVCV.......... 62
180 5.000e-17UniRef50_UPI000DA5FE3A RNA-binding S4 domain-containing protein n=1 Tax=Massilibacillus massiliensis TaxID=1806837 RepID=UPI000DA5FE3A  ali  41  1METIEINSEVIQLDQLLKWAGIVDSGGQVKGMIEEKIIKLNGVFVTERRKKIYPGDTIEILESGIWQV.. 68
181 5.000e-17UniRef50_A0A0K8JEU7 Uncharacterized protein n=5 Tax=Sporomusaceae TaxID=1843490 RepID=A0A0K8JEU7_9FIRM  ali  35  1MEEIAIHTATIQLDQLLKWAGIVESGAQVKFLLADAMIEVNGKRIEERRKKIYPGDVVHVKGMGQWQV.. 68
182 6.000e-17UniRef50_E4KR67 S4 domain protein YaaA n=92 Tax=Terrabacteria group TaxID=1783272 RepID=E4KR67_9LACT  ali  53  1MEELKIDSDYLTLGQLLKYVDIIASGGMAKWYLSEYMVYVNGESENRRGKKLYPGDLIEFPHENRII... 69
183 6.000e-17UniRef50_A0A0D3LH06 Pseudouridine synthase n=1 Tax=Flammeovirgaceae bacterium 311 TaxID=1257021 RepID=A0A0D3LH06_9BACT  ali  19  361.EKVAHTDANIRLNKYIADAGIC-SRRDADELIASGQVKVNGEVVTQMGHKVSRNDAVTLNGKKI..... 423
184 6.000e-17UniRef50_L0A7G3 Uncharacterized protein n=10 Tax=Terrabacteria group TaxID=1783272 RepID=L0A7G3_DEIPD  ali  39  3......DEPTIDLQDWLKFAGLVGTGGEAKYLIQGGEVKLNGETETRRRKKLRRGDEIEIEGQRFKV... 63
185 7.000e-17UniRef50_UPI0007832847 RNA-binding S4 domain-containing protein n=6 Tax=Actinobacteria TaxID=201174 RepID=UPI0007832847  ali  34  8.EDVHIDGDVIRLGQFLKLASLIDSGANAKEVIVDGDVLVNGAPELRRGYQLKDGDLVTFHDRSARV... 73
186 7.000e-17UniRef50_E4SJ58 Uncharacterized protein n=11 Tax=Lactobacillus TaxID=1578 RepID=E4SJ58_LACAR  ali  47  4IKYFTITGEYITLGQFLKEESFISSGGQAKFYLQDNPVTLNGELEQRRGKKIFANDRLLVNGQEY..... 68
187 7.000e-17UniRef50_A0A1Z8MLT1 Uncharacterized protein n=1 Tax=Rhodopirellula sp. TMED11 TaxID=1986614 RepID=A0A1Z8MLT1_9PLAN  ali  36  1.........MIRLDDLLKRLGWVESGGQAKVFIQDGQVSVNGQTETRRRKQLFVGDLIECLGQE...... 55
188 7.000e-17UniRef50_A2SHW4 Uncharacterized protein n=22 Tax=Proteobacteria TaxID=1224 RepID=A2SHW4_METPP  ali  34  10..DFALRGEFITLDALLKATGLADSGGAAKQLIQSGQVQVDGREELRRGAKLRAGQVVAVSGARVR.... 73
189 7.000e-17UniRef50_A0A1C0ALV8 RNA-binding protein n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1C0ALV8_9FIRM  ali  32  1MKTITINTEYIKLDQLLKLANIVSGGGEAHALITDGQVKLNSNVELQKRKKIVKGDVVTVGKEEIKIV.. 68
190 7.000e-17UniRef50_A0A1F7VEE3 30S ribosomal protein S4 n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPLOWO2_02_FULL_51_9 TaxID=1802410 RepID=A0A1F7VEE3_9BACT :  ali  14  93..........MRLDNVVYRLGLVKTRAAARQLVNHGHVNVNGKRVDVPSYQVRSNDVVSVREEKR..... 147
191 7.000e-17UniRef50_K1LCC7 Pseudouridine synthase n=13 Tax=Cytophagales TaxID=768507 RepID=K1LCC7_9BACT  ali  19  142.......SDDIRLNKYIANSGIC-SRREADALIQKGDVKVNGEVIKEMGYKVKPGDKVHYKGKLI..... 198
192 7.000e-17UniRef50_A0A1H7PFN1 Ribosome-associated protein n=2 Tax=Parapedobacter koreensis TaxID=332977 RepID=A0A1H7PFN1_9SPHI  ali  29  27MVTFKIAGEYIQLIQLLKVLNWVEHGGEAQAVVTAGLVRHNGQVDFRKRLKVKPGDTVEFRGKQVQIV.. 94
193 7.000e-17UniRef50_A0A1G9XUE4 Ribosome-associated protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1G9XUE4_9FIRM  ali  37  1MEDIAINTTVIHLDQLLKWAGIAQSGGQVKSMVEAGIIELNNVIVTERRKKVYPGDIIAIEGLGKWQVTA 70
194 7.000e-17UniRef50_A0A1Z9K140 Heat shock protein 15 n=173 Tax=cellular organisms TaxID=131567 RepID=A0A1Z9K140_9GAMM  ali  12  3......ETETMRIDKWLWAARFFKTRGEAQRVVSAGHLRMDGDTMTKPHRQVRPGQVLTFKGNDVRVIK. 66
195 8.000e-17UniRef50_A0A095XQG3 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A095XQG3_9FIRM  ali  38  1MREITIHTSFIALNELLKLAGVVGSGAEAKLLIRSGEVWVNGEPCTVIRKKITVNDRVDVPDQGSFTVVS 70
196 8.000e-17UniRef50_G5H2S4 Uncharacterized protein n=9 Tax=Terrabacteria group TaxID=1783272 RepID=G5H2S4_9FIRM  ali  40  1MTDIEIRTDFIQLDQFLKLAGAVPSGGMVKELLSGGGILRNGEPETARRRKLVSGDVVAVDGIGVYRVV. 69
197 8.000e-17UniRef50_A0A2T4WH90 RNA-binding protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4WH90_9BACT  ali  28  12.......SEFIPLDKLLKLCRLVNSGGEAHAFIMQGAVRLNGEIEMQKRKKIRVGDKVEFNGEQIAV... 71
198 9.000e-17UniRef50_D5EVC4 Pseudouridine synthase n=66 Tax=root TaxID=1 RepID=D5EVC4_PRER2  ali  25  211.......NEPLRLNKFLANAGVC-SRREADEFIQAGVVSVNGEIVTELGTKILRTDVVKFHDQPVNI... 269
199 9.000e-17UniRef50_D0I5R1 Uncharacterized protein n=5 Tax=Vibrionaceae TaxID=641 RepID=D0I5R1_GRIHO  ali  32  13...IEVSSQPIELYKVLKMANAVSGGGEAKMAIAEGYVIVNGEVETRKRCKIYDGDVIAFNEEFYVV... 76
200 9.000e-17UniRef50_I7IXS0 Uncharacterized protein n=2 Tax=Turicella otitidis ATCC 51513 TaxID=883169 RepID=I7IXS0_9CORY  ali  36  72...ITISTETITLGKFLKLSGLAETGGMAKELVADGAVTLNGEPSGSRGELLHEGDVVCVDEQCARVAR. 137
201 9.000e-17UniRef50_B6IUH9 Heat shock protein, putative n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=B6IUH9_RHOCS  ali  13  24...........RLDKWLWYARFVKTRGLAARLCASGAIRIGGAHVTKAHHRVKPGDVLTFPGPHIRVIR. 82
202 9.000e-17UniRef50_A0A0C6FXF8 RNA-binding protein S4 n=51 Tax=Proteobacteria TaxID=1224 RepID=A0A0C6FXF8_9RHIZ  ali  15  1.....MREDRQRLDKWLWFARFAKTRSLAARLVEDGYVRVNGHRADAPAKALAVGDVVTVAAQHVVRVRD 68
203 9.000e-17UniRef50_A2U3Y8 Pseudouridine synthase n=42 Tax=Bacteria TaxID=2 RepID=A2U3Y8_9FLAO  ali  20  49..........IRLNKYIANSGVC-SRREADTYIEHGSVKVNGKLVTEMGYKVQPDDVVQFDGTSI..... 102
204 9.000e-17UniRef50_UPI0004798806 RNA-binding S4 domain-containing protein n=1 Tax=Afifella pfennigii TaxID=209897 RepID=UPI0004798806  ali  16  9.......TGTQRLDRWLWHARFARTRSQAQKLVCGGHVRLNRDKVTQPSRQVRVGDVLTLALPRQVKVV. 70
205 1.000e-16UniRef50_C7R3K8 RNA-binding S4 domain protein n=11 Tax=Actinobacteria TaxID=201174 RepID=C7R3K8_JONDD  ali  43  10...VTIRDTMIRLGQFLKLASLAESGAHARDLIEDDNVYVNGELEKRRGRQLIHGDIVTV.......... 66
206 1.000e-16UniRef50_D4YSS4 S4 domain protein YaaA n=7 Tax=Bacilli TaxID=91061 RepID=D4YSS4_9LACO  ali  40  4IKDFEIKGEYITLSQFLKEENIISSGGQAKWYLKDNPVILNGQSENRRGKKLHVGDELTVENVQYK.... 69
207 1.000e-16UniRef50_A0A2D7M2U5 RNA-binding protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D7M2U5_9BACT  ali  37  19.....MDEPTIRLAQFLKWMGLCATGGEAKIRIQEGEISVNGEIETRRGKVLRNGDRVTVEGEEHEV... 80
208 1.000e-16UniRef50_A0A2E0DAI6 Pseudouridine synthase n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E0DAI6_9FLAO  ali  22  41..TKRIDDGSMRLNQFLAHAGIC-SRREADKLIEAGVVKVNGESIIQMGYRVQETDIVKFNGRTLK.... 103
209 1.000e-16UniRef50_A0A2N8ZKD1 Uncharacterized protein n=8 Tax=Vibrionaceae TaxID=641 RepID=A0A2N8ZKD1_9VIBR  ali  35  27...VEVSTQPIELYKVLKIANAVSGGGEAKFAIAEGYVAVNGELEQRKRCKLYDGDVVEFNQEFYVVI.. 91
210 1.000e-16UniRef50_A0A1P8U5Q5 RNA-binding protein n=2 Tax=Microbacterium TaxID=33882 RepID=A0A1P8U5Q5_9MICO  ali  40  7IDDVPIGSEGIRLGQFLKFAGVLDSGGDVKEAIIDGLVTVNGEVDRRRGRQLQIGDVVGFDGRRLRV... 73
211 1.000e-16UniRef50_E6MIM9 S4 domain protein n=7 Tax=Firmicutes TaxID=1239 RepID=E6MIM9_9FIRM  ali  28  8MEKIQIQTDFIKLDQLLKYIGAADSGAMAKAMVLDERVRVDGEICTMRGKKIRPGQQVAVADLGAWRVTG 77
212 1.000e-16UniRef50_A0A133XS62 Pseudouridine synthase n=1 Tax=Atopobium deltae TaxID=1393034 RepID=A0A133XS62_9ACTN  ali  22  1.....MSDDLMRLQRFLARAGVA-SRRHAEKLIEAGRVSVNGQVVTQLGTKVAPSDSVALDGK....... 58
213 1.000e-16UniRef50_A0A090WSG4 Ribosomal large subunit pseudouridine synthase B n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A090WSG4_9FLAO  ali  15  57......NPDEIRLNKYIANSGIC-SRREADDHIAIGLVTVNGKVITEMGYKVKVADEVRYDGARI..... 114
214 1.000e-16UniRef50_A0A1D8RRZ3 Uncharacterized protein n=2 Tax=Colwellia TaxID=28228 RepID=A0A1D8RRZ3_9GAMM  ali  34  7...INISVEPIELCKLLKIANMVGGGGEAKIVISEGYVLVNNEVEFQKRKKIRHGDTVEFDGEIFEV... 70
215 1.000e-16UniRef50_A0A2N6PHL0 RNA-binding protein n=6 Tax=Brevibacterium TaxID=1696 RepID=A0A2N6PHL0_9MICO  ali  34  1METVEISSGDIRLGQLLKLHGVAEHGVMAKDMIASGDVLVNGEVDTRRSAKIVTGDVISVPAAGVEFTVA 70
216 1.000e-16UniRef50_A5Z7E6 S4 domain protein YaaA n=214 Tax=Bacteria TaxID=2 RepID=A5Z7E6_9FIRM  ali  43  2..EITIKDDFIKLGQALKLAGLVDSGVDAKFVIQDGQVKVNGEVDTRRGKKLYAGDTFEFEGTVVTV... 66
217 1.000e-16UniRef50_A0A1T5IAV1 Ribosome-associated protein n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1T5IAV1_9FIRM  ali  39  2..EITINTEFIKLDQLLKLADVTSSGAESHALIMDGKVKVNGKAELQKRKKIRANDIVEINNKIIQVV.. 67
218 1.000e-16UniRef50_A0A133XTP9 Pseudouridine synthase n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A133XTP9_9BACT  ali  23  240.EEKINSTEPIRLNKYLANSGLC-SRRNADLLIAEGKIKVNGEVVTTMGVEITRQDIVEYNGKRVEI... 304
219 1.000e-16UniRef50_A0A2G4HAR6 Pseudouridine synthase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G4HAR6_9FLAO  ali  14  262.EEYAPDSDHMRLNRYLAHAGIC-SRREADTLIAQGLVTINGQVAMDMGLKVGPGDDVRYAGERLK.... 325
220 1.000e-16UniRef50_U5QN82 Ribosome-associated protein n=36 Tax=Bacteria TaxID=2 RepID=U5QN82_9CYAN  ali  43  3........DFIKLDQFLKLAGAVQTGGQAKLLVQDGQVMVNGAVETRRGRKLVNGDVVRL-GEQIYPVE. 62
221 2.000e-16UniRef50_G2SZF4 Uncharacterized protein n=42 Tax=Firmicutes TaxID=1239 RepID=G2SZF4_ROSHA  ali  36  1MIEIEIEDEFIKLGQALKKAGLVESGVDAKFVIQDGLVTVNGEVETQRGKKLHGGELVSYNGETVKIVR. 71
222 2.000e-16UniRef50_A0A2W6V604 Uncharacterized protein n=3 Tax=Intrasporangiaceae TaxID=85021 RepID=A0A2W6V604_9MICO  ali  30  108..TVGIRDQSIRLGQLLKLSGVVPDGAMARMVIENGEVTVDGEVVMRRGTQIRPGQIVSYAGESI..... 170
223 2.000e-16UniRef50_A0A0L1LMK5 tRNA synthetase RNA-binding protein n=121 Tax=root TaxID=1 RepID=A0A0L1LMK5_9MICC  ali  33  6.EDIPIRDSMIRLGQLLKLANLVEDGVEAAEVVKNGLVKVNGEIDDRRGRQLHNGDTVTVNGQTVRV... 71
224 2.000e-16UniRef50_A0A0F3INY2 Uncharacterized protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0F3INY2_9PROT  ali  21  1MTTFYAPTPTMRLDKFLWAARFFKSRTCAAGLLKEGRVRVNRRLVDKAHVTVRIGDVLTFPQADRIRVV. 71
225 2.000e-16UniRef50_A0A0F2ND10 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2ND10_9FIRM  ali  33  1MQTVSVKG-SIRLDRFLKWAGMAGSGGQAKVIIQSGMVKVNGEKTINRGKMLNQGDEVSLEDSGIFRVV. 68
226 2.000e-16UniRef50_A0A1E3W0S3 Uncharacterized protein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1E3W0S3_9RHIZ  ali  21  5...........RLDKWLWCARLAKTRSAATRLIADGKVRINGERVRKPSRLVQHGDVVTATPPGRLVV.. 61
227 2.000e-16UniRef50_E7FX42 Uncharacterized protein n=5 Tax=Erysipelothrix TaxID=1647 RepID=E7FX42_ERYRH  ali  47  1MGAMKKETQYITLGQFLKVADYVNSGGEAKHLIHSFSIQVNGEEENRRGRKLYPGDVVVINGNKHEI... 67
228 2.000e-16UniRef50_A0A2H5EVB5 RNA-binding protein n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2H5EVB5_9RHOB  ali  20  6........DSIRLDKWLVHVRLFKTRGLAAERIEGGGVRVNGQPSRKPGRSIRPGDEVTVSMQGRVR... 64
229 2.000e-16UniRef50_A0A1Y5RFT9 Heat shock protein 15 n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5RFT9_9RHOB  ali  17  7..........IRLDKWLFFARFFKTRSLAAKVVTDGGIRVNGQRVSKPSASVRVGDTLTFQGHNVRVV.. 65
230 2.000e-16UniRef50_A0A0K8MRZ0 S4 domain containing protein YaaA n=4 Tax=Leuconostocaceae TaxID=81850 RepID=A0A0K8MRZ0_9LACT  ali  46  3.ERVAIKTAYITLAQLLKMENLIASGGQAKAFLAEQEVELNGEPENRRGKKLYPGDQVVIHQETYQI... 68
231 2.000e-16UniRef50_A3CRA2 30S ribosomal protein S4 n=505 Tax=root TaxID=1 RepID=RS4_STRSV  ali  94...........RLDNVVYRLGLATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKV... 149
232 2.000e-16UniRef50_A0A090JL62 RNA-binding protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A090JL62_9FIRM  ali  38  1.....MDKDHITLSDFLKLNNIVQSGGEAKILIQSGQVKVNGEVETRRGKKLQKGDKITLNSEEY..... 60
233 2.000e-16UniRef50_A0A0G1IM61 30S ribosomal protein S4 n=10 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1IM61_9BACT  ali  15  78..........MRLDNVVYRLGFAKTRAAARQLVNHGHITVNGKRVNAPSYQTKIGDEIRVK......... 128
234 2.000e-16UniRef50_Q1ZSC9 Uncharacterized protein n=44 Tax=Vibrionaceae TaxID=641 RepID=Q1ZSC9_PHOAS  ali  37  12...VEVSTQPIELYKVLKIANLVSGGGEAKYAISEGYVAVNGELELRKRCKIYDGDVIEFNGEFYVV... 75
235 2.000e-16UniRef50_A0A2N9AJN7 Uncharacterized protein n=1 Tax=Methylobacterium extorquens TaxID=408 RepID=A0A2N9AJN7_METEX  ali  16  7...........RLDKWLWFARFARTRSMAARLVSDGHVRVNGTRADAPAKAIHCGDVLTV.......... 55
236 2.000e-16UniRef50_UPI0009E6E80E RNA-binding S4 domain-containing protein n=5 Tax=Rathayibacter TaxID=33886 RepID=UPI0009E6E80E  ali  40  51.EDVPLEGGSIRLGQFLKFAGILDTGGEVKEAVADGLVRVNGEVDRRRGRQLAVGDVVEIGGRRFRV... 116
237 2.000e-16UniRef50_A0A1Y0MID0 Pseudouridylate synthase n=1 Tax=Winogradskyella sp. PC-19 TaxID=754417 RepID=A0A1Y0MID0_9FLAO  ali  15  44......NPDEIRLNKYIANSGMC-SRREADENISIGLVTVNGKVITEMGYKVKLGDEVKFDGRRI..... 101
238 2.000e-16UniRef50_A0A2X2SSZ6 Ribosomal large subunit pseudouridine synthase B n=1 Tax=Capnocytophaga ochracea TaxID=1018 RepID=A0A2X2SSZ6_CAPOC  ali  19  154..........VRLNKFIADAGIC-SRRNADMYISAGNVTVNGEVMTTLGYRVKPTDEVRFDGK....... 205
239 2.000e-16UniRef50_E0QJN1 S4 domain protein n=20 Tax=Bacteria TaxID=2 RepID=E0QJN1_9FIRM  ali  33  2..EIIINTEFIKLDQLLKLADITSSGAESHALITDGKVKVNGQVELQKRKKIRENDIVEVNKKVIQVI.. 67
240 2.000e-16UniRef50_A0A0D8I7Y7 RNA binding protein containing a single S4 domain n=11 Tax=Firmicutes TaxID=1239 RepID=A0A0D8I7Y7_9CLOT  ali  34  3.REFKLEGEYIKLDQLLKSTDIVGSGGHAKIIILNEEVKVNGEIVTQRGKKIKLGDLVEVEGIKIKVI.. 69
241 3.000e-16UniRef50_A0A1I7CTZ5 Pseudouridine synthase n=13 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A1I7CTZ5_9BACT  ali  17  201.KKMESEDNLIRLNKYIANSGIC-SRREADSLISQGLVTLNGEVCTELGRKVKKTDRVVYQGRKI..... 263
242 3.000e-16UniRef50_K9P5K8 Uncharacterized protein n=17 Tax=Bacteria TaxID=2 RepID=K9P5K8_CYAGP  ali  40  1..........MKLDQFLKWQGLVGTGGEAKQRIQRGDVTVNGAIETRRGRQLAPGDAVAIDGREV..... 55
243 3.000e-16UniRef50_A0A2E6LGS9 Pseudouridylate synthase n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E6LGS9_9FLAO  ali  19  1MKKPEFNSDLIRLNKFISNSGIC-SRREADTHIRMGMVTVNGKIITEMGYKINLNDKVSYDGQIIQ.... 66
244 3.000e-16UniRef50_D5SMI6 RNA-binding S4 domain protein n=9 Tax=Bacteria TaxID=2 RepID=D5SMI6_PLAL2  ali  42  7...........TLDQFLKQQGWVATGGHAKLVIQEGEVIVNGEVDLRRGRKMRVGDVVEWNGERAEVPEG 65
245 3.000e-16UniRef50_A0A178YDK7 RNA-binding protein n=12 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A178YDK7_SINSA  ali  17  14...........RLDKWLFFARLIKSRSLAQKAIEAGHVAINGERATQSSSQVKPGDTLELSLERRDLVV. 71
246 3.000e-16UniRef50_A0A2U3D6A4 Uncharacterized protein n=1 Tax=Acidibacillus sulfuroxidans TaxID=1765684 RepID=A0A2U3D6A4_9BACL  ali  45  1MITIHTKTTYITLQQALKLSGMIDSGGSAKVILQDNKVFVNGIHEQRRGRKLYPGDLISVFNQTILIAES 70
247 3.000e-16UniRef50_A0A2E8WWH2 RNA-binding protein n=9 Tax=unclassified Crocinitomicaceae TaxID=1986672 RepID=A0A2E8WWH2_9FLAO  ali  45  6.ETFGIHTEYIDLLQFLKATGIAATGGEAKAIVDEGLVTVNGEAESRRRRKLRPGDTL............ 62
248 3.000e-16UniRef50_A0A2R5HEG3 Uncharacterized protein n=1 Tax=Lactococcus sp. NtB2 TaxID=2169526 RepID=A0A2R5HEG3_9LACT  ali  57  1MQNFSLYQEYLTLGQFLKEAALISTGGQAKLFLAEGGVFVNGELENRRGKKLVPGDQLEIP......... 63
249 3.000e-16UniRef50_K1LF77 Pseudouridine synthase n=94 Tax=Flavobacteriales TaxID=200644 RepID=K1LF77_9FLAO  ali  16  77..EKDIQKETIRLNKYIANSGIC-SRRQADDLIKQGLVTVNGKVVMEMGYQVQKTDKVSFDGQ....... 136
250 3.000e-16UniRef50_A0A0C5S2N2 RNA-binding protein n=14 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0C5S2N2_9MOLU  ali  49  1MKKIEINTPYITLNQFLKLTGLINNGGEAKMWLANNSVLVNNESENRRNKKLYDQTIVEFDGVKYLI... 67
251 3.000e-16UniRef50_A0A2E1GRY1 Pseudouridylate synthase n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E1GRY1_9FLAO  ali  16  1..........MRLNKFISNSGIC-SRREADKFISMGLVKVNGKVITKMGYKIEPKDNVTFDEIKI..... 54
252 3.000e-16UniRef50_A0A0M4DEQ3 RNA-binding protein n=22 Tax=root TaxID=1 RepID=A0A0M4DEQ3_9DELT  ali  29  3.QTFELTGEFIELYKLLKLFSLSTSGGMAKAMIAEGEVSVDGQIELRKRCKLRRGQVVECGGEKIEIV.. 69
253 3.000e-16UniRef50_F9MXD0 Pseudouridine synthase n=8 Tax=Firmicutes TaxID=1239 RepID=F9MXD0_9FIRM  ali  17  1.........MMRLQKYLAHAGLA-SRRKSEDYILQGRVAVNGQTITSLGTKVGPGDQVSFDGKPVK.... 56
254 3.000e-16UniRef50_UPI000C1B9661 30S ribosomal protein S4 n=2 Tax=Firmicutes TaxID=1239 RepID=UPI000C1B9661  ali  14  89...........RLDNLVYRAGIASSIRQARQMVVHGHVLVNGKKVSIPSYQVSVGDEIELREKSRK.... 143
255 3.000e-16UniRef50_A0A075JJG7 Uncharacterized protein n=15 Tax=Terrabacteria group TaxID=1783272 RepID=A0A075JJG7_9BACI  ali  60  3.EQIEINTEYIALGQFIKLANILESGGMVKSFLQEEGVLVNGELEHRRGRKLYPSDVVEIEGIGSYIVV. 70
256 3.000e-16UniRef50_A0A2I0R1P1 rRNA pseudouridine synthase n=3 Tax=Brumimicrobium TaxID=200473 RepID=A0A2I0R1P1_9FLAO  ali  18  65.......NDKIRLNKYLANAGIC-SRREADVLISSGVVSVNGKTIVELGYKVSPTDEVRYDGATVK.... 122
257 3.000e-16UniRef50_A0A2G6F0E8 RNA-binding protein n=2 Tax=Fusobacteriales TaxID=203491 RepID=A0A2G6F0E8_9FUSO  ali  46  1MNKVKINTEFIKLDQFLKWIGVVDNGSVAKEFILAGEVKVNGEIELRRGRKIYSEYIVEIFNEKYVV... 67
258 4.000e-16UniRef50_Q9RUJ5 Uncharacterized protein n=2 Tax=Deinococcus TaxID=1298 RepID=Q9RUJ5_DEIRA  ali  42  44........QTIDLQDFLKLQGVVETGGEAKFRVQGGEVRVNGEIETRRRKKLRRGDVVEYAGHRLKV... 102
259 4.000e-16UniRef50_A0A2P8CKN3 Pseudouridine synthase n=2 Tax=Prolixibacter TaxID=314318 RepID=A0A2P8CKN3_9BACT  ali  18  154......DDGSIRLNRFIANAGIC-SRREADTFIASGVVTVNGKPVTEMGVRVKPGDDVRFNGQRI..... 211
260 4.000e-16UniRef50_A0A0S2W8U2 30S ribosomal protein S4 n=20 Tax=Bacteria TaxID=2 RepID=A0A0S2W8U2_9FIRM  ali  17  90...........RLDNVVYRLGLAMTRREARQLVNHGHFTVNGKRVNIPSYLVSAGDVIEVAEKSRSSVK. 147
261 4.000e-16UniRef50_M7MXY3 Pseudouridine synthase n=3 Tax=Bacteroidetes TaxID=976 RepID=M7MXY3_9BACT  ali  17  22......TEASIRLNKYIADAGIC-SRRDADELIASGQIKVNGEVITQMGYKVSRSDTVLYNGKKI..... 79
262 4.000e-16UniRef50_Q2RMJ5 RNA-binding S4 n=6 Tax=Terrabacteria group TaxID=1783272 RepID=Q2RMJ5_MOOTA  ali  38  2.............DQFLKWNGVAATGGQAKELITSGLVRVNGQVERRRSHELVPGDEVEVKG........ 50
263 4.000e-16UniRef50_C2M2F6 Pseudouridine synthase n=12 Tax=Bacteroidetes TaxID=976 RepID=C2M2F6_CAPGI  ali  16  95..........IRLNKYIANAGICA-RREADRYIAAGNVEVNGKPMTELGYRVQPTDVVKFDGKNI..... 148
264 4.000e-16UniRef50_A0A0N1J0F7 Pseudouridine synthase n=1 Tax=bacterium 336/3 TaxID=1664068 RepID=A0A0N1J0F7_9BACT  ali  19  331..........IRLNKFIANAGVC-SRREADDLITQGFVKVNGNTITEMGYQVKPSDKVSYKGKLLQR... 386
265 4.000e-16UniRef50_A0A2P8ENC8 Ribosome-associated protein n=2 Tax=Fusobacterium naviforme TaxID=77917 RepID=A0A2P8ENC8_9FUSO  ali  38  9MTDIKIKDEYIKLEQALKLSGEFSMGSDAKYAVKEGKVLVNGAVETQRGKKLRDGDIFSTGGHDYRII.. 76
266 4.000e-16UniRef50_A0A090Q444 Ribosomal large subunit pseudouridine synthase B n=41 Tax=Bacteroidetes TaxID=976 RepID=A0A090Q444_9FLAO  ali  17  60......DTKGIRLNKYIANSGIC-SRREADVFIAAGSVFVNDKPVTEMGYRVQPDDHVKFDGQSI..... 117
267 4.000e-16UniRef50_A0A2A5B5P7 GntR family transcriptional regulator n=2 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2A5B5P7_9GAMM  ali  26  305.....LNREPIELYKILKFEGLVGSGGEAKTMIADGLVLLNGKVETQKRKKIMSGDVIEIGAERIR.... 365
268 4.000e-16UniRef50_A0A0J7J3I3 Pseudouridine synthase n=8 Tax=Flavobacteriales TaxID=200644 RepID=A0A0J7J3I3_9FLAO  ali  15  63.....LHKDTIRLNKYIANSGIC-SRREADELITQGLVQVNGVVITEMGYQVQKTDKVVFDGQGI..... 121
269 4.000e-16UniRef50_A0A240EMQ9 Ribosome-associated protein n=1 Tax=Vibrio thalassae TaxID=1243014 RepID=A0A240EMQ9_9VIBR  ali  36  21...IEVTSHPIELYKLFKVANLVGGGGEAKHFIAEGYVAVNGELETRKRRKMYAGDFFEFDQEYYVVV.. 85
270 4.000e-16UniRef50_A0A1H6UNZ0 Pseudouridine synthase n=5 Tax=Cytophagaceae TaxID=89373 RepID=A0A1H6UNZ0_9BACT  ali  18  342....KEETDEIRLNRYIANAGIC-SRREADDLISSGQISVNGKIVNEMGYKVRPTDVVKYGKK....... 399
271 4.000e-16UniRef50_A0A2R8B7N8 Heat shock protein 15 n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2R8B7N8_9RHOB  ali  20  3......DADRIRIDKWLWQARFCKTRSLAAGTVASGRVRINGERSVKPGRAIGPGDVLTLGGGGVRVVR. 66
272 5.000e-16UniRef50_A1SRW3 Uncharacterized protein n=15 Tax=Alteromonadales TaxID=135622 RepID=A1SRW3_PSYIN  ali  28  11...VEIKEEPTALYKILKFANLVSGGGEAKLAITEGYVFLNGQVETQKRKKIYAGDVISFNEQHYQI... 74
273 5.000e-16UniRef50_A0A2E3X7F1 Pseudouridine synthase n=9 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E3X7F1_9FLAO  ali  23  11.....IDYELIRLNKFISNSGIC-SRREADEFIKLGMVKVNGKMITKMGYKVLPSDIVKYDGETI..... 69
274 5.000e-16UniRef50_A0A2A5XK51 RNA-binding protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2A5XK51_9BACT  ali  29  5..EFKLNTEYIELNKLLKILSLVESGGQANNLITEGFVRYNGQVDTRKRLKLRKGDKIEFTEMLIRI... 69
275 5.000e-16UniRef50_A0A1V5YSY2 Pseudouridine synthase n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5YSY2_9BACT  ali  22  144.......TKPIRLNKFLANAGIC-SRREADEFIAAGVITVNGEVVKEMGVKVLPTDKVMFHNQQVRI... 202
276 5.000e-16UniRef50_A0A2V2DUN2 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2DUN2_9FIRM  ali  37  1MKALKISGAYIRLCDALKLAGAAETGGMAKMRIINGEVLVNGSICSVKGKKLYPGDRFSLQEEEFVI... 67
277 5.000e-16UniRef50_C6VXU0 Pseudouridine synthase n=12 Tax=Cytophagaceae TaxID=89373 RepID=C6VXU0_DYAFD  ali  17  317....KEETDEIRLNRYIANAGIC-SRREADDLISSGQISVNGKIVTEMGYKVRPTDVVKYGKK....... 374
278 5.000e-16UniRef50_A0A1Y5P1V8 Uncharacterized protein n=7 Tax=Micrococcales TaxID=85006 RepID=A0A1Y5P1V8_9MICO  ali  38  7IDDVSIGSETIRLGQFMKFAGLLDSGGNVKEAVIDGYVTVNGEVDRRRGRQLQVGDVIDFEGRRVRV... 73
279 5.000e-16UniRef50_A0A2N0VMM2 Pseudouridine synthase n=2 Tax=Bacteria TaxID=2 RepID=A0A2N0VMM2_9BACT  ali  19  13........DEIRLNKYIAHAGFC-SRRDADEYIENGKVKINGKVVTELGTKVSTDDKIEVEGQRV..... 68
280 5.000e-16UniRef50_A0A226BZB6 RNA-binding protein n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226BZB6_9FIRM  ali  41  4.KNVSIETEYITLGQLLKYTNLVSTGGEVKHLIESNRILINGNETNKRGKKIYPGDEIIINNNLSVKV.. 70
281 5.000e-16UniRef50_A0A076H8J3 tRNA synthetase RNA-binding protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A076H8J3_9SYNE  ali  35  1..........MKLDQYLKWKGWVSTGGEAKQRIQNGEVSVNGTVETRRGRQLAEGDRVSLAGEDGVVGEA 60
282 6.000e-16UniRef50_U7D504 RNA-binding S4 domain-containing protein n=2 Tax=Bacteria TaxID=2 RepID=U7D504_9BACT  ali  33  2..NFTIEGEWIELCQLLKACNLCESGGAAKTLIQGGLVLVDGSVEQRRRKKIYPGQTV............ 57
283 6.000e-16UniRef50_A0A0K8MVZ9 S4 domain containing protein YaaA n=5 Tax=Fructobacillus TaxID=559173 RepID=A0A0K8MVZ9_9LACT  ali  45  3.ERVAIKTAYITLAQLLKMENIIASGGQAKAFLAEQSVLLNGEEENRRGKKLYPGDQVDFQGTRYLI... 68
284 6.000e-16UniRef50_F9YSF6 Pseudouridine synthase n=12 Tax=Capnocytophaga TaxID=1016 RepID=F9YSF6_CAPCC  ali  20  108..........IRLNKYIADAGIC-SRRNADIYIASGNVQVNGEVITQLGFRVKPNDVVKFDGKVI..... 161
285 6.000e-16UniRef50_E3BK78 Uncharacterized protein n=4 Tax=Vibrio TaxID=662 RepID=E3BK78_9VIBR  ali  36  18...IEVSTQPIELYKVLKIAELVSGGGEAKHFISNGYVAVNGEVEYRKRKKLYDGDYFEFNQEFYVIV.. 82
286 6.000e-16UniRef50_A0A2E1KRV3 RNA-binding protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E1KRV3_9PLAN  ali  45  5......QDETIQLDQFLKWVGAVGTGGEAKRVIQAGRVRVNDQRETRRRRKLSPNDVV-VLGERSFVVQ. 66
287 6.000e-16UniRef50_B3ERJ4 Pseudouridine synthase n=25 Tax=root TaxID=1 RepID=B3ERJ4_AMOA5  ali  18  18.........YVRLNKWISNAGIC-SRREADELIQAGRITVNGEKITTLGYQVKNTDIVKFRDK....... 70
288 6.000e-16UniRef50_G0IZI9 Pseudouridine synthase n=30 Tax=Bacteria TaxID=2 RepID=G0IZI9_CYCMS  ali  20  97.KTTQTDADEIRLNKFIANAGIC-SRRDADKLIENGEISVNGKVVNEMGYKVLRKDRVVYKGKSIR.... 160
289 6.000e-16UniRef50_A0A2D7DGT6 Pseudouridylate synthase n=5 Tax=Flavobacteriales TaxID=200644 RepID=A0A2D7DGT6_9FLAO  ali  22  52......SGGPMRLNRYIANAGVC-SRREADALIESGVVTVNGEIVVQMGYKVNAGDTVRVGGTSIR.... 110
290 6.000e-16UniRef50_H5WRK0 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=H5WRK0_9BURK  ali  35  12..DFLLRGEHITLDALLKATGLASSGGDAKLQIASGQVMVNQEAELRRGRKLRAGDLVVVGTQRIQ.... 75
291 6.000e-16UniRef50_A0A257IW91 Pseudouridine synthase n=1 Tax=Cytophagaceae bacterium BCCC1 TaxID=2015573 RepID=A0A257IW91_9BACT  ali  20  282....ETFTPTIRLNRYLANAGLC-SRRDADEFIASGQITVNGEIITEMGYQVQPTDVVKY-GRKI..... 340
292 6.000e-16UniRef50_UPI000DD0B871 RNA-binding S4 domain-containing protein n=1 Tax=Catenovulum sp. RQJ05 TaxID=2234133 RepID=UPI000DD0B871  ali  31  1MSIIYINREPVELYKILKFENLVEGGGEAKILISEGYVAVNGEIETQKRKKIYDGDVIEFDELRYEI... 67
293 7.000e-16UniRef50_G8R5L3 Uncharacterized protein n=17 Tax=root TaxID=1 RepID=G8R5L3_OWEHD  ali  31  1MKTFELNDEFIELNRLLKTLGMVGTGGEAKIRISDGEALLNGEPETQVRKKLRSGDVIEFGGEKVSI... 68
294 7.000e-16UniRef50_A0A1B9Y043 Pseudouridine synthase n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1B9Y043_9FLAO  ali  16  68......EDTGIRLNKYISNSGIC-SRREADTYIEHGSVSVNGKLMTQMGYKVQPTDEVRFDGTLISI... 127
295 7.000e-16UniRef50_A8RAI7 S4 domain protein YaaA n=25 Tax=Bacteria TaxID=2 RepID=A8RAI7_9FIRM  ali  52  2..NIKINSEYITLGQLLKKADFIQSGGEAKFAVKEMDITVNGEQEDRRGRKLYAGDRLVIDGVEVII... 66
296 7.000e-16UniRef50_D4Z4N5 Putative RNA-binding protein S4 n=22 Tax=Alphaproteobacteria TaxID=28211 RepID=D4Z4N5_SPHJU  ali  18  7...VPAHGPSLRIDKFLWFARLAKSRSVAQKMAEDGHIRLNGRRIERSHSPVRAGDLITFPHSGVRVVR. 73
297 7.000e-16UniRef50_A0A257LDU2 Pseudouridine synthase n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A257LDU2_9BACT  ali  20  97.......GESVRLNRFISNAGVC-SRREADELIGAGLVSINGAVVTELGCKVNAGDVVRFNGEKLTV... 155
298 7.000e-16UniRef50_R5Q7S7 RNA-binding S4 n=1 Tax=Acetobacter sp. CAG:977 TaxID=1262685 RepID=R5Q7S7_9PROT  ali  25  1.....MSAESLRIDKWLWFSRFSKTRTAAQELCEAGHVSVNGEKVLKVSREIRIGDELDIRGSVRFHVR. 65
299 7.000e-16UniRef50_A0A2W4ZZB1 RNA-binding protein n=1 Tax=Phormidesmis priestleyi TaxID=268141 RepID=A0A2W4ZZB1_9CYAN  ali  49  7........EFIKLDQFLKVTDVARSGGDAKLLIRSGEVSVNGEMELRRGRKLYDQDVVTIDDDVSFTVE. 67
300 7.000e-16UniRef50_A0A2P7TCA4 Pseudouridine synthase n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A2P7TCA4_9SPHI  ali  20  68MVYEELETKGMRLNKYVAAAGVC-SRRHADELIAAGEITVNGEVITAMGHKVFAKDVVKYNNK....... 129
301 7.000e-16UniRef50_A0A1K1P3J2 Pseudouridine synthase n=164 Tax=cellular organisms TaxID=131567 RepID=A0A1K1P3J2_9FLAO  ali  17  34.KPVATNPDEMRLNKFIANAGIC-SRRDADIYITAGSVSVNGQPVTELGFKVKLSDEVRFDGKVIR.... 97
302 7.000e-16UniRef50_A0A2D9Z4S0 RNA-binding protein n=7 Tax=Planctomycetaceae TaxID=126 RepID=A0A2D9Z4S0_9PLAN  ali  35  18........QHVRLDHFLKLLQFAESGGHAKVLIQGGLVHVNGELCTARKRKLFHGDEIKIDDEVVTV... 76
303 7.000e-16UniRef50_A0A1Y3VKB7 Pseudouridine synthase n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A1Y3VKB7_9BACT  ali  15  219..EPAAQTGEMRLNRFIAQSGIC-SRREADDFILAGVVTVNGKVVTELGTKVQPTDEVRFNDEPVR.... 281
304 7.000e-16UniRef50_A0A1F3Q716 Pseudouridine synthase n=1 Tax=Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_35_15 TaxID=1797364 RepID=A0A1F3Q716_9BACT  ali  18  206......DDGTVRLNKYIANAGIC-SRREADALISSGVVQVNGKNITEMGYKVKPTDIIKYGGQTLK.... 264
305 7.000e-16UniRef50_M6BIL1 30S ribosomal protein S4 n=47 Tax=Bacteria TaxID=2 RepID=M6BIL1_LEPBO  ali  21  50...........RLDNVVYRLGFAVTRRQARNFIAHRHVLVNGERVDIPSYRLNVGDKVEIREK....... 101
306 7.000e-16UniRef50_A0A1V6CNN3 Pseudouridine synthase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1V6CNN3_9BACT  ali  21  151....PLKEELIRLNRFISNAGVC-SRREADKFIAAGVVKVNGQIVTELGTKVSPTDEVRFDDQLI..... 210
307 7.000e-16UniRef50_A0A1M4VET3 Ribosomal large subunit pseudouridine synthase B n=1 Tax=Psychroflexus salarius TaxID=1155689 RepID=A0A1M4VET3_9FLAO  ali  19  26.QQIKDPNAGMRLNKYIANSGVC-SRRDADIYIKSGNVTVNGEVITEMGHKVKLQDEVKFDGRRI..... 88
308 7.000e-16UniRef50_A0A0E9GJ27 30S ribosomal protein S4 n=11 Tax=cellular organisms TaxID=131567 RepID=A0A0E9GJ27_CHLTH  ali  51...........RLDNVVYRLGLATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSAKV... 106
309 8.000e-16UniRef50_A0A2N8MC65 RNA-binding protein n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2N8MC65_9RHIZ  ali  21  6...........RLDKWLWFARVARTRGLAARLVAEGHVRLNARRIETPAKGVGPGDVLTIALERQVRV.. 62
310 8.000e-16UniRef50_E1RCN3 30S ribosomal protein S4 n=10 Tax=Spirochaetes TaxID=203691 RepID=E1RCN3_SEDSS  ali  13  100...........RLDNVVYRLRFANSRKQARQLVSHGHILVNGKRVTIPSYVVRQGDEIEIREASKKMVV. 157
311 8.000e-16UniRef50_A0A2N7D6V5 Urease n=4 Tax=Vibrionaceae TaxID=641 RepID=A0A2N7D6V5_9VIBR  ali  36  22...IEVSSHPIELYKLFKVANLVGGGGEAKHFISEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVV.. 86
312 8.000e-16UniRef50_B0RQY2 Uncharacterized protein n=2 Tax=Xanthomonas campestris TaxID=339 RepID=B0RQY2_XANCB  ali  27  56..EFDLDGEYIELNQLLKLAGIADSGGQGKAIVASGAVSVDGVQELRKTAKIRPGQLVQLDDVEIRV... 120
313 8.000e-16UniRef50_A0A2E6PWH6 Pseudouridine synthase n=18 Tax=Bacteria TaxID=2 RepID=A0A2E6PWH6_9FLAO  ali  21  4.KKTQKPSEGIRLNKFIAHAGIC-SRREADMHIKIGSVKVNNKVMTEMGYKVVPTDVVQFDGQ....... 64
314 8.000e-16UniRef50_A0A1Y4NPH7 RNA-binding protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Y4NPH7_9FIRM  ali  37  1MDKFRLREDFIRLGQVLKAAGLVENGAEAKEVIQNGEVTVNGETDTRRGRKLYDGDVAAYAGREIKI... 69
315 8.000e-16UniRef50_E1SNZ3 RNA-binding S4 domain protein n=3 Tax=Proteobacteria TaxID=1224 RepID=E1SNZ3_FERBD  ali  30  12.......DDFIELYKVLKIEGWVGSGSEAKMLIAEGEVLVNHEVETRKRRKLVPGDNVIFGEEAVLI... 71
316 8.000e-16UniRef50_A0A1F8Y0B8 RNA-binding protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F8Y0B8_9DELT  ali  23  2.......SEEIRLDKWLWAARFFKTRSLAATAVSGGKVHVNGAR-TRPARAVRIGDEIKIRHEWIVIVRG 66
317 9.000e-16UniRef50_A0A1F2X9G6 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_63_9 TaxID=1797198 RepID=A0A1F2X9G6_9ACTN  ali  43  8.........PITLGQFVKLAGLAATGGEAKQLVTTGLVLVNGRIEARRGHKLGQSDVVESRGAAAQVVK. 67
318 9.000e-16UniRef50_U4K4V3 Uncharacterized protein n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=U4K4V3_9VIBR  ali  35  12...VEVASQPIELYKVLKIANAVSGGGEAKYAISEGYVAVNGELETRKRRKLYDGDLIEFNQEYYVVI.. 76
319 9.000e-16UniRef50_A0A2E5LMC4 RNA-binding protein S4 n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E5LMC4_9PROT  ali  13  1MKQ---TSDNLRLDKWLWHARFFKSRTLAAKQITGGKCRVNKQIIKKVRYQIHKGDVLTFQGQRIRIIR. 67
320 9.000e-16UniRef50_A0A0S2HWT7 Pseudouridine synthase n=41 Tax=Bacteroidetes TaxID=976 RepID=A0A0S2HWT7_9BACT  ali  18  17.......DDPIRLNRYIANSGVC-SRREADKLIEQGKIKVNGEIVTELGFKVKRSDDVEYEGKSLV.... 74
321 9.000e-16UniRef50_A0A1V5W3V6 Pseudouridine synthase n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W3V6_9BACT  ali  18  195......DDDLIRLNKFIANAGVCA-RREADELIASGVITVNGTVVTEMGYKVKRTDTVLMDGKALV.... 253
322 9.000e-16UniRef50_A0A1I0E5U6 Pseudouridine synthase n=5 Tax=Bacteroidia TaxID=200643 RepID=A0A1I0E5U6_9BACT  ali  20  73....TLSAEGMRLNRFIANAGVC-SRREADTFIGAGAVTINGKIITELGTRVLPGDEVRFDGRKI..... 132
323 9.000e-16UniRef50_A0A256WJK8 RNA-binding protein n=1 Tax=Bacteroidetes bacterium 4572_77 TaxID=1972459 RepID=A0A256WJK8_9BACT  ali  32  2..TFSIEGEYIELNRLLKLLSWVESGGQAHMFISQGEVIVNGETEYRKRKKLRPKDVVSFNDQTVEI... 67
324 9.000e-16UniRef50_A0A2G6GAP4 30S ribosomal protein S4 n=1 Tax=Candidatus Campbellbacteria bacterium TaxID=2026716 RepID=A0A2G6GAP4_9BACT  ali  18  95...........RLDNVVYKAGLADTRAMAKQMVSHGHITVNGRKLNIPSYQVKVGDKIAVRKES...... 147
325 9.000e-16UniRef50_A0A1L6FEP7 Uncharacterized protein n=8 Tax=root TaxID=1 RepID=A0A1L6FEP7_9RHOO  ali  31  15...FAVRGEHIQLDQLLKAAGLVDSGGAAHVAVAEGRVRVDGKVETRKRAKLRAGQRVRFGGEDIELVEA 81
326 9.000e-16UniRef50_A0A1I1Q9F3 Ribosome-associated protein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1I1Q9F3_9CLOT  ali  36  1MNKVKINTEIIKLDAFLKWSGIASLGSEAKIYIQEGLIKINGEICLQRGKKLKIGDV............. 57
327 9.000e-16UniRef50_A0A1S7DUZ6 Pseudouridine synthase n=22 Tax=FCB group TaxID=1783270 RepID=A0A1S7DUZ6_RIEAN  ali  14  77........DTIRLNKYIANSGIC-SRREADELIQQGLVEINGKVVTELGYQVQKTDKVVFDGQSI..... 132
328 9.000e-16UniRef50_A0A2D5TMK0 Pseudouridine synthase n=14 Tax=Bacteria TaxID=2 RepID=A0A2D5TMK0_9FLAO  ali  25  36..........IRLNKYIANAGVC-SRREADVFIQQGSVQVNGKLITEMGYKVQPTDEVKFDGTTI..... 89
329 9.000e-16UniRef50_D7E3Z6 RNA-binding S4 domain protein n=19 Tax=Bacteria TaxID=2 RepID=D7E3Z6_NOSA0  ali  41  1.........MIKLDQFLKLLGIGSTGGQAKLMIIDGDVKVNGTVETRRGRKLAPTDIVTVTGKTFNV... 58
330 1.000e-15UniRef50_A0A090IIK0 Uncharacterized protein n=8 Tax=Moritella TaxID=58050 RepID=A0A090IIK0_9GAMM  ali  31  12...VVVSEEPIELYKILKIENLVTSGSEAKNHIANGYVYVNGEVETRKRKKIMFGDIIGFDGEAYQV... 75
331 1.000e-15UniRef50_A0A2G0CGY1 Pseudouridine synthase n=1 Tax=Lewinella marina TaxID=438751 RepID=A0A2G0CGY1_9BACT  ali  18  31..........MRLNKYIAHAGVA-SRRTAGDMVKAGKVKVNGEVLDNPAYQIQEGDVVEYNGEVV..... 84
332 1.000e-15UniRef50_C4VND8 S4 domain protein YaaA n=75 Tax=Terrabacteria group TaxID=1783272 RepID=C4VND8_9LACO  ali  45  4IKVFKIKGEFITLGQFLKEETYVGSGGQAKCFLAETPVILNGQKENRRGKKLHVGDEVEVQGQIYK.... 69
333 1.000e-15UniRef50_W9AQF3 S4 domain protein YaaA n=4 Tax=Oceanobacillus TaxID=182709 RepID=W9AQF3_9BACI  ali  55  46.EEIEISTEYIALGQFIKLANILESGGMVKAFLQDEGVLVNNEREHRRGRKLYAGDIVELEGISYKVIKA 115
334 1.000e-15UniRef50_I3TQ56 Heat shock protein n=5 Tax=Tistrella TaxID=171436 RepID=I3TQ56_TISMK  ali  13  47...........RLDKWLWCARFYKSRTQAARLCADGLIRLNRMPVTKAAQMVKPGDVLTFSGNRIRVVQ. 105
335 1.000e-15UniRef50_A0A1F3MB44 Pseudouridine synthase n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3MB44_9BACT  ali  19  282..........IRLNKYLADAGIC-SRREADRLIESGVVEINGVVVTELGTKVGPNDKVRYGGESLKR... 337
336 1.000e-15UniRef50_F0ID17 Pseudouridine synthase n=64 Tax=Bacteroidetes TaxID=976 RepID=F0ID17_9FLAO  ali  18  56......DSKGIRLNKYIANAGICA-RREADRYITAGNVEVNGKPMTELGYRVQPNDIVKFDGKNI..... 113
337 1.000e-15UniRef50_F0RCX5 RNA-binding S4 domain protein n=20 Tax=Flavobacteriaceae TaxID=49546 RepID=F0RCX5_CELLC  ali  20  42.........SIRLNKYVANSGVC-SRREADVFIAAGSVTVNGKVVSEMGYKVKLDDVVKFDGR....... 94
338 1.000e-15UniRef50_A0A2J8HJC8 Uncharacterized protein n=7 Tax=Vibrio TaxID=662 RepID=A0A2J8HJC8_VIBDI  ali  36  21...VEVDNQPIELYKVLKIADVVSGGGEAKYAITEGYVAVNGEVELRKRRKLYDGDLIEFNQEFYLVI.. 85
339 1.000e-15UniRef50_UPI00047ED403 RNA-binding S4 domain-containing protein n=2 Tax=Acholeplasma TaxID=2147 RepID=UPI00047ED403  ali  42  1MKTFYLNGEFMTLAQFLKANDYINSGGEAKYFLQDYVVKINGEQCSLRGKKLYEKDIVTVGNDDFV.... 66
340 1.000e-15UniRef50_UPI000C6DAAC0 RNA-binding S4 domain-containing protein n=1 Tax=Colwellia echini TaxID=1982103 RepID=UPI000C6DAAC0  ali  29  8...VELNRQPVELCKLLKIANLVSGGGEAKIVISEGYVLLNGEVEYQKRKKVYHEDVIEFNGEIVQLV.. 72
341 1.000e-15UniRef50_A0A1F4Y3S7 30S ribosomal protein S4 n=3 Tax=Candidatus Adlerbacteria TaxID=1752736 RepID=A0A1F4Y3S7_9BACT  ali  16  94...........RLDNVIFRSGIVKTRRAARQLVSHGHVTVNGRRLTIPSHAVQMNDVVAIRPESR..... 147
342 1.000e-15UniRef50_A0A2T9XNF4 RNA-binding protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2T9XNF4_9CELL  ali  44  14.....ISDESIRLGQFLKLAGLAESGAQARELLDDGVVSVNGEAEFRRGRQLRRGDLVVVD......... 69
343 1.000e-15UniRef50_Q1MAD8 Putative heat shock protein 15 n=403 Tax=Alphaproteobacteria TaxID=28211 RepID=Q1MAD8_RHIL3  ali  16  4.ETQPTSGSRQRIDKWLFFARMAKSRSVAQSHIQSGHVRINGERCSYPSQMVKPGDRIELTLERRDVV.. 70
344 1.000e-15UniRef50_A0A1T5LHI0 Pseudouridine synthase n=3 Tax=Bacteria TaxID=2 RepID=A0A1T5LHI0_9BACT  ali  15  332.EEAPAQTEKIRLNRYIANSGVC-SRREADELITMGLISVNGKTITELGYKVNPGDEVRYESKVLR.... 395
345 1.000e-15UniRef50_A8L260 Uncharacterized protein n=25 Tax=Bacteria TaxID=2 RepID=A8L260_FRASN  ali  48  3.....IDGDVIRLGQFLKLADVVEAGSAVKAVLASGSVSVNGEVETRRGRQLRPGDEVTLPGEQLRV... 64
346 1.000e-15UniRef50_Q9X1I3 30S ribosomal protein S4 n=3265 Tax=root TaxID=1 RepID=RS4_THEMA  ali  14  99...........RLDNVVYRMGFAINRRQARQLVNHGHFLVNGKKVNIPSYLLRPNDVVEVREKSR..... 152
347 1.000e-15UniRef50_A0A1G5NX94 Ribosome-associated heat shock protein Hsp15 n=1 Tax=Afifella marina DSM 2698 TaxID=1120955 RepID=A0A1G5NX94_AFIMA  ali  21  11......TTEAQRLDRWLWHARFVRTRSAAQKFISDGHVRINRQKVDQASRLVRIGDVLTLALPGVKVVEA 75
348 1.000e-15UniRef50_A0A0G1UDL4 30S ribosomal protein S4 n=23 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1UDL4_9BACT  ali  14  80.KNPGVTGEMIRLDNVVYRLGIAPSRSVGRQLVGHGHILVNGHKVTIPSYQVRVGDTITIRPQS...... 148
349 1.000e-15UniRef50_Q5E0W3 Uncharacterized protein n=40 Tax=Vibrionaceae TaxID=641 RepID=Q5E0W3_ALIF1  ali  35  14...VEVNVQPIELYKVLKIANVVSGGGEAKHVIGEGYVGVNGELEQRKRRKMYDGDVIEFNEEYYVVI.. 78
350 1.000e-15UniRef50_Q8YS38 Asl3253 protein n=22 Tax=Terrabacteria group TaxID=1783272 RepID=Q8YS38_NOSS1  ali  39  26.........MIKLDQFLKLVGIAPTGGQAKLMIMDGDVKVNGAVETRRGRKLVSSDRVTVAGQVFEV... 83
351 1.000e-15UniRef50_A0A2P7T9U4 Pseudouridine synthase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2P7T9U4_9SPHI  ali  20  1MVHEELQTKGMRLNKYVATAGVC-SRRHADELIAAGEITVNGEVITAMGHKVFTKDVVKYNGK....... 62
352 1.000e-15UniRef50_A0A257K9H4 Pseudouridylate synthase n=3 Tax=Flavobacterium TaxID=237 RepID=A0A257K9H4_9FLAO  ali  22  149......EADGIRLNKYIANSGVC-SRREADIYIQSGNVKVNQTVINELGYKVMPGDQVFFDGAKV..... 206
353 1.000e-15UniRef50_A0A0G1BEB0 30S ribosomal protein S4 n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1BEB0_9BACT  ali  13  74.....IEQLEMRLDNVVYKLGFAPSRRAARQMVSHGHVLINGVRTTIPSRTVFEGDVITVRERTR..... 133
354 1.000e-15UniRef50_A0A0P1E5C7 Heat shock protein 15 n=12 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A0P1E5C7_9RHOB  ali  13  7...........RIDKWLWQARFFKTRSLAAKQVSGGHVRLNGNRILKPAQAVGPGDVLTFPQGRIVRVV. 64
355 1.000e-15UniRef50_B7CCH6 S4 domain protein YaaA n=4 Tax=Firmicutes TaxID=1239 RepID=B7CCH6_9FIRM  ali  44  2..EFELRDEYITLAQLLKACDVVYSGGQAKEYLASMEVFVNGVNENRRGKKIYHGDIVETNGIRIEV... 66
356 1.000e-15UniRef50_A0A1V4RIF3 30S ribosomal protein S4 n=6 Tax=Bacteria TaxID=2 RepID=A0A1V4RIF3_9BACT  ali  100...........RLDNVVYRLGFAPSRRAARQLIRHRHFMVNDKVVDIPSYEVSPGDVVKVRDKSI..... 153
357 1.000e-15UniRef50_A0A0A8JFT2 S4-domain binding protein n=13 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0A8JFT2_BACSX  ali  50  1MELLKIDAEFVTLGQLLKMTNAISSGGMAKWFLEENIVYVNGEEERRRGKKLRHGDIVNVPGIGKFKIDG 70
358 1.000e-15UniRef50_K1TSW1 S4 domain-containing protein YaaA n=2 Tax=human gut metagenome TaxID=408170 RepID=K1TSW1_9ZZZZ  ali  38  6MEKVRIHTEFIKLDALLKFAGLCETGGEAKELIQGGEVKLNGEPCTMRR..................... 54
359 1.000e-15UniRef50_G4CLZ8 S4 RNA-binding domain protein n=16 Tax=Neisseriaceae TaxID=481 RepID=G4CLZ8_9NEIS  ali  32  9......NDEYIPLCDLLKLAGLAESGGQAKALIAAGEVLRNGAVETRKTAKIRGGETIEFNGCTLEI... 69
360 1.000e-15UniRef50_X5F758 Putative RNA-binding protein n=108 Tax=Betaproteobacteria TaxID=28216 RepID=X5F758_NEIME  ali  34  1METVYLEDEYIALCDLLKLAGLAESGGQAKAFIAEGLVLRNGETETRKTAKIRGGEVIEFDGARLEI... 69
361 2.000e-15UniRef50_Q04PW4 30S ribosomal protein S4 n=133 Tax=cellular organisms TaxID=131567 RepID=RS4_LEPBJ  ali  21  97...........RLDNVVYRLGFAVTRRQARNFIAHRHVLVNGERVDIPSYRLNVGDKVEIREK....... 148
362 2.000e-15UniRef50_G9YEH3 S4 domain protein n=3 Tax=Veillonellaceae TaxID=31977 RepID=G9YEH3_9FIRM  ali  35  1MKDIVIKTEKIQLDQFLKWADIVESGGQAGFLIADKKVIVNGEICTVKRKQLVTGDVIIIKDNGKYRLVG 70
363 2.000e-15UniRef50_A0A0K1J7S1 Uncharacterized protein n=16 Tax=Proteobacteria TaxID=1224 RepID=A0A0K1J7S1_9RHOO  ali  28  5...FAVRGEYIQLDQLLKATGLTGTGGEAHAAVEAGRVTVDGKVESRKRAKLRPGATVCLGGETVVLVAS 71
364 2.000e-15UniRef50_A0A2T2QY48 30S ribosomal protein S4 n=1 Tax=Parcubacteria group bacterium SW_4_49_11 TaxID=1919225 RepID=A0A2T2QY48_9BACT  ali  18  93...........RLDNVVFRTGLAVTRDMARQFISHGHIMVNGEIVTIPSYSVREGDVIRISEAGLR.... 147
365 2.000e-15UniRef50_A0A2H5XU87 30S ribosomal protein S4 n=12 Tax=Bacteria TaxID=2 RepID=A0A2H5XU87_9BACT  ali  14  125...........RLDALVYRAGFAPSIYAARQYVRHGHIEVNGQKVDIPSYRVKPNDVIQVREKSRK.... 179
366 2.000e-15UniRef50_A0A1Y4AHJ2 Pseudouridine synthase n=4 Tax=Bacteroidales TaxID=171549 RepID=A0A1Y4AHJ2_9BACT  ali  18  263.......SGEIRLNRFIAQSGLC-SRREADDYIQAGVVTVNGQVVTELGSKVKPTDDVRFNGERVQ.... 320
367 2.000e-15UniRef50_A0A1H4D4K3 Pseudouridine synthase n=3 Tax=Bacteria TaxID=2 RepID=A0A1H4D4K3_9BACT  ali  22  211......QTGEIRLNRFLAQSGIC-SRREADDFITAGLVSVNGQVVTVLGTKVMPTDEVKFNDSRVQ.... 269
368 2.000e-15UniRef50_A0A1G2Q8P0 Uncharacterized protein n=1 Tax=Candidatus Veblenbacteria bacterium RIFOXYC2_FULL_42_11 TaxID=1802428 RepID=A0A1G2Q8P0_9BACT  ali  10...........RLDNIVYRLGFAKTRAGARQLVNHGHILVDGKRVDIPSYQVRPGQVVSVN......... 59
369 2.000e-15UniRef50_A0A1X1MU55 Uncharacterized protein n=1 Tax=Vibrio sp. qd031 TaxID=1603038 RepID=A0A1X1MU55_9VIBR  ali  39  14.EEVLITQEPVELYKILKLANLVDGGGQAKHLIGEGYVAVNGELEFRKRRKTYDGDVVQV-GEQFFVV.. 79
370 2.000e-15UniRef50_A0A134ABU3 Pseudouridine synthase n=1 Tax=Peptoniphilus coxii TaxID=755172 RepID=A0A134ABU3_9FIRM  ali  20  1..........MRLQKYMAHAGVA-SRRKCEEIIAEGRVKVNGEVVDTQGYIVEEGDRVTVDGKKVWPVK. 58
371 2.000e-15UniRef50_G0L391 Ribosomal large subunit pseudouridine synthase B n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=G0L391_ZOBGA  ali  15  1..........MRLNKYVANSGVC-SRREADIYISAGSVTVNGKPVTEMGYKVKITDEVKFDGRLLNPIK. 58
372 2.000e-15UniRef50_UPI0006914588 hypothetical protein n=1 Tax=Arcanobacterium sp. S3PF19 TaxID=1219585 RepID=UPI0006914588  ali  29  1MKDIALRL-PIRLSAFVKLCGAAENGGQAKELIRSGNVKVNGRTETHPSHLLLDGDAVTVAG........ 61
373 2.000e-15UniRef50_A0A0M2VD94 RNA-binding protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A0M2VD94_9GAMM  ali  22  6.RNVTLSKQPVELYKILKFEGLCSSGGAAKAAVDGGLVKVNGVVETQKRKQINAGDTVTFANET...... 68
374 2.000e-15UniRef50_A0A1G2VAJ7 30S ribosomal protein S4 n=1 Tax=Parcubacteria group bacterium RIFCSPHIGHO2_01_FULL_45_26 TaxID=1817737 RepID=A0A1G2VAJ7_9BACT :_  ali  13  96..........MRLDNVVYRAGLVPTRRFARQTITHGHILVNGVKVSSPSYELNPGDVVTLR......... 146
375 2.000e-15UniRef50_A0A1G7RRX9 Ribosome-associated heat shock protein Hsp15 n=1 Tax=Pelagibacterium luteolum TaxID=440168 RepID=A0A1G7RRX9_9RHIZ  ali  17  11...........RLDKWLWHARVTKTRTLAQKLIEGGSVRLNGQRITAPDQKVGPGDGLTLQIHSRIRV.. 67
376 2.000e-15UniRef50_E6LEK5 S4 domain protein YaaA n=41 Tax=Terrabacteria group TaxID=1783272 RepID=E6LEK5_9ENTE  ali  60  1MKEIFLTSEYMTLGQMLKEASIISSGGQAKWFLAENSVFVDGELENRRGRKLYSGMMIEIP......... 62
377 2.000e-15UniRef50_A0A010Q480 RNA-binding protein n=5 Tax=Micrococcales TaxID=85006 RepID=A0A010Q480_9MICC  ali  34  1MSEVPIRDESIRLGQLLKLAGVVENGAIAREVIDSSGVRVDGEVETRRGAQIKRGQLVEFNGE....... 63
378 2.000e-15UniRef50_A0A2N2W0C4 Pseudouridine synthase (Fragment) n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-9 TaxID=2013699 RepID=A0A2N2W0C4_9BACT  ali  18  358......DDGTIRLNKYIANSGIC-SRREADTLIESGAVMVNGEVVTELGTKVTRADKIQFGGETLNI... 417
379 2.000e-15UniRef50_A0A1I2IMS1 Pseudouridine synthase n=2 Tax=Thermoflexibacter ruber TaxID=1003 RepID=A0A1I2IMS1_9BACT  ali  15  291.EEVKGDGGEVRLNRFIANAGVC-SRREADELIQKGRVKINGQVMTEMGYRVKPTDSVYLDDEPLKR... 355
380 2.000e-15UniRef50_A0A1L6CXK0 Uncharacterized protein n=131 Tax=Bacteria TaxID=2 RepID=A0A1L6CXK0_CORPS  ali  38  4.QDVTIRDQEIKLGQFIKLASLVETGGIAKEVIANGEVTVNGAVDTRRGKKLRDGDVVCV.......... 62
381 2.000e-15UniRef50_A0A2E1RK16 Pseudouridylate synthase n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E1RK16_9FLAO  ali  23  7........ELIRLNKFISNSGLC-SRREADMYISMGEVRVNDKIINQLGYKIRSGDKVYFNGQEI..... 62
382 2.000e-15UniRef50_A0A1F3J171 Pseudouridine synthase n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3J171_9BACT  ali  18  182.......GEDTRLNKFISNSGIC-SRREADVLISTGVVKVNGEVIITMGYKVKPGDKVTVDGRELK.... 239
383 2.000e-15UniRef50_K0ND55 Uncharacterized RNA-binding S4 domain protein n=5 Tax=Desulfobacteraceae TaxID=213119 RepID=K0ND55_DESTT  ali  31  27MEKVNIKTEFVELYKILKFENLAASGGEAKYLINDGFVRVNGSVETRKRKKIVPGDIIETGGVIIEI... 95
384 2.000e-15UniRef50_A0A095XEA2 30S ribosomal protein S4 n=2 Tax=unclassified Tissierellia TaxID=1737407 RepID=A0A095XEA2_9FIRM  ali  11  89...........RLDNMVYRAGFASSIRQARQMVVHGHILVNGKKVDRPSFQVQVGDELTLKEKSR..... 142
385 2.000e-15UniRef50_A0A2E6IMQ6 Pseudouridylate synthase n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E6IMQ6_9FLAO  ali  20  1MTENKSKSKLIRLNKFISSSGIC-SRREADLHISIGNVSVNGKIVTKMGLKVSIDDDVRFDGSIVR.... 65
386 2.000e-15UniRef50_A0A2E5AK76 Pseudouridine synthase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E5AK76_9FLAO  ali  22  11......KTDFIRLNKYISNSGIC-SRREADKFIEAGIVSVNGKVITQMGFKVNRSDIIKFNDSIIK.... 69
387 2.000e-15UniRef50_A0A0M4RMG1 tRNA synthetase RNA-binding protein n=43 Tax=Bacteria TaxID=2 RepID=A0A0M4RMG1_9MICC  ali  31  6IIDIPIRDDMIRLGQLLKLASLVEDGVEAADLIKNGMVKVNGEIDERRGSQLHDGDTVTVNGETVRI... 72
388 2.000e-15UniRef50_X5MMF2 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) n=2 Tax=Candidatus Phaeomarinobact  ali  15  13...........RIDRWMWCARFFKTRSIAARFVGTGKVRVNGTRVTKAAHQVRPGDVLTFPGDRIRVIE. 71
389 2.000e-15UniRef50_A0A1Y2K5N9 Pseudouridine synthase n=1 Tax=Magnetofaba australis IT-1 TaxID=1434232 RepID=A0A1Y2K5N9_9PROT  ali  16  25.......SEHPRLHKWLADAGLC-SRREAEEWIAAGRVSLNGHKVTKPGAKVGPQDLVAVDGNAVER... 83
390 2.000e-15UniRef50_A0A2E7FHD4 Pseudouridine synthase n=6 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2E7FHD4_9FLAO  ali  16  16.........TIRLNKYIAHAGIC-SRREADMHIGLGVVKVNNQIVTELGYQVKEGDVVHFDGKRI..... 70
391 2.000e-15UniRef50_A0A142EIW1 Pseudouridine synthase n=7 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A142EIW1_9BACT  ali  15  253......EDGAIRLNKYIANSGIC-SRREADELISSGQISVNGEVIKEMGHKVKKSDRVVFQGKRI..... 310
392 2.000e-15UniRef50_A0A1X0TPM9 RNA-binding protein n=48 Tax=Bacteria TaxID=2 RepID=A0A1X0TPM9_STASC  ali  53  3.QDISVKDD-ITLGQFLKNEGVIGTGGQAKWFLQDEEVLINGERETRRGKKLHDGDLVEIPSEGQFRI.. 68
393 2.000e-15UniRef50_A0A1T4NJL7 Pseudouridine synthase n=102 Tax=root TaxID=1 RepID=A0A1T4NJL7_9PORP  ali  21  189......STDFIRLNKFLANSGIC-SRRKADELIAAGKVSVNGAIVTTLGAHVTRQDEITCEGKVVSI... 248
394 2.000e-15UniRef50_A0A150HAE1 Ribosome-associated protein n=6 Tax=Brevibacterium TaxID=1696 RepID=A0A150HAE1_9MICO  ali  36  1MEEVWIRDDSIRLGQVLKLSGFVEDGVMAKELIQDGQVFVNGELNSRRSSNVNVGDVIAVP......... 61
395 2.000e-15UniRef50_A0A136LRK3 RNA-binding S4 domain-containing protein (Fragment) n=1 Tax=Bacteroidetes bacterium OLB12 TaxID=1619897 RepID=A0A136LRK3_9BACT :_  ali  15  180..TPKTDSDLIRLNKFIANSG-VGSRREADELIKMGLITVNGAVVTEMGHKVKVTDDVRYEGKKLK.... 242
396 2.000e-15UniRef50_A0A258BK04 30S ribosomal protein S4 (Fragment) n=1 Tax=Candidatus Saccharibacteria bacterium 32-49-10 TaxID=1970478 RepID=A0A258BK04_9BACT :  ali  12  3...........RLDNVIYRAGFATSRRAARQLVGHGHFLLNGRRVDIPSIRVKAGDEITVRPKSTK.... 57
397 2.000e-15UniRef50_A0A2E1EGG0 RNA-binding protein S4 n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E1EGG0_9RHIZ  ali  18  11...........RIDRWLWCARFLKSRSLAASLVQSGRLRVNGERVSKASRTIRPDDVLTFPGPHIRVVR. 69
398 3.000e-15UniRef50_A0A0L0LPQ6 30S ribosomal protein S4 n=22 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0L0LPQ6_9BACT  ali  13  84..EILHRSLEMRLDNITYRLGLAASRRAARQMVSHGHITVNGIKTTIPSRAIRIGDRIAVRE........ 143
399 3.000e-15UniRef50_W2E228 30S ribosomal protein S4 n=955 Tax=root TaxID=1 RepID=W2E228_9BACL  ali  12  83.ENFMILLES-RLDNLVFRLGFANSRAGARQLVSHGHVTVNGKKVDIASYQVSVGDVIGLRERSR..... 145
400 3.000e-15UniRef50_A0A250FB77 Pseudouridine synthase n=50 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A250FB77_9FLAO  ali  19  149..........IRLNKYIADAGIC-SRRNADMYISAGNVTVNGEVMTTLGYRVKPTDEVRFDGK....... 200
401 3.000e-15UniRef50_A0A1J5SM61 Heat shock protein 15 n=3 Tax=root TaxID=1 RepID=A0A1J5SM61_9ZZZZ  ali  17  1.....MPDGAMRIDQWLWFARLCKSRGLAQTLIGQGLVRLNRQAVAKAGTPLRPGDEVALP......... 56
402 3.000e-15UniRef50_A0A2G6D690 RNA-binding protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6D690_9PROT  ali  32  3IKEIIIERYPITLGQFLKYSAIVSDGMEARDIIASGTVAINGEIDTRRGRKLFPGDTVTVDTDQYQCSRS 72
403 3.000e-15UniRef50_A0A2R8AJK5 Heat shock protein 15 n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2R8AJK5_9RHOB  ali  15  1..........MRVDKWLWHARFFKTRGLATKLVSAGHMRVNGDKIAKASHGITTGDVLTFPQAKQVRV.. 58
404 3.000e-15UniRef50_L1P2D1 S4 domain protein n=27 Tax=Bacteria TaxID=2 RepID=L1P2D1_9NEIS  ali  32  9......DKEYIALCDLLKLAGLAESGGQAKMLIAAGNVLRNGEVETRKTAKIHGGEVIEFDGARLEI... 69
405 3.000e-15UniRef50_A6C9S7 Choline sulfatase n=6 Tax=PVC group TaxID=1783257 RepID=A6C9S7_9PLAN  ali  36  480...VSEDRAPIRLDQFLKFQAAVGTGGHAKVVIQGGEVTVNGVVETRRRKQLAPGDIVGYAGEE...... 540
406 3.000e-15UniRef50_A0A1V5PWV1 30S ribosomal protein S4 n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5PWV1_9CHLR  ali  14  97...........RLDNVIYRMGLALTRLQARQMVNHGHVLVNGRRLNIPSYLVRPGDIVSLKERARR.... 151
407 3.000e-15UniRef50_A9VYK7 RNA-binding S4 domain protein n=14 Tax=Rhizobiales TaxID=356 RepID=A9VYK7_METEP  ali  16  7...........RLDKWLWFARFARTRSMAARLVSDGHVRVNGTRTDAPAKAIHCGDVLTV.......... 55
408 3.000e-15UniRef50_A0A180ESP1 Pseudouridine synthase n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A180ESP1_9BACT  ali  16  31..........MRLNKYLAHSGVA-SRRQAAELIKAGKCQVNGEVQKSPGYQIEEGDVVVVAGKEV..... 84
409 3.000e-15UniRef50_F9DAD6 Pseudouridine synthase n=22 Tax=Prevotella TaxID=838 RepID=F9DAD6_9BACT  ali  25  255.KEENIDNEPLRLNKYLANAGVC-SRREADEFIQAGVVTVNGEVVKELGTKILRSDEVKFKDKPV..... 318
410 3.000e-15UniRef50_A0A0R2DH64 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=A0A0R2DH64_9LACO  ali  52  3.KDVFIETPYITLGQMLKEESIISTGGQAKWYLRENTVNINDEPDNRRGRKLYPGDKIAVPDAGLFFIRS 71
411 3.000e-15UniRef50_A0A0G4AQ82 30S ribosomal protein S4 n=114 Tax=root TaxID=1 RepID=A0A0G4AQ82_9BACT  ali  13  97...........RLDNVVFRMGFAPSRIMAKQFISHGHILVNGRKVTISSFQVKVGDIVAVREKS...... 149
412 3.000e-15UniRef50_J1FD46 Pseudouridine synthase family 1 protein n=9 Tax=Hymenobacteraceae TaxID=1853232 RepID=J1FD46_9BACT  ali  17  15........EPKRLNKFISDSGFC-SRRDADELIEQGRVTVNGKIPTDPGMKVTPKDKVRIDDEMLRV... 72
413 3.000e-15UniRef50_A0A2N2XWB5 Pseudouridine synthase n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-21 TaxID=2013690 RepID=A0A2N2XWB5_9BACT  ali  15  183....KPDSGEMRLNKYIANSGIC-SRREADELIKAGLVKINGKLVIELGSKVKPDDVVTYNGQTI..... 242
414 3.000e-15UniRef50_A0A099F4C9 Heat shock protein Hsp15 n=2 Tax=Paracoccus TaxID=249411 RepID=A0A099F4C9_9RHOB  ali  16  5......EPDTIRLDRWLHHVRLFRTRSLAADAIGGGGVRVNGQPCRKPARAVRPGDTVTVSAHGTVR... 65
415 3.000e-15UniRef50_A0A1H8GLS0 Heat shock protein Hsp15 n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1H8GLS0_9RHOB  ali  28........DSCRIDKWLFYTRFFKTRSLATEMITKGRLRINGQRQPKPGHAVRPGDTLTFPAKETRVIR. 89
416 3.000e-15UniRef50_A0A1H1M6Z7 23S rRNA pseudouridine2605 synthase n=13 Tax=root TaxID=1 RepID=A0A1H1M6Z7_9FLAO  ali  18  51MEKSPLNTEGIRLNKYIANSGVC-SRRDADMYIAAGNVTVNGKSITEMGYRVKLEDDVRFDGRR...... 114
417 3.000e-15UniRef50_A0A1I0ISR7 Ribosome-associated protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1I0ISR7_9ACTN  ali  27  4..DFELRSDFIPLCDLLKYCGVTETGGMAKHLIAEGLVLVDGEVELRKTAKIRAGQVVSGDGFSIHV... 68
418 3.000e-15UniRef50_A0A1C7GS18 30S ribosomal protein S4 n=24 Tax=Bacteria TaxID=2 RepID=A0A1C7GS18_9FIRM  ali  99...........RLDNVVYRCGWASSRAEARQLVVHGHFTVNGKKVDIPSYLVKPGEMVAIKDKSRQ.... 153
419 3.000e-15UniRef50_A0A0X8LIC8 RNA-binding S4 domain-containing protein n=10 Tax=Vibrio TaxID=662 RepID=A0A0X8LIC8_VIBFL  ali  35  21...IEVDAQPIELYKVLKIANAVSGGGEAKYAIAEGYVAVNGELEMRKRRKLYDGDLVEFNEEYYLII.. 85
420 3.000e-15UniRef50_A5GSL9 S4-like RNA-binding protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A5GSL9_SYNR3  ali  40  1..........MRLDQALKWQGLVATGGEAKLRIQGGEVQVNGSVESRRGRKLQSGDVVELAGRRFTI... 57
421 3.000e-15UniRef50_A0A0P8C1Z9 Ribosome-associated heat shock protein Hsp15 HslR n=75 Tax=root TaxID=1 RepID=A0A0P8C1Z9_9RHOB  ali  15  7...........RLDRWLWHARFFKTRSLAARIVSGGGVRVNGVRTAKPAAAVGPGDVLTFAQARAIRVV. 64
422 3.000e-15UniRef50_C7XXJ9 S4 domain protein YaaA n=7 Tax=Bacilli TaxID=91061 RepID=C7XXJ9_9LACO  ali  50  5.KVFQIDRDFITLGQLLKEEGIIPTGGAAKWFLKEHQVKINGDLDDRRGKKLYPNDQVEIIGIESVKIES 73
423 4.000e-15UniRef50_Q11YT0 Pseudouridine synthase n=2 Tax=Cytophaga TaxID=978 RepID=Q11YT0_CYTH3  ali  17  329..........IRLNKYISNSGIC-SRREADQLIIEGTVKVNGIVVTELGYKVKPGDSVKYNNK....... 380
424 4.000e-15UniRef50_G2KT97 Uncharacterized protein yaaA n=469 Tax=Bacteria TaxID=2 RepID=G2KT97_LACSM  ali  52  9.KEVLITTPYITLAQLLKMEDVIASGGQAKWYLREKTVYYNDEPENRRGKKLYDGDVVRVPDFGTFLIKS 77
425 4.000e-15UniRef50_A0A0Q8LFT1 RNA-binding protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q8LFT1_9MICO  ali  43  9..DVPIGGEAIRLGQFLKFAGVLDSGGDVKEVIIDGLVTVNGEVDRRRGRQLQLGDIVGFEGRRFRV... 73
426 4.000e-15UniRef50_UPI000DEA6133 pseudouridine synthase n=1 Tax=Aquiflexum sp. Z0201 TaxID=2249427 RepID=UPI000DEA6133  ali  19  426..NPKVQSDSLRLNKFIANSGIC-SRREADVLIQHGEIQVNGEVIKELGYKVNRTDKVIYKGKNI..... 487
427 4.000e-15UniRef50_R9PHM3 Uncharacterized protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=R9PHM3_AGAAL  ali  34  16.TEVYVDEQPIELYKVLKIGNLVNGGGEAKMAIAEGYVGLNGELEQRKRKKVYADDIIEFNGQFLYVV.. 82
428 4.000e-15UniRef50_A0A0L8V8A3 Pseudouridine synthase n=28 Tax=cellular organisms TaxID=131567 RepID=A0A0L8V8A3_9BACT  ali  22  33...IKKSDREIRLNKFIANAGIC-SRREADQLIEKGEITINGEVVTSLGYKVTSKDEVAYKGKVI..... 93
429 4.000e-15UniRef50_A0A0C2E520 Heat shock protein 15 n=28 Tax=Bacteria TaxID=2 RepID=A0A0C2E520_9PSED  ali  20  1MAQKAEEDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGERC-KPGKEPRVGDEIQIRDERTVVVQA 72
430 4.000e-15UniRef50_I0KCL8 Pseudouridine synthase n=15 Tax=Cytophagaceae TaxID=89373 RepID=I0KCL8_9BACT  ali  15  390....ESDPDSIRLNRYIANAGVC-SRREADELIGKGDVQVNGKVITEMGYRVKPGDVVKYGNK....... 447
431 4.000e-15UniRef50_A0A1F6E7A3 30S ribosomal protein S4 n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F6E7A3_9BACT  ali  10  93..........MRADNVVYRAGFAPTRRAARQMVSHGHIKVNDKRITVPSYNARVGDVLSVREGSR..... 147
432 4.000e-15UniRef50_A0A0G0PJ39 30S ribosomal protein S4 n=1 Tax=Candidatus Woesebacteria bacterium GW2011_GWA1_39_8 TaxID=1618552 RepID=A0A0G0PJ39_9BACT  ali  12  21...........RLDNVIFRLGFAPSRSMARQLISHGHILVNKRKARSPGLQVEKGDVISLRPESASKVT. 78
433 4.000e-15UniRef50_A0A0Q0KJF8 Urease n=20 Tax=Vibrionaceae TaxID=641 RepID=A0A0Q0KJF8_9VIBR  ali  35  20...VEVSSQPIELYKVLKIANAISGGGEAKHVISEGYVFVNGEEETRKRRKVYNGDLIEFNQEFYVVI.. 84
434 4.000e-15UniRef50_A0A2E3HRM1 Pseudouridine synthase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E3HRM1_9FLAO  ali  23  21..........IRLNKFLSNAGIC-SRREADQFIVMGLVTVNGKLVTEMGFQVQRSDEVRYDGQIVK.... 75
435 4.000e-15UniRef50_P81288 30S ribosomal protein S4 n=1974 Tax=root TaxID=1 RepID=RS4_GEOSE  ali  11  84.ENFMILLES-RLDNLVYRLGLARTRRQARQLVTHGHIIVDGSRVNIPSYRVKPGQTIAVREKSR..... 146
436 4.000e-15UniRef50_A0A0N1BMJ3 Uncharacterized protein n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N1BMJ3_9PROT  ali  12  4.......GAGLRLDKWLWFARLAKSRSQAQDLCESRRLRVDGRVVDRASAQVRAGSVVSFRGDELIVVR. 66
437 4.000e-15UniRef50_A0A1F6EEP0 Uncharacterized protein n=1 Tax=Candidatus Kaiserbacteria bacterium RIFCSPHIGHO2_12_FULL_56_13 TaxID=1798505 RepID=A0A1F6EEP0_9BA  ali  13  38...........RLDNVVYRLGLATTRRGARQMVAHGHIVVNGKRVRVPSYQVRTTDRIAVRGAS...... 90
438 4.000e-15UniRef50_A0A1G1SQS7 Pseudouridine synthase n=11 Tax=Cytophagales TaxID=768507 RepID=A0A1G1SQS7_9BACT  ali  15  426.EEEDFGTDELRLNRYIANAGIC-SRREADTLIAAGEIKVNGEVVTEMGYKVQPEDTVQYREKSVYV... 496
439 4.000e-15UniRef50_C1KRA9 Ribosomal protein S4 n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1KRA9_MICPC  ali  20  101..........MRLDVILYRARFATSYLQLHQWIAHGKVCVNGQVVTTKGRLLSPGDVVSIHPQAVSSVE. 159
440 4.000e-15UniRef50_W4UB00 30S ribosomal protein S4 n=1 Tax=Cutibacterium acnes JCM 18918 TaxID=1302243 RepID=W4UB00_CUTAC  ali  16  92...........RLDNVVYRAGLAATRRQARQMVSHGHFLVNGKKVNIPSYRVSTHDIIDVREKS...... 144
441 4.000e-15UniRef50_A0A1I7FSI7 Pseudouridine synthase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1I7FSI7_9FIRM  ali  12  1..........MRINKYIAGAGI-TSRRKADELIRRGRVTVNGKKMTEPGYDVRPGDTVSVGGRKIR.... 55
442 4.000e-15UniRef50_A0A2G6H8D9 Pseudouridine synthase (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6H8D9_9BACT  ali  15  39.KNIERNDGKIRLNKYIADAGIC-SRREADKLIASGAITVNGKVVTELGTKVSVTDQVQLGNDTLNR... 103
443 4.000e-15UniRef50_A0A0Q0PXX1 Urease n=37 Tax=Vibrionaceae TaxID=641 RepID=A0A0Q0PXX1_9VIBR  ali  35  20...VDVSSQPIELYKVLKIANAISGGGEAKHVISEGYVFVNGEEETRKRRKVYNGDLIEFNQEFYVVI.. 84
444 4.000e-15UniRef50_A0A1G9S362 30S ribosomal protein S4 n=1 Tax=Romboutsia lituseburensis DSM 797 TaxID=1121325 RepID=A0A1G9S362_9FIRM  ali  11  89...........RLDNLVYRLGLASSIRQARQMVVHGHILVNGKKVDRPSYEITVGDVISLREKS...... 141
445 5.000e-15UniRef50_K9RJG8 Uncharacterized protein n=48 Tax=Terrabacteria group TaxID=1783272 RepID=K9RJG8_9CYAN  ali  43  1.........MIKLDQFLKLLGIVQTGGQAKHLIVDGAVKVNGILETRRGRKLVTGDKITIENQTFEV... 58
446 5.000e-15UniRef50_A0A0S3PHG9 Uncharacterized protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0S3PHG9_9NOSO  ali  43  1.........MIKLDQFLKLIGIAPTGGQAKLMILDGDVKVNGAVETRRGRKLVATDQVTIAGQTFEV... 58
447 5.000e-15UniRef50_A0A258WUX5 RNA-binding protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A258WUX5_9SPHI  ali  26  1MLEFKLEGEFIPMIQLLKAMNLVPSGGEAQIVVEAGLVKYNGEVDLRKRLKVRRGDIVEFKGQKIKV... 67
448 5.000e-15UniRef50_C2MA52 Pseudouridine synthase n=4 Tax=Porphyromonas TaxID=836 RepID=C2MA52_9PORP  ali  17  203.......GEPIRLNKFLSNSGLC-SRRTADQYIAAGRVKVNGAVVSELGSQVLPTDQVMVDDKPV..... 259
449 5.000e-15UniRef50_A0A258V6S7 RNA-binding protein n=3 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A258V6S7_9SPHN  ali  12  1..........MRIDKFLWFTRFAGSRSLAQDWVSAGHMRLNGRRIERCSAAVKLGDVLVLPMRSRVTV.. 58
450 5.000e-15UniRef50_A0A1M7ZIF6 Heat shock protein Hsp15 n=5 Tax=Rhizobiales TaxID=356 RepID=A0A1M7ZIF6_9RHIZ  ali  19  8........DRQRLDKWLWFARFARTRTLAQELITTGKVRINRERTKSSSHLVRAGDVITVAGREVRVVR. 69
451 5.000e-15UniRef50_G2SPI4 S4 domain protein YaaA n=104 Tax=Terrabacteria group TaxID=1783272 RepID=G2SPI4_LACRR  ali  44  3.KEVRLKTPCITLGQLLKIENIVSSGGQAKYFLEEHEILVNGEHENRRGKKLYPGDEVVVADQGKFVMK. 72
452 5.000e-15UniRef50_UPI000C9F871B RNA-binding S4 domain-containing protein n=1 Tax=Rhodopseudomonas palustris TaxID=1076 RepID=UPI000C9F871B  ali  20  2........ERQRLDKWLWHARVVKARSSAAALVESGHVRINGGRQTSPGHAIKIGDVVTIALDRSVRV.. 61
453 5.000e-15UniRef50_A0A2E7W4K0 Uncharacterized protein n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E7W4K0_9PROT  ali  14  3........DSLRIDKWLWFARFCKSRSLAKTMCISNKVSVNGTKVQKPNFQIRKGDVISYRSFQRDIVVA 66
454 5.000e-15UniRef50_A0A2E3A9X3 Pseudouridine synthase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2E3A9X3_9FLAO  ali  14  18...........RLNKFIANSGIC-SRREADMFIAMGMVKINGKIVVEMGYQVQPGDDVRYDGRRII.... 71
455 5.000e-15UniRef50_H2G1B4 Ribosome-associated protein n=8 Tax=Proteobacteria TaxID=1224 RepID=H2G1B4_OCESG  ali  22  3.ETFSLEGDFIPLCNLLKVLGWCDSGAMAKGVIDDGAVTVNGQVEVRKRCKIVAGQTVHFNGQTVTVTE. 71
456 5.000e-15UniRef50_A0A1V6BFQ4 Pseudouridine synthase n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6BFQ4_9BACT  ali  16  227.........SIRLNRYIANSGIC-SRREADEMIEAGLISVNGEIVTQLGTKVSQDDVVKYNGETIR.... 282
457 5.000e-15UniRef50_S7X464 Ribosomal large subunit pseudouridine synthase B n=108 Tax=Bacteria TaxID=2 RepID=S7X464_9FLAO  ali  15  51......NPDEIRLNKYIANSGMC-SRREADENIAIGLVMVNGKVVTEMGFKVKRTDDVRFDGQRV..... 108
458 5.000e-15UniRef50_A0A0H1RAV0 RNA-binding protein S4 n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0H1RAV0_9RHIZ  ali  15  1.....MREDRQRLDKWLWFARFAKTRTLAAKLVTSGFVRVNGQRTDNAAKAVAVGDVVTIALARTTLVV. 64
459 5.000e-15UniRef50_Q4JY78 Uncharacterized protein n=24 Tax=Corynebacterium TaxID=1716 RepID=Q4JY78_CORJK  ali  36  1MEEVSIRDSEIKLGQFIKLANLVETGGEAKEAIAAGVVQVNGAVDTRRGKTLRGGDEVTL.......... 62
460 5.000e-15UniRef50_A0A1G1TB66 Pseudouridine synthase n=5 Tax=Hymenobacteraceae TaxID=1853232 RepID=A0A1G1TB66_9BACT  ali  15  215.EEEDFGTDELRLNRYIANAGIC-SRREADTLIAAGEIKVNGEVVTEMGYKVQPEDTVQYREKSVYV... 285
461 5.000e-15UniRef50_A0A0F2P2G0 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A0F2P2G0_9FLAO  ali  24  38....KVDDGKIRLNKFLANAGIC-SRREADVLIQTGVVEVNGKIITEMGFKVADTDKIVCGGETLR.... 98
462 5.000e-15UniRef50_K0IV28 Uncharacterized protein n=22 Tax=Bacteria TaxID=2 RepID=K0IV28_AMPXN  ali  54  4.EKIQIKTDYIQLGQFLKLANIVDSGGSVKYFLNDYAVFVNGDQDQRRGKKLYPGDIIEVEEVGQFQIV. 71
463 5.000e-15UniRef50_A0A2G5K3B2 RNA-binding protein S4 n=2 Tax=Rhodobacterales TaxID=204455 RepID=A0A2G5K3B2_9RHOB  ali  4......TPDTVRIDKWLWYARFFKTRSMCAKLISDGRITLNDQKIKKPATTVNIGDRIMFRQQRIVTIVG 70
464 5.000e-15UniRef50_A0A1G2HHK6 Uncharacterized protein n=4 Tax=Candidatus Spechtbacteria TaxID=1817915 RepID=A0A1G2HHK6_9BACT  ali  17  56...........RLDSVLYRSGFAPTRGAARQMASHGHAIVNGRRVTIPSYQLRTGDKVNVRE........ 106
465 5.000e-15UniRef50_UPI0004E28A1E RNA-binding S4 domain-containing protein n=1 Tax=Lachnospiraceae bacterium AC2028 TaxID=1408321 RepID=UPI0004E28A1E  ali  38  1MITFYLKDDFIKLGQVLKASGLCESGVDAKYDIINGEVTVNGEVEERRGRKIVSGDVIEY.......... 60
466 5.000e-15UniRef50_A0A094WCD2 Pseudouridine synthase n=7 Tax=Leptospirillum TaxID=179 RepID=A0A094WCD2_9BACT  ali  17  1MEQSTLNTTFIRLQKLLAHRGLA-SRRNAEEMIRGGLVKVNGIVVTVPGTKVHPTDRVTVDGKNVPV... 74
467 5.000e-15UniRef50_A0A221A9V6 Tyrosine--tRNA ligase n=21 Tax=Bacteria TaxID=2 RepID=A0A221A9V6_9BURK  ali  19  5..DFTLTGDYVELHNLLKITGLAESGGQAKMMVGDGAVTVDGRVETRKTCKIRAGQVVLFGDTRIAVHEA 72
468 5.000e-15UniRef50_A0A2H0U742 Uncharacterized protein n=1 Tax=Candidatus Kaiserbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_59_10 TaxID=1974612 RepID=A0A2H  ali  10  1..........MRIDNAVYRAGFVSTRRAARQAVSHGHICINGRRTTTPSAALSVGDALTVREGSRK.... 56
469 5.000e-15UniRef50_UPI0009BA0F23 30S ribosomal protein S4 n=6 Tax=Terrabacteria group TaxID=1783272 RepID=UPI0009BA0F23  ali  12  83.....IKTLETRLDNLTYRMGFASSIRQARQMVVHGHILVNGKRINIPSYLVDIGDEISLKDKSRNV... 144
470 6.000e-15UniRef50_I2EV38 Pseudouridine synthase n=4 Tax=Cytophagaceae TaxID=89373 RepID=I2EV38_EMTOG  ali  17  204......KDELIRLNRYISNAGIA-SRRDADELIASGQITVNGKVVSEMGYKVKPTDVVKY-GKKI..... 260
471 6.000e-15UniRef50_A0A174RW21 Pseudouridine synthase n=19 Tax=Bacteria TaxID=2 RepID=A0A174RW21_9FIRM  ali  18  258..........IRLNRFIANSGIC-SRREADDLITAGVVAVNGKIVTELGTKVNPEDEVRFNGEIVK.... 312
472 6.000e-15UniRef50_D4HYN0 Uncharacterized protein ybcJ n=386 Tax=Bacteria TaxID=2 RepID=D4HYN0_ERWAC  ali  25  1MATFSLGDHSVDLCDLLKLEGWVESGAMAKSFIADGYVTVNGEVETRKRCKIVAGQTVAFDGNSVTV... 68
473 6.000e-15UniRef50_I3YQ70 Pseudouridine synthase n=2 Tax=Rikenellaceae TaxID=171550 RepID=I3YQ70_ALIFI  ali  20  219..........MRLNRFLAQSGLC-SRREADDFITAGLVTVNGQIVTQLGTKVLPTDEVKFNDSRVQ.... 273
474 6.000e-15UniRef50_G4D1R2 S4 RNA-binding domain protein n=4 Tax=Tissierellia TaxID=1737404 RepID=G4D1R2_9FIRM  ali  38  1.....MESGYIKLDSFLKYKNLVGSGGEAKILIQEGLVKVNSEVETRRGRKLVKGDRVEFDSEEFIV... 62
475 6.000e-15UniRef50_UPI000255CF6D RNA-binding S4 domain-containing protein n=1 Tax=Nesterenkonia sp. F TaxID=795955 RepID=UPI000255CF6D  ali  42  56..QIPIRDESIRLGQLLKLADVVEHGGMAREVLDAGAVTVDDEVETRRGRQIRPGEIVQLDGE....... 116
476 6.000e-15UniRef50_A0A0X3YCS4 RNA-binding protein n=15 Tax=Bacteria TaxID=2 RepID=A0A0X3YCS4_9GAMM  ali  34  1MRDVILSKPAVELYKILKFEGLLSSGGEAKAAIDSGLVKVNGEVETRKRRQINAGDIIEIGGDK...... 64
477 6.000e-15UniRef50_A0A1X6PB91 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6PB91_PORUM  ali  37  313......DGEFIRLEAFLKAQSVAPTGGQAKLLIRSGGVAVNGLTEIRRGRKLRGGDVVEVEAEGVQMTVA 376
478 6.000e-15UniRef50_Q2S2G3 Pseudouridine synthase n=11 Tax=Bacteria TaxID=2 RepID=Q2S2G3_SALRD  ali  11  1MATESSDREGMRINKYIAHAGVC-SRRDADDLVEQGRVHIDGERVDQHGTCVREGQTVTVDGEEVYPLE. 68
479 7.000e-15UniRef50_A0A090VTZ0 Uncharacterized protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A090VTZ0_ESCVU  ali  22  1MATFSLKHPHVELCDLLKLEGWSESGAQAKNFIADGLVSVDGAVETRKRCKIVAGQTVTFNGQSITV... 68
480 7.000e-15UniRef50_A0A257NL77 Heat-shock protein n=1 Tax=Rhodospirillales bacterium 20-58-10 TaxID=1970564 RepID=A0A257NL77_9PROT  ali  24  11...........RLDKFLFFARFCKSRAVAGELIETGAVRINRQPTVKPHAKLRPNDVITLP......... 60
481 7.000e-15UniRef50_Q6KIT5 Expressed protein n=2 Tax=Mycoplasma TaxID=2093 RepID=Q6KIT5_MYCMO  ali  39  1MLKIEIKDDFITLSQFLKISSLISTGGESKNFIIENNVNLNGKRIFERNKKIYKNDIVEINNKKYQII.. 68
482 7.000e-15UniRef50_A0A1W6CYE7 Uncharacterized protein n=1 Tax=Paracoccus contaminans TaxID=1945662 RepID=A0A1W6CYE7_9RHOB  ali  17  17...VRPDAQTIRLDRWLCHARLFKTRTLAADRIASGGVRVNGVPCRKPAHALRVGDVVT........... 72
483 7.000e-15UniRef50_K9Y8Q8 RNA-binding S4 domain-containing protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=K9Y8Q8_HALP7  ali  43  2.......SETIKLDQFLKYQCVAQTGGEAKMMIWDEEVLVNDEIETRRGRKLVNGDRVTVFGETYVV... 61
484 7.000e-15UniRef50_A0A0K0Y3I8 Heat shock protein 15 n=44 Tax=Bacteria TaxID=2 RepID=A0A0K0Y3I8_9RHOB  ali  13  6........DSLRLDKWLWHARFFKSRGLAAALVKSGRIRVDGTPVSKPSRAISAGVVLTFPKEDEVRIV. 66
485 7.000e-15UniRef50_UPI00046E59AE rRNA pseudouridine synthase n=2 Tax=Porphyromonas gingivicanis TaxID=266762 RepID=UPI00046E59AE  ali  25  189......STEAIRLNKFLANSGIC-SRRKADELITEGKVSVNGVIVTTLGAHVTRQDEIKCDGKLVSI... 248
486 7.000e-15UniRef50_A0A2U1ANF0 Pseudouridine synthase n=1 Tax=Pontibacter virosus TaxID=1765052 RepID=A0A2U1ANF0_9BACT  ali  18  14........EPKRLNKFISDSGFC-SRRDADELIEQGRVTVNGKIPNDPGMKVTPKDKVRIDDEMLRV... 71
487 7.000e-15UniRef50_E2SHL8 S4 domain protein YaaA n=44 Tax=Firmicutes TaxID=1239 RepID=E2SHL8_9FIRM  ali  60  2..DIKITSEYITLGQLLKMTDFIQSGGEAKFAVKSLAIKVNQEQENRRGRKLYAGDVIEIEG........ 61
488 7.000e-15UniRef50_A0A246JPQ1 RNA-binding protein n=3 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A246JPQ1_9SPHN  ali  11  9.........SIRLDKLLWFLRFARSRSLAQAVVAAGHIRLDGRRVSRPSCAVHVGQTLVLPGERIEVVR. 69
489 8.000e-15UniRef50_C4FMI7 S4 domain protein n=41 Tax=root TaxID=1 RepID=C4FMI7_9FIRM  ali  35  1MKEVPIHTEYIQIDQLLKLEGIIETGGQIKSFIEEGILTLNGQVVTEKRKKCRVGDVISCKGLDVDLV.. 71
490 8.000e-15UniRef50_A0A2E3L3X6 RNA-binding protein S4 n=1 Tax=Magnetovibrio sp. TaxID=2024836 RepID=A0A2E3L3X6_9PROT  ali  23  4.KSVRPENEAQRLDLWLWFARFFKSRSLSTRFVQSGRLRVNNQVIKKAHHNLRVGDILTFPKAGRVQVV. 71
491 8.000e-15UniRef50_Q98PK6 30S ribosomal protein S4 n=122 Tax=root TaxID=1 RepID=RS4_MYCPU  ali  17  95...........RLDNLVYRAGFAETRRQARQFVNHGHVLVDGKKVDIPSYRVAVGKVIEIKEK....... 146
492 8.000e-15UniRef50_A0A269PK91 Uncharacterized protein n=3 Tax=Pseudoalteromonadaceae TaxID=267888 RepID=A0A269PK91_9GAMM  ali  27  11..EVELQEEPIELCNLLQILDLVDSGGQAKTMISEGYVGLNDEVCTQKRRKVFGGDILNFGGNLYQI... 75
493 8.000e-15UniRef50_A0A2V5JV28 30S ribosomal protein S4 n=4 Tax=unclassified Verrucomicrobia (miscellaneous) TaxID=417295 RepID=A0A2V5JV28_9BACT  ali  19  94...........RIDNVVYRLGLANTRSAARQLVSHGHVLVNGRTVNVASYNVKAGDEITIKDK....... 145
494 8.000e-15UniRef50_A0A0G1N4X4 30S ribosomal protein S4 n=36 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1N4X4_9BACT  ali  13  92...........RLDNTVYRLGLAKTRRFARQIVSHGHIFVNGKRLDIPSHKVRVGDVISVRE........ 142
495 8.000e-15UniRef50_A0A099KYM5 Uncharacterized protein n=2 Tax=Thalassotalea TaxID=1518149 RepID=A0A099KYM5_9GAMM  ali  32  8...IEFEQEPIELCKLLKVANLVGGGGEAKMVISEGYVYLNGEVEYQKRKKVYFEDIVQFNGEAVMPI.. 72
496 8.000e-15UniRef50_A0A1V5HFX7 Pseudouridine synthase n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5HFX7_9BACT  ali  24  135.......TAPIRLNKYLANAGVC-SRREADEFIQAGVVKVNGDVITELGTKITRADEVMFNDQPV..... 191
497 8.000e-15UniRef50_E8PPL3 Pseudouridine synthase n=20 Tax=Deinococci TaxID=188787 RepID=E8PPL3_THESS  ali  22  4.........PLRLQAFLARAG-VGSRRKAEELIRQGRVRVNGK-VAVLGQKVNPGDVVEVDGKPV..... 57
498 8.000e-15UniRef50_A0A2S6QJ99 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium MarineAlpha12_Bin1 TaxID=2013107 RepID=A0A2S6QJ99_9PROT  ali  22  1MKN---SVDTVRLDKWLWFARFCKTRTQANKFCREGNIRVNRELVAKPNHLLKPEDVLSFILKRILIIR. 67
499 9.000e-15UniRef50_UPI0009ECF339 hypothetical protein n=1 Tax=Croceicoccus mobilis TaxID=1703339 RepID=UPI0009ECF339  ali  14  259......RGESLRIDRLLWMLRLAKSRSAAQEIVGSGHIRRNGIRVTRMSQPVCAGDVLTVPGRAIRVIE. 322
500 9.000e-15UniRef50_A0A1V5F3Y3 Pseudouridine synthase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5F3Y3_9BACT  ali  23  149.........PIRLNKFLANAGIC-SRREADEFIQSGVISVNGEVVTQLGAKIMMTDTVMFKNQPVQ.... 204
501 9.000e-15UniRef50_A1K5P0 Uncharacterized protein n=16 Tax=Bacteria TaxID=2 RepID=A1K5P0_AZOSB  ali  24  5...FAVRGDYIQLDQLLKAANLVSSGGEAHAAVEAGAVKVDGRPESRKRAKLRPGQRVRFGAEEIVLV.. 69
502 9.000e-15UniRef50_UPI000D757BE6 RNA-binding S4 domain-containing protein n=1 Tax=Sphaerotilus hippei TaxID=744406 RepID=UPI000D757BE6  ali  26  4.TTFALHTDFLALDALLKATSVVHSGGAAKVLIQDGGVRVDGLVEQRRSCKIRPGQVVEALGQRIVVSR. 71
503 9.000e-15UniRef50_A0A151AZP3 Pseudouridine synthase n=3 Tax=Bacteria TaxID=2 RepID=A0A151AZP3_9THEO  ali  18  1..........MRLQKYLARAGVA-SRRHAEEMIRAGRVRVNGQIVTAMGLRIEPGDEVTVDGRPV..... 55
504 9.000e-15UniRef50_N1MW06 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) n=7 Tax=Sphingomonadales TaxID=204  ali  15  10......HGPTLRIDKYLWFVRLCPNRSSAQKLAEDGHIRVNGRRIERAHAAVRVGDLITFPGQGVRVVR. 73
505 9.000e-15UniRef50_V5WHR8 Pseudouridine synthase n=1 Tax=Salinispira pacifica TaxID=1307761 RepID=V5WHR8_9SPIO  ali  18  1MEQ----QEEPRLQVFLSRSGIA-SRRKSAELIEDGRVTVNGKVIREPGYRVQPADKVRFDGTSV..... 60
506 9.000e-15UniRef50_A0A0G0RZJ3 30S ribosomal protein S4 n=12 Tax=root TaxID=1 RepID=A0A0G0RZJ3_9BACT  ali  18  97...........RLDNVVYRLGFAKTRRQARQMISHGFFTVNDHLVNIPSYQVQIGDQIQIRDSK...... 149
507 9.000e-15UniRef50_M7XA50 Pseudouridine synthase n=2 Tax=Cyclobacteriaceae TaxID=563798 RepID=M7XA50_9BACT  ali  18  375......DDEVFRLNKYISNSGIC-SRREADELIKKGEVMVNGEVVTEMGHKVLRSDKVTFRGKLIR.... 433
508 9.000e-15UniRef50_K1Z0Y4 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1Z0Y4_9ZZZZ  ali  14  7...........RLDNVVYRAGLAASRRAARQMVTHGHITVNGKKLDIPSYRVRIGEVISI.......... 55
509 1.000e-14UniRef50_A0A257SXH3 30S ribosomal protein S4 n=9 Tax=Planctomycetes TaxID=203682 RepID=A0A257SXH3_9BACT  ali  12  122...........RLDNVVHRLGFGQSRAQARQLVAHGHITVNGQRVNIPSFLLKPGDVVR........... 169
510 1.000e-14UniRef50_A0A2T2YJF2 Pseudouridine synthase n=1 Tax=Adhaeribacter sp. HMF7605 TaxID=2072846 RepID=A0A2T2YJF2_9BACT  ali  16  357......TDNGIRLNRYIANAGVC-SRREADTLISSGEIKVNGEVVTEMGYMVKPEDTVQYGKKRLNR... 416
511 1.000e-14UniRef50_Q6AL69 Uncharacterized protein n=1 Tax=Desulfotalea psychrophila (strain LSv54 / DSM 12343) TaxID=177439 RepID=Q6AL69_DESPS  ali  37  6.TDVVVSELPIRLGQFLKLASAVQDGFEAKIHIQAGTVEVNGEVETRRGCQLAQDDLVSFDGQSYRLV.. 72
512 1.000e-14UniRef50_A0A1G6WHT9 Ribosome-associated heat shock protein Hsp15 n=1 Tax=Paracoccus isoporae TaxID=591205 RepID=A0A1G6WHT9_9RHOB  ali  19  2........ESLRLDKFLWAARFYKTRALAQQMIEGGKVRIDGDRV-KPARAVRPGQIIELRGRTRRRIE. 62
513 1.000e-14UniRef50_L7WA45 Ribosomal large subunit pseudouridine synthase F n=16 Tax=Flavobacteriia TaxID=117743 RepID=L7WA45_NONDD  ali  11  89...........RLNKYIANSGLC-SRRDADIYIKAGSVSVNGKPVTEMGYQVMPGDEVRFDDRPIQ.... 142
514 1.000e-14UniRef50_A0A1V6C1H3 Pseudouridine synthase n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6C1H3_9BACT  ali  23  125.KQPKVPGE-VRLNKFIANSGLC-SRREADTFISTGLVTVNGEIVDRLGVKVTPADDVRVNGQRIK.... 187
515 1.000e-14UniRef50_A0A2E9V5G5 RNA-binding protein n=2 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2E9V5G5_9RHOB  ali  18  1MKEL----EHCRIDKWLWACRFFKTRSISHKVVEHGKVRLNGRKLRKPSTLLRITDVITLRGDSVIVVR. 66
516 1.000e-14UniRef50_A0A0X8K368 Uncharacterized protein n=21 Tax=Actinomyces TaxID=1654 RepID=A0A0X8K368_9ACTO  ali  37  18.......SGSIRLGQFLKLAGLVEDGAQARIAIQSGDVTVNGVVETRRGHHLADGDVVVVD......... 71
517 1.000e-14UniRef50_C2CYC1 S4 domain protein YaaA n=30 Tax=Bacilli TaxID=91061 RepID=C2CYC1_LACBR  ali  52  7.KEIFIDRPYITLGQLLKEESIISSGGQAKWYLREHTVNINDEPDNRRGRKLYAGDNVEVPDVGLFFIRS 75
518 1.000e-14UniRef50_A0A2G4HYV9 Pseudouridine synthase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2G4HYV9_9FLAO  ali  13  413......KSDEIRLNRYIANSGIC-SRREADDLITQGLVKVNGDVVKELGTKIRPSDNVKVEDRKVI.... 471
519 1.000e-14UniRef50_A0A0G1R2T2 30S ribosomal protein S4 n=9 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1R2T2_9BACT  ali  12  83.RNPEVTGEKMRLDNAVYRLGFAPSRIVARQFVNHGHITVNGRKTASPSHKVKIGDVIALREQS...... 151
520 1.000e-14UniRef50_A0A0U5MY64 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit n=69 Tax=Bacteria TaxID=2 RepID=A0A0U5MY64_  ali  13  7...........RLDKWLFFCRFFKSRALAANVVESGGVRLNGQSVAKPAHAVKPGDRLSFPGPYTRTVE. 65
521 1.000e-14UniRef50_A0A265QDN6 30S ribosomal protein S4 n=2 Tax=Firmicutes TaxID=1239 RepID=A0A265QDN6_9FIRM  ali  12  89...........RLDNLVYRLGFASSIRQARQMVVHGHILVNGRKVDIPSYIVEIGDTIELKGKSKDI... 144
522 1.000e-14UniRef50_A9BFZ1 30S ribosomal protein S4 n=62 Tax=Bacteria TaxID=2 RepID=RS4_PETMO  ali  12  100...........RLDSVVYQMGFAPNRRTARQIVTHGHILVNGKKVNIPSYRVKVGDVIEVKEKSRNI... 155
523 1.000e-14UniRef50_Q9CE71 Uncharacterized protein n=49 Tax=Lactococcus TaxID=1357 RepID=Q9CE71_LACLA  ali  46  1MKKYILFEEYITLGQVLKELGLISTGGQAKIFLAEGNIFYNGEAENRRGKKLRDGDLLEFPTFDLKV... 69
524 1.000e-14UniRef50_A0A258HB04 30S ribosomal protein S4 n=3 Tax=Bacteria TaxID=2 RepID=A0A258HB04_9BACT  ali  10  94...........RLDNVVYRSGLATSRRAARQLVGHGHFELNGRRVDIPSIRVKAGDVITVRPKSVK.... 148
525 1.000e-14UniRef50_A0A2G6GR06 Uncharacterized protein n=1 Tax=Bacteroidia bacterium TaxID=2044936 RepID=A0A2G6GR06_9BACT  ali  22  7MKEPKQEYKPIRLNRYIANASAC-TRREADQLIKEGKIRVNGKIVTELGTKVKRSDTVEWNEKK...... 69
526 1.000e-14UniRef50_A0A2M8F5U5 30S ribosomal protein S4 n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_9_14_0_2_um_filter_53_11 TaxID=1974780 RepID=A0A2M8F  ali  94...........RLDNVIFRSGFASSRRQARQFVSHGLFSLNGQRVTVPSIQVKTGDSFTVREKNR..... 147
527 1.000e-14UniRef50_A0A1I6NVC1 S4 domain protein YaaA n=2 Tax=Halolactibacillus TaxID=306539 RepID=A0A1I6NVC1_9BACI  ali  55  4.EEIEIRTDYITLGQFLKLANVVESGGMVKLFLSESPVFVNETQDQRRGKKLYPGDSISIPEVGTYTV.. 70
528 1.000e-14UniRef50_A0A2E5RNG4 Pseudouridine synthase n=4 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E5RNG4_9FLAO  ali  21  49...........RLNKFIAHAGVC-SRREADELIQLGSITVNGKIITEMGYKVKNTDVVKHEGET...... 100
529 1.000e-14UniRef50_A0A1U7L8U2 RNA-binding protein n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A1U7L8U2_9BACT  ali  33  1MITFEIDTEYIELIKLLKATRIADSGAMAKILVENGEVTRNGEPEFRKRAKITKGEIITALGQSVQVV.. 68
530 1.000e-14UniRef50_A0A2E4F5U5 RNA-binding protein S4 n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E4F5U5_9PROT  ali  15  10......NNSSIRLDKWLWYARFLKSRTLASHLCVAGRVRINRKRIDKAHSPIKIGDILTFPQKRIRVVR. 73
531 1.000e-14UniRef50_A0A1J5HAA7 RNA-binding protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A1J5HAA7_9CYAN  ali  31  7.EKFQLASEYITLGNLLKICGVADTGGVAKLMIIDGEIEVDGRIETRRGCKIRVGQRVSGYGFIIDVIEA 75
532 1.000e-14UniRef50_A0A2N2DZ37 S4 domain-containing protein YaaA n=3 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DZ37_9FIRM  ali  46  2...VKIDTEFITLGQLLKMTNVISSGAEAKTAVKEMKIFVNGQKEDRRGRKLYPGDIVNV-EKKVFKVE. 66
533 1.000e-14UniRef50_F9R6R9 Uncharacterized protein n=36 Tax=Vibrio TaxID=662 RepID=F9R6R9_VIBSN  ali  34  26.....VSSHPIELYKVFKIANLVGGGGEAKHLISEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVV.. 88
534 1.000e-14UniRef50_A0A0G1QDJ5 30S ribosomal protein S4 n=2 Tax=Candidatus Berkelbacteria TaxID=1618330 RepID=A0A0G1QDJ5_9BACT  ali  16  62...........RLDNVLYRSGLAISRPQARQLISHRHFSVNGHRVNIPSILVRPGDIIS........... 109
535 1.000e-14UniRef50_A0A0P7YCI0 Ribosome-associated heat shock protein Hsp15 n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0P7YCI0_9RHOB  ali  17  4.......DARIRLDKWLFFARFFKTRSLAARQVGAGHVRVNSDKVLKPAHAVGPGDVLTFQGRVIRVVR. 66
536 1.000e-14UniRef50_A0A068NK27 S4 domain protein YaaA n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NK27_9BACT  ali  43  9.REIRITTEFITLGQLIKLLDLVNSGAEVKALLATARFAVNDEPDDRRGRKIYPGDIVTLPNQTRVKV.. 75
537 1.000e-14UniRef50_A0A2E6G6Q0 Pseudouridine synthase n=2 Tax=unclassified Crocinitomicaceae TaxID=1986672 RepID=A0A2E6G6Q0_9FLAO  ali  17  88.......DAPLRLNKFIANSGVCV-RREADILITAGAVTVNGNVVTELGTKVQPTDKVVVEGQRIK.... 145
538 1.000e-14UniRef50_UPI000D3E0380 RNA-binding S4 domain-containing protein n=1 Tax=Methyloceanibacter sp. wino2 TaxID=2170729 RepID=UPI000D3E0380  ali  22  45...........RLDKWLWCARAVKTRSAATRLIADGKVRINGERVRKPSRIVQLGDVITATPPGRLVV.. 101
539 1.000e-14UniRef50_A0A2E6W5S1 30S ribosomal protein S4 n=2 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E6W5S1_9GAMM  ali  18  103...........RLDNLVYRAGFAATRAQARQMVSHGHVVVNEKRLNIPSYKCRIGDVVQIKEQS...... 155
540 1.000e-14UniRef50_Q6AQ24 Related to ribosomal large subunit pseudouridine synthase B n=1 Tax=Desulfotalea psychrophila (strain LSv54 / DSM 12343) TaxID=177439  ali  19  99.........PVRLQKFLAASGIC-SRRKAEQLILDGRVTLNGETVLILGTKITPDDKITVDGKLVK.... 155
541 1.000e-14UniRef50_A0A1F3JMI1 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F3JMI1_9BACT  ali  27  1MIKFNLNGEYIELNKLLKVLQLVESGGVANTLITEGEVKLNGKIETQKRKKLVIGDKIIFFEKTIVIVE. 70
542 1.000e-14UniRef50_A0A286ILA8 Pseudouridine synthase n=5 Tax=Cytophagales TaxID=768507 RepID=A0A286ILA8_9BACT  ali  15  217......KDEAIRLNRYIANAGLC-SRREADELISAGVIKVNGKVVDEMGFMVQPGDTVKY-GKDI..... 273
543 1.000e-14UniRef50_A0A1G9EMD1 S4 domain protein YaaA n=2 Tax=Salinicoccus TaxID=45669 RepID=A0A1G9EMD1_9STAP  ali  48  1MET-KIFGDIITLGQFLKLEGIIGSGGQAKWFLSENVVYINDEVEDRRGKKLQHGDVIKSDEFGQYKIE. 68
544 1.000e-14UniRef50_UPI000248E6EC rRNA pseudouridine synthase n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000248E6EC  ali  17  39.KQAAQSPDTMRLNKYIGNSGIC-TRKDADLYISTGSVKVNGVVVTEMGYKVKLTDEVRFDGQLIRPVKN 106
545 1.000e-14UniRef50_A0A1G1MYX8 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium GWF2_43_52 TaxID=1801847 RepID=A0A1G1MYX8_9BACT  ali  24  2..DFQLKAEFVELDNMLKALHLVASGAHARQCIQSGSIKINGHVETRVRRKLRAGDSVEFGQEQISIV.. 67
546 1.000e-14UniRef50_A0A1E2RVB7 Heat shock protein 15 n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1E2RVB7_9RHIZ  ali  14  15......HVDGQRLDKWIWCARLVKTRTLATSLVEAGKIRINGERVRKASRRVRPGDVLTAHGGRLWVVR. 78
547 1.000e-14UniRef50_A0A2I0FFX0 Uncharacterized protein n=1 Tax=Moritella sp. Urea-trap-13 TaxID=2058327 RepID=A0A2I0FFX0_9GAMM  ali  31  12...VVVSAEPIELYKILKIENLVTSGSEAKNHIANGFVYVNGEVETRKRKKIMFGDIIGFDGEAYQV... 75
548 1.000e-14UniRef50_A0A1M5AMD0 Pseudouridine synthase n=6 Tax=Bacteria TaxID=2 RepID=A0A1M5AMD0_9BACT  ali  19  26......EEEKIRLNKYIAHCGFC-SRRKADDYIAAGKVEVNDEVVTQMGVKVQRTDKVVVEGQQ...... 82
549 1.000e-14UniRef50_A0A257Q6W3 Heat-shock protein n=1 Tax=Acidocella sp. 20-57-95 TaxID=1970301 RepID=A0A257Q6W3_9PROT  ali  23  1MPE-EEDKAWQRLDKFLFFARFCKTRAVAGQLIETGAVRINRQPTIKPHAKLRPNDVITLP......... 60
550 1.000e-14UniRef50_UPI00096B6C81 RNA-binding S4 domain-containing protein n=1 Tax=Nitratireductor basaltis TaxID=472175 RepID=UPI00096B6C81  ali  16  14..........IRLDKWLWHARQAKSRSLAQKLIQSGRVRINGQRIANNAFPVGPGDTVTL.......... 63
551 1.000e-14UniRef50_D1C704 30S ribosomal protein S4 n=6 Tax=Bacteria TaxID=2 RepID=D1C704_SPHTD  ali  12  95...........RLDNVVYRLGFTPTRPMARQLVNHGHVLVNGRRVDIPSYRVSPGDTIALTEKAAEI... 150
552 2.000e-14UniRef50_R5G392 S4 domain protein YaaA n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R5G392_9FIRM  ali  47  2IKNITIKTEYIKLGQLLKLVGIIANGSEAKSFLEEEKVYVNGEEESRRGRKIYPGYHIRFKEIEVIV... 68
553 2.000e-14UniRef50_A0A1G8K768 S4 domain protein YaaA n=10 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G8K768_9LACT  ali  50  1MEEVYLEEEFITLGQILKRESFIPSGGLAKWYLSEHTVYLNDELENRRGKKLYPGDQLKL.......... 62
554 2.000e-14UniRef50_A0A1M5XGA0 Pseudouridine synthase n=1 Tax=Chryseolinea serpens TaxID=947013 RepID=A0A1M5XGA0_9BACT  ali  17  326..EAPAQTGKIRLNKFIANSGVC-SRREADELITMGLISVNGKTITELGYKVNPGDEVR........... 381
555 2.000e-14UniRef50_C0DU58 S4 domain protein n=12 Tax=Eikenella TaxID=538 RepID=C0DU58_EIKCO  ali  19  8......DEHHMRLDKWLWAARFFKTRGMAQKHIELGRVLVNGAKV-KNSKNIEPGDTI............ 58
556 2.000e-14UniRef50_A0A2S2DZM2 Pseudouridine synthase n=2 Tax=Cytophagaceae TaxID=89373 RepID=A0A2S2DZM2_9BACT  ali  16  418......KNDSIRLNRFIANAGIC-SRRDADKLIEAGEIKVNNKVITEMGYQVQPTDIVKYGNRKLNR... 477
557 2.000e-14UniRef50_A0A2L2XAG4 Pseudouridine synthase n=23 Tax=root TaxID=1 RepID=A0A2L2XAG4_9BACT  ali  15  1..........MRLNKYIAMCG-CASRRGADELIEAGRVKVNGETVTLLGFEVRVRDKVSVDGK....... 52
558 2.000e-14UniRef50_A0A257GDY5 RNA-binding protein n=1 Tax=Novosphingobium sp. PASSN1 TaxID=2015561 RepID=A0A257GDY5_9SPHN  ali  4.......EDSLRIDKLLWFLRFAASRSLAQDWVAAGHIRLNGRRIERASALVRCGDVLVLPLRSGVKVIA 66
559 2.000e-14UniRef50_A0A1G5Z280 Pseudouridine synthase n=3 Tax=Algoriphagus TaxID=246875 RepID=A0A1G5Z280_9BACT  ali  15  319....KEETDSFRLNKYISNSGICG-RREADDLIAKGLITVNGQVITEMGYKVKKSDRVIYQGKKI..... 378
560 2.000e-14UniRef50_A0A136PGE6 Pseudouridine synthase (Fragment) n=2 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A136PGE6_9BACT  ali  17  82.KTSSAKNEGVRLNKVIADSG-AASRRAADEMIREGRVKINGSVVTELGTRVKGNDKVTIDNKLI..... 144
561 2.000e-14UniRef50_L8D487 Uncharacterized protein n=1 Tax=Pseudoalteromonas luteoviolacea B = ATCC 29581 TaxID=1268239 RepID=L8D487_9GAMM  ali  33  14.............CNLLKLIGLADTGGQAKLFISEGYVHLNGELCTQKRKKIYAGDQFSFNGDEFIVSRA 70
562 2.000e-14UniRef50_F2I5D0 S4 domain protein YaaA n=11 Tax=Aerococcus TaxID=1375 RepID=F2I5D0_AERUA  ali  43  7...VAIDTEYITLGQLLKALGYIQTGGQAKIYLANYPVILDGQEEQRRGKKLYPGSVVEFPHEGIYAIRG 74
563 2.000e-14UniRef50_M4QAR3 Ribosomal protein S4 n=1 Tax=Seculamonas ecuadoriensis TaxID=221724 RepID=M4QAR3_SECEC  ali  15  133...........RLDSVLYRAQFAKSMYQARQLINHGHILVNGKVLNISSYTVKNGDLIQVNPKSYDFV.. 189
564 2.000e-14UniRef50_A0A127B4W1 Pseudouridine synthase n=12 Tax=Bacteria TaxID=2 RepID=A0A127B4W1_9BACT  ali  13  3......KDEQVRLNKYISDSGFC-SRREADRYIEEGRVTINDRIP-KMGASVKPGDVVAVDGETIK.... 60
565 2.000e-14UniRef50_A0A0D3V6D4 30S ribosomal protein S4 n=8 Tax=Bacteria TaxID=2 RepID=A0A0D3V6D4_9BACL  ali  11  92...........RLDNLVYRLGFANSRAGARQLVSHGHITVNGKKVDIASYMLNTGDVISLRERSR..... 145
566 2.000e-14UniRef50_V7PYR4 30S ribosomal protein S4 n=49 Tax=unclassified Bacteria TaxID=2323 RepID=V7PYR4_9BACT  ali  11  95...........RLDNIVYRLGIASTRRLARQLVSHGHILVNNKKITVPSMHVRIGDTISVRPQS...... 147
567 2.000e-14UniRef50_A0A2H6AUT4 30S ribosomal protein S4 n=9 Tax=Bacteria TaxID=2 RepID=A0A2H6AUT4_9BACT  ali  23  31...........RLDTVVYRANFVPTMFAARQLVNHGHVLVNGKRVNIPSYLVNEGDVIEIREKSRLVVES 92
568 2.000e-14UniRef50_UPI000A015AE5 RNA-binding S4 domain-containing protein n=1 Tax=Acholeplasma equifetale TaxID=264634 RepID=UPI000A015AE5  ali  33  1MNEFEIRGEYITITQLLKVLGYSLSGGEAKFFLLDKNVSINGHFIQERRKKIYKGDIVTIEGNRYKMI.. 68
569 2.000e-14UniRef50_A0A2P6L914 HslO n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6L914_NEPCL  ali  17  15..........IRLDKWLWACRFYKTRGLAKDMIEGGKVHYNGQRC-KPSKVVEPGATIRLADEKVVVV.. 74
570 2.000e-14UniRef50_G8TRT1 Pseudouridine synthase n=16 Tax=Bacteroidetes TaxID=976 RepID=G8TRT1_NIAKG  ali  18  218......EGASMPLNKFIAHSGIC-SRRDAADLVKSGKVIVNGAKVTEPGHKVSDKDDIKVNGKKLFI... 277
571 2.000e-14UniRef50_UPI0009848276 rRNA pseudouridine synthase n=1 Tax=Mobilibacterium timonense TaxID=1871012 RepID=UPI0009848276  ali  12  1..........MRINKYIGASGIC-SRRRADQLIDEGKVKVNGQVLMEKGYDVRPGDEVQVDGTLIR.... 55
572 2.000e-14UniRef50_D5RU85 S4 domain protein n=9 Tax=Rhodospirillales TaxID=204441 RepID=D5RU85_9PROT  ali  19  1MPETE-DRDWQRLDKWLWCARVAKTRGECARLVERGRFRLNRQPVEKPHAKLRPGDVLTLAEQGRIRV.. 71
573 2.000e-14UniRef50_A0A1B2N2Q8 RNA-binding protein n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1B2N2Q8_9GAMM  ali  26  5..EFELDSEYVELKQLLKLADLVTSGGEAKTVIGDGQVLVDGEVELRKACKIRGGQQVQFGDTVINVIAD 72
574 2.000e-14UniRef50_A0A0G1T0V9 30S ribosomal protein S4 n=21 Tax=root TaxID=1 RepID=A0A0G1T0V9_9BACT  ali  12  97...........RLDNIVYRLGMAKTRAAARQLVNHGHILVNGKKVDIPSYQVRAGEVVSV.......... 145
575 2.000e-14UniRef50_UPI000C1B5BC1 RNA-binding S4 domain-containing protein n=2 Tax=Ezakiella TaxID=1582879 RepID=UPI000C1B5BC1  ali  35  4..EVRVDTE---LKNALKLASLVDSGGVSKHLIKDGQVKVNGQVETRPSHKLSDGDVIEFNGQEVTI... 65
576 2.000e-14UniRef50_UPI000A16D893 RNA-binding S4 domain-containing protein n=2 Tax=Colwelliaceae TaxID=267889 RepID=UPI000A16D893  ali  37  8...IDISVQPIELCKLLKIANMVGGGGEAKIVISEGYVLVNNEVEFQKRKKVYQDDIIEFNGEIVQV... 71
577 2.000e-14UniRef50_A0A0X3QKX4 RNA-binding protein n=9 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0X3QKX4_9MICC  ali  34  9.EELPIRDEMIRLGQALKLGSLVEDGAMARTAVEEGMVQVNHDIETRRGRQLHDGDVITYNGTSLVI... 74
578 2.000e-14UniRef50_A0A2M7G6W5 30S ribosomal protein S4 n=1 Tax=bacterium (Candidatus Blackallbacteria) CG17_big_fil_post_rev_8_21_14_2_50_48_46 TaxID=2014261 R  ali  22  99...........RLDNVVYRMKFATTRAQARQFVSHGHILVNGKRVNVASYKVRANDKIEVLEASKNFVRN 157
579 2.000e-14UniRef50_A0A1J4TMJ5 Pseudouridine synthase n=4 Tax=Flavobacteriales TaxID=200644 RepID=A0A1J4TMJ5_9FLAO  ali  13  131....EQSVDGIRLNRYISNSGIC-SRREADVYIKAGNVKINDKIVTEMGYKVQVTDVVKFDDAVI..... 190
580 2.000e-14UniRef50_A0A142L7M9 Pseudouridine synthase n=1 Tax=Bacteroidetes bacterium UKL13-3 TaxID=1690483 RepID=A0A142L7M9_9BACT  ali  19  273.KDDKPQSGNIRLNRYIANAGVC-SRREADDLILAGVVTVNGKAVEEMGYQVKPSDEVRYNGQ....... 333
581 2.000e-14UniRef50_C7REZ7 S4 domain-containing protein n=22 Tax=Terrabacteria group TaxID=1783272 RepID=C7REZ7_ANAPD  ali  30  1MEKIEFESEEIKLKDLLKATNIIPTGGLAKVIIKEEGVLLNGSPCFVAGKKLHKGDTVEFDDFSITIV.. 68
582 2.000e-14UniRef50_Q9JXZ3 Uncharacterized protein n=24 Tax=Neisseria TaxID=482 RepID=Q9JXZ3_NEIMB  ali  32  47METVYLEDEYIALCDLLKLVGLAESGGQAKAFIAEGLVLRNGETETRKTAKIRGGEVIEFDGARLEI... 115
583 2.000e-14UniRef50_A0A2N2Z207 Pseudouridine synthase (Fragment) n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2N2Z207_9BACT  ali  15  142......KDGTIRLNKFIANSGIC-SRREADHLIESGAVSINGKVVTELGTKITRDDKVQFGGETLNI... 201
584 2.000e-14UniRef50_A0A172UAJ4 Heat shock protein 15 n=23 Tax=Proteobacteria TaxID=1224 RepID=A0A172UAJ4_9GAMM  ali  20  7..........IRIDKWLWAARFFKTRGLAADAVNGGKVHVNGQRC-KPGKDVKIGDLVTV.......... 55
585 2.000e-14UniRef50_A0A0G0JYH7 30S ribosomal protein S4 n=12 Tax=Candidatus Shapirobacteria TaxID=1752721 RepID=A0A0G0JYH7_9BACT  ali  23  102...........RLDSVLYTSGLADSRSQSKQFISHGHVLVNGSPLSISSYALKINDEITLDKSTIDQIKD 160
586 2.000e-14UniRef50_Q47Z52 Uncharacterized protein n=11 Tax=Colwellia TaxID=28228 RepID=Q47Z52_COLP3  ali  30  8...IELNHQPVELCKLLKIANLVSGGGEAKVVISEGYVLLNGEVEYQKRKKVYHEDVIEFNGEVVQ.... 70
587 2.000e-14UniRef50_E0S2D2 S4 domain protein YaaA n=55 Tax=Terrabacteria group TaxID=1783272 RepID=E0S2D2_BUTPB  ali  41  1METIRLRDDFIKLGQALKKAGLEGSGVDAKNDIQAGLVKVNGEVEERRGRKLYDGDIFEYDGTQVKI... 69
588 2.000e-14UniRef50_A0A1Y2K3D3 30S ribosomal protein S4 n=4 Tax=Bacteria TaxID=2 RepID=A0A1Y2K3D3_9PROT  ali  10  45...........RLDNVVYRMGIAASRTEARQVVGHKHVSVNGKPVNIPSYLVKPGDVVAVRDKEHLRIKG 105
589 2.000e-14UniRef50_A0A0G1QZ07 30S ribosomal protein S4 n=1 Tax=Parcubacteria group bacterium GW2011_GWC2_45_7 TaxID=1618932 RepID=A0A0G1QZ07_9BACT  ali  14  60...........RLDNAVYRLGLARSRGEAREYVSHGHFLVNGKRANVPSLQVQSGDTIEVRPKSR..... 113
590 2.000e-14UniRef50_A0A1G8UXV7 Ribosome-associated protein n=4 Tax=Ferrimonas TaxID=44011 RepID=A0A1G8UXV7_9GAMM  ali  27  12........DFIELYKVLKIQAWVGSGSDAKLVIGEGLVEVNGQVETRKRCKLVQGDVVAFNGEQVTI... 70
591 2.000e-14UniRef50_A0A0G0JQ91 30S ribosomal protein S4 n=2 Tax=Candidatus Falkowbacteria TaxID=1752728 RepID=A0A0G0JQ91_9BACT  ali  94.....LQSLEMRLDNVVYRAGFASSRSEARQLVSHGHFTINDKNVKIPSFVVRPGDTLKVK......... 149
592 2.000e-14UniRef50_A0A0J8AMA9 RNA-binding protein n=5 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A0J8AMA9_9SPHN  ali  12  6......HGPSLRIDKYLWFVRLCSSRSNAQKLAETGHIRLNGRRIERAHAPVRTGDLITFPGDAVRVVR. 69
593 2.000e-14UniRef50_A0A0Q1A0X0 tRNA synthetase RNA-binding protein n=26 Tax=Bacteria TaxID=2 RepID=A0A0Q1A0X0_9RHOB  ali  12  6........PTIRLDKWLWHARFFKSRSLAAGVVTSGKVRVDSQPVSKPARAIGPGNVLTFQETKVVRVVA 70
594 2.000e-14UniRef50_A0A0G1QZP6 30S ribosomal protein S4 n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A0G1QZP6_9BACT  ali  17  94..........MRLDNVFYRAGFAKTRRMGRQAVSHAHVTVNGRKVDVPSFQVRANDVIGVREKSKK.... 149
595 2.000e-14UniRef50_A0A0G1TIC4 30S ribosomal protein S4 n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1TIC4_9BACT  ali  13  76...........RLDNVVYRLGFASTRSQARQVVNHGHIFVNGRRINIPAHRVQPGDVVMIRTQS...... 128
596 3.000e-14UniRef50_A0A212TZ60 Ribosome-associated protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A212TZ60_9MICO  ali  35  15..EVSITDEFITLGQLLKLANVVDDGAIAREVIQAGDVELDGEVCTQRGRKVRPGQVVGTP-VGRIVVRA 81
597 3.000e-14UniRef50_A0A1E8CNT0 RNA-binding protein n=2 Tax=Pseudohongiella acticola TaxID=1524254 RepID=A0A1E8CNT0_9GAMM  ali  24  15..DVEVNVIPVELYKVLKFEGLVGSGAEAKSVVADGMVLVNGAVETQKRKKIMADDVIEFAGQRLRIV.. 80
598 3.000e-14UniRef50_A0A2E1I2S7 Pseudouridylate synthase n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E1I2S7_9FLAO  ali  24  7..........IRLNKFIANSGICN-RREADNYISDGRVTVNNKIINKLGSKVSLKDSIRFDGREVFPVK. 64
599 3.000e-14UniRef50_A0A1F3KFY1 Pseudouridine synthase n=1 Tax=Bacteroidetes bacterium GWF2_43_11 TaxID=1797352 RepID=A0A1F3KFY1_9BACT  ali  15  232....QIEGE-IRLNKYISYAGIC-SRREADKLIEAGAVKINGVIVTTLGSRVQPGDRVQYGDET...... 289
600 3.000e-14UniRef50_A0A238WSI8 Pseudouridine synthase n=2 Tax=Hymenobacter TaxID=89966 RepID=A0A238WSI8_9BACT  ali  17  356.......GDLTRLNRYIANAGIC-SRREADALIAAGEIRVNGEVVTEMGYKVQPTDTVQY.......... 407
601 3.000e-14UniRef50_A0A0C1XNP8 Pseudouridine synthase n=1 Tax=Hassallia byssoidea VB512170 TaxID=1304833 RepID=A0A0C1XNP8_9CYAN  ali  17  214.......SDKIRLNRYISNSGVC-SRREADELIKMGLVTVNGTVVTEMGHKVSRKDVVKYDGKTLR.... 271
602 3.000e-14UniRef50_A0A2E5WIQ0 Pseudouridine synthase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E5WIQ0_9BACT  ali  27  1MKE-KSSSNTIRLNKFISNAGFY-SRREADKLITRGRVTVNGSLCTKLGIKINLNDSVKVDGK....... 61
603 3.000e-14UniRef50_X8CBH8 30S ribosomal protein S4 n=7 Tax=Bacteria TaxID=2 RepID=X8CBH8_MYCXE  ali  17  92...........RLDNVVYRAGLARTRRHARQLVSHGHFLVNGVKVNIPSYRVSQYDIIDVREKSLNTV.. 148
604 3.000e-14UniRef50_A0A2L2X8L0 Uncharacterized protein n=1 Tax=Desulfocucumis palustris TaxID=1898651 RepID=A0A2L2X8L0_9FIRM  ali  32  1MRQVSVRG-PLRLDQFLKWSNAAGTGGQGKMLVQSGMVSVNGNIVYNRGRSIVPGDVVDVEGIGSYKVV. 68
605 3.000e-14UniRef50_Q67JX0 30S ribosomal protein S4 A n=46 Tax=Bacteria TaxID=2 RepID=RS4A_SYMTH  ali  11  90..EVLLQTLERRLDNVVYRMGFAASRAEARQIVKHSHIEVNGRKVNIPSYLVREGDVVAVRESSR..... 152
606 3.000e-14UniRef50_UPI0009F6D451 hypothetical protein n=1 Tax=Methylomonas sp. LWB TaxID=1905845 RepID=UPI0009F6D451  ali  20  86......EQDELRIDKWLWAARFFKTRGLASDAVSGGKVHVNGQRC-KPSRDVRLGDRISI.......... 138
607 3.000e-14UniRef50_A0A1N6NPG8 Ribosome-associated protein n=11 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1N6NPG8_9SPHI  ali  29  1MTEFKLIGDHIPMIQLLKAAHLVSTGGEAQIVVSEGEVKYNGEVDYRKRLKVKRGDTVEFRGNKILVI.. 68
608 3.000e-14UniRef50_Q7UXM6 30S ribosomal protein S4 n=12 Tax=Rhodopirellula TaxID=265488 RepID=RS4_RHOBA  ali  20  94...........RLDNVVRRVGFTKTRPQARQGITHGHFRVNGVKVTKPGYMLRAGDLIEVRGRE...... 146
609 3.000e-14UniRef50_A0A1M3KYP9 30S ribosomal protein S4 n=1 Tax=`Candidatus Kapabacteria` thiocyanatum TaxID=1895771 RepID=A0A1M3KYP9_9BACT  ali  14  94...........RLDSLVFRSGFARSMYAARQYVRHGHVLVNGKKVDMPAYAVQPNDVISVKEKSRK.... 148
610 3.000e-14UniRef50_W4HKS2 Heat shock protein n=5 Tax=Rhodobacteraceae TaxID=31989 RepID=W4HKS2_9RHOB  ali  14  10.....LPGGKLRVDKWLWQARFFKTRSLAAKVVSGGHVRLNGARIAKPAVAVGAGDVLTFPQARDVRVV. 73
611 3.000e-14UniRef50_A0A212RTL0 Heat shock protein Hsp15 n=1 Tax=Arboriscoccus pini TaxID=1963835 RepID=A0A212RTL0_9PROT  ali  17  1.....MNASELRLDKWLWHARFARSRDKAAALIQERKVRINGQLATKLHHRLRLGDVVVLNDPSAIRV.. 63
612 3.000e-14UniRef50_C6XTU3 RNA-binding S4 domain protein n=67 Tax=cellular organisms TaxID=131567 RepID=C6XTU3_PEDHD  ali  25  1MIKFKLEGEFIPLIQLLKATALVQSGGEAQTVVEDGLVKYNGTVDYRKRLKVRVGDVIDFMGQKITVI.. 68
613 3.000e-14UniRef50_H6L9P7 Pseudouridine synthase n=6 Tax=Bacteroidetes TaxID=976 RepID=H6L9P7_SAPGL  ali  15  35..........MRLNKYLAHSG-VSSRRKADEIIKEGRVTVNGQVVLEMGHRVEPEDEVKLDGKVITPIK. 93
614 3.000e-14UniRef50_A0A0D8D0Z3 Uncharacterized protein n=7 Tax=Colwelliaceae TaxID=267889 RepID=A0A0D8D0Z3_9GAMM  ali  31  10...VEITEQPIALCQLLKIANMVGGGGEAKIVISEGYVLLNNEVEYQKRKKVFDGDIVEFNGDAIQI... 73
615 3.000e-14UniRef50_L0RW02 Conserved domain protein n=6 Tax=Mycoplasma TaxID=2093 RepID=L0RW02_MYCC1  ali  33  3...IKIKSEFIKISQLLKFSKIINTGGEIKKFLEDNHVTLNGKKITSRSSKVRPGDIVWINENSVLNIE. 68
616 3.000e-14UniRef50_A0A2R8A453 S4 domain protein YaaA n=27 Tax=Firmicutes TaxID=1239 RepID=A0A2R8A453_CARDV  ali  52  22...VLIDSEFITLGKLLKHIDVISSGGMAKWYLAEHTVLLDNEIENRRGKKIYPGSVVEIPEVGSFFVQS 88
617 3.000e-14UniRef50_A0A2N1BY87 Uncharacterized protein n=7 Tax=Colwellia TaxID=28228 RepID=A0A2N1BY87_9GAMM  ali  27  8...IELNHQPVELCKLLKIANFVSGGGEAKVVISEGYVLLNGEVEYQKRKKVYHEDVVEFNGEVLQLI.. 72
618 3.000e-14UniRef50_A0A1Y1RPF9 16S/23S rRNA (Cytidine-2`-O)-methyltransferase n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y1RPF9_9MICC  ali  13  1..........MRLDLYMVQAGIARSRTLAAKMIEGGHISVNGQVVAKPAQKLREGDTVRVR......... 51
619 3.000e-14UniRef50_A0A2W4Q106 RNA-binding protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4Q106_9ACTN  ali  34  6.ETYRLRTDYIPLCDLLKVCGVTDTGGEAGLLIASGEVYVDGEVEQRKRRKVRAGQVVTGEGFEIRVV.. 72
620 3.000e-14UniRef50_A0A2E2URV4 Pseudouridine synthase n=2 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2URV4_9FLAO  ali  15  33.KSVETEKQGVRLNQFIAHSGI-SSRREADKLIKAGLVKVNGKIIVEMGFRVLPKDIVKFNNETI..... 95
621 3.000e-14UniRef50_A0A2A2RLY9 Uncharacterized protein n=5 Tax=Opitutae TaxID=414999 RepID=A0A2A2RLY9_9BACT  ali  24  17.RNIAVRAVPIELCQFIKFGGLTESGGEAKQLISEGLVLLNGVVETQKRKQLVVGDKVKANGHVIIV... 82
622 3.000e-14UniRef50_A0A1I0V7F1 Pseudouridine synthase n=6 Tax=Algoriphagus TaxID=246875 RepID=A0A1I0V7F1_9BACT  ali  14  204.KKAKLTNDELRLNKYIANSGIC-SRREADSLISQGLVTVNGLVCTEMGKQVKRTDRVVYQGRKI..... 268
623 3.000e-14UniRef50_A0A1Y0H564 Pseudouridine synthase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0H564_9BACT  ali  21  3....EEQSEKVRLHRFLAQCGIA-SRRKAEELIAQGKVSVNGEIVIEQGVKVGPGDRVEFDGNPIR.... 63
624 3.000e-14UniRef50_A0A258L662 Pseudouridine synthase n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A258L662_9RHIZ  ali  14  113.......TEPMRIAKAMARAGLC-SRREAERWIEDGRVAVNGKILTTPACEVGPGDKVVVDGR....... 167
625 3.000e-14UniRef50_Q6N9G0 30S ribosomal protein S4 n=618 Tax=root TaxID=1 RepID=RS4_RHOPA  ali  22  95...........RLDAVVYRAKFVSTMFAARQFINHGHIKVNGKRVNIPSYKVRVGDVIEVKEAS...... 147
626 3.000e-14UniRef50_P21466 30S ribosomal protein S4 n=4575 Tax=root TaxID=1 RepID=RS4_BACSU  ali  93...........RLDNVVYKLGLARTRRQARQLVNHGHILVDGSRVDIPSYLVKPGQTIGVREKSR..... 146
627 3.000e-14UniRef50_V6F4E0 Ribosome-associated heat shock protein Hsp15 n=17 Tax=Alphaproteobacteria TaxID=28211 RepID=V6F4E0_9PROT  ali  16  1..........MRIDKWLFFTRLLKTRSQAAALVEAGEVRLNGALIDKPAQPVKVGDELIFPGKRLRRVV. 60
628 4.000e-14UniRef50_I1C5J1 Uncharacterized protein n=13 Tax=Fungi incertae sedis TaxID=112252 RepID=I1C5J1_RHIO9  ali  13  61...........RLDFVVFRSNFCSSVYAARQLCVHGKVLVNGKKMAFPSHKLKDGDVVTVDPQAIQFLKG 119
629 4.000e-14UniRef50_P59129 30S ribosomal protein S4 n=9 Tax=root TaxID=1 RepID=RS4_CHLTE  ali  12  94...........RLDNVVYRCGFSPSRAGARQLVTHGHMLVNGKKVNIPSFLVSPGDQIEFRQKSR..... 147
630 4.000e-14UniRef50_C9M7W9 30S ribosomal protein S4 n=15 Tax=Bacteria TaxID=2 RepID=C9M7W9_9BACT  ali  15  99...........RLDNVVYRLGFCTTRPQARQLVCHGHFAVNGRKVDIPSARVSAGDVISIRENS...... 151
631 4.000e-14UniRef50_A0A2E4T255 Pseudouridine synthase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E4T255_9FLAO  ali  19  34.KXLKSENYGMRLNQFIAHSGI-SSRREADKLIKAGLVKVNGKIIVEMGFKVLPKDIVKFNXEII..... 96
632 4.000e-14UniRef50_A0A2S6DJ38 30S ribosomal protein S4 (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2S6DJ38_STAAU  ali  77...........RLDAVVYQLGLARTRRQARQLVNHGHIMVDGARVDIPSYQLKPGQVISVRE........ 127
633 4.000e-14UniRef50_W7CA00 30S ribosomal protein S4 n=4 Tax=root TaxID=1 RepID=W7CA00_9LIST  ali  34...........RLDNVVYRLGLARTRRAARQLVNHGHIVVDSKRVDIPSYQVSPGQVISVREKSLK.... 88
634 4.000e-14UniRef50_A0A1J4VKB5 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4VKB5_9BACT  ali  34  7..EFKLSSEYIELDNLLKAVNIVPTGAQAKMLIIADSVKVNNVVEKRVRRKLRKGDTVEVHGRAILLV.. 72
635 4.000e-14UniRef50_A0A133YQI6 S4 domain protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A133YQI6_9FIRM  ali  37  1MKTVYIETEFIKLSQLLKYASIVQNGSDAKFFISEGLVFVDGEVETRRGRKIYDSMNVKVDGKEFNILV. 71
636 4.000e-14UniRef50_A0A0W1RRM2 Uncharacterized protein n=1 Tax=Halothiobacillus sp. XI15 TaxID=1766620 RepID=A0A0W1RRM2_9GAMM  ali  17  18........DSQRLDTWLWAARFFKTRQLASAAIDGGKIELNGQTVGKRGKAIRPGDRLTIGKAGMRFVVD 79
637 4.000e-14UniRef50_A0A174ZX11 Pseudouridine synthase n=13 Tax=Firmicutes TaxID=1239 RepID=A0A174ZX11_CLOIN  ali  24  3...........RLQKVIAAAGI-TSRRKAEVLISEGRVAVNGETITELGYKVKRGDLIEVDGKAI..... 55
638 4.000e-14UniRef50_C2KMB6 S4 domain protein YaaA n=20 Tax=Leuconostoc TaxID=1243 RepID=C2KMB6_LEUMC  ali  46  1MTTVRITTEYITLTQLLKEENIISSGGQAKYYLMDFPVLLNGETENRRGKKLYDHDEIVIDGETYTI... 68
639 4.000e-14UniRef50_A0A2D5N9G8 Pseudouridine synthase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2D5N9G8_9FLAO  ali  19  59.EDIASTSGEMRXNRFLSHAGICN-RREADDLIAAGLVQVNGKVIVTMGYKVQPTDEVKYNGSLIK.... 122
640 4.000e-14UniRef50_Q0AX41 Pseudouridine synthase n=4 Tax=Syntrophomonas TaxID=862 RepID=Q0AX41_SYNWW  ali  17  1..........MRLAKYLAESGI-SSRRQAERLITQGKVKVNDKTITELAFTLKPGDRVEFAGKIIEQ... 56
641 4.000e-14UniRef50_A0A2H5Y1A1 Pseudouridine synthase n=1 Tax=bacterium HR21 TaxID=2035416 RepID=A0A2H5Y1A1_9BACT  ali  21  1MERRETSQQGIRLNKFLADAGIA-SRRKADELIRQGRVKVNGKP-AVLGMRVFPWDEVTVDGNRVR.... 64
642 4.000e-14UniRef50_C3JBA6 Pseudouridine synthase n=3 Tax=Porphyromonadaceae TaxID=171551 RepID=C3JBA6_POREA  ali  21  223.........PLRLNKFLASSGVC-SRRVADQLIVDGHVSVNGEIVTQLGKHVTREDFISVDGKPVSI... 279
643 4.000e-14UniRef50_A0A126NYF0 RNA-binding protein n=9 Tax=Rhizobiales TaxID=356 RepID=A0A126NYF0_9BRAD  ali  15  1.....MRQDRQRLDKWLWFARFAKTRATAARLIEAGHVRVDGRRIVGAGHGLKLGDVLTLALPHATIVV. 64
644 4.000e-14UniRef50_A0A0F2PXU2 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4b TaxID=1629717 RepID=A0A0F2PXU2_9FIRM  ali  34  1MHSIAVST-SIKLNQFLKLSNAAGSGGQGKMLVQTGRVSVNGTVVYHRGKNILPGDIVSVEGIGAYKAVA 69
645 4.000e-14UniRef50_K4ZLY5 30S ribosomal protein S4 n=2 Tax=Bacillales TaxID=1385 RepID=K4ZLY5_PAEAL  ali  10  34...........RLDNLVFRLGLSNSRAGARQLVAHGHVTVNGKKVDIPSYIVTPGDVIGLRERSRKVIK. 93
646 4.000e-14UniRef50_A0A2D6E2V3 30S ribosomal protein S4 n=1 Tax=bacterium TaxID=1869227 RepID=A0A2D6E2V3_9BACT  ali  15  135...........RLDNLVYRTGLASTRRQARQYVTHGLFTVNGRRVDIPSYQVRAKDIIAVGENK...... 187
647 5.000e-14UniRef50_A0A161HFJ0 Heat shock protein 15 n=213 Tax=Bacteria TaxID=2 RepID=A0A161HFJ0_9GAMM  ali  19  7.........SVRLDKWLWAARFFKTRSLAAEAVSGGRVHVNGDRV-KPSRSVRVGDRLRIN......... 57
648 5.000e-14UniRef50_R7FNS4 S4 domain protein n=1 Tax=Clostridium sp. CAG:288 TaxID=1262791 RepID=R7FNS4_9CLOT  ali  34  3.KTIKITTEYIKLDQLLKIAGYVQTGGEAKVFIATSNILVEGVPTWARGKKIYPGYVVNVGDDELHI... 68
649 5.000e-14UniRef50_A0A179D2Y3 Pseudouridine synthase n=2 Tax=Thermosulfurimonas dismutans TaxID=999894 RepID=A0A179D2Y3_9BACT  ali  25  1..........MRLSKFLARAG-VTSRRKAEVLIQEGKVLVNGEVITEPSFKVDPEDKVEVGGRSVK.... 56
650 5.000e-14UniRef50_A0A2A2YF40 Pseudouridine synthase n=2 Tax=unclassified Verrucomicrobiae TaxID=481447 RepID=A0A2A2YF40_9BACT  ali  17  6...........RLNKYLAACGVA-SRRGCDDLILAGHVEVNGHPCLKPGTRIKEGDHVRVDGKR...... 57
651 5.000e-14UniRef50_A0A1Y4GGB6 Pseudouridine synthase n=1 Tax=Cloacibacillus sp. An23 TaxID=1965591 RepID=A0A1Y4GGB6_9BACT  ali  20  1.....MSEGTVRLNRYLAMCG-AGARRKVEEYITDGRVRINGTTVTEPGRQVAPGDVVELDGRELSPVES 64
652 5.000e-14UniRef50_A0A1F6WR23 30S ribosomal protein S4 n=1 Tax=Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_33_17 TaxID=1801764 RepID=A0A1F6WR23_9BA  ali  11  94...........RLDNIVYRLGFAPTRRMARQMTSHGHFCVNGTRTTVPSYSIKQGDVITVRE........ 144
653 5.000e-14UniRef50_A0A2N1V8Z3 Pseudouridine synthase n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-4 TaxID=2013811 RepID=A0A2N1V8Z3_9BACT  ali  17  24.KKIDMLDQTVRLNKFISDAGY-TSRRKADELIEAGRVTVGGKIVTEHGTKVRKGDNVRVDGDSV..... 86
654 5.000e-14UniRef50_A0A0G1FXP5 30S ribosomal protein S4 n=7 Tax=Bacteria TaxID=2 RepID=A0A0G1FXP5_9BACT  ali  11  100..........IRLDNVVFRLGWAKSRPAARQLVNHGHVLINGKRVSIPSYQVKMGEVISLTDKT...... 153
655 5.000e-14UniRef50_B2A4P2 Pseudouridine synthase n=51 Tax=Bacteria TaxID=2 RepID=B2A4P2_NATTJ  ali  21  1..........MRLQKFMSRAGIA-SRRKSEELIQQGRVTVNGQVITRLGTKINPTDTVKVDGEPI..... 55
656 5.000e-14UniRef50_A0A075LMQ4 RNA-binding protein n=7 Tax=Bacillaceae TaxID=186817 RepID=A0A075LMQ4_9BACI  ali  56  3.EEIQINTEYIQLGKFLKLVNAVESGGMVKLYLADYPVLVNGEEENRRGRKLYPEDRVELP......... 62
657 5.000e-14UniRef50_A0A2N5Z655 Uncharacterized protein (Fragment) n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5Z655_9BACT  ali  17  118......EDNSIRLNRYIAQTGFC-SRREADTYITSGVVSINNKRVTELGTKVKPTDKIKINGE....... 173
658 5.000e-14UniRef50_B7GKJ8 Pseudouridine synthase n=37 Tax=Bacteria TaxID=2 RepID=B7GKJ8_ANOFW  ali  25  9.......NEMERLQKVIAHAGVA-SRRKAEQLIVEGKVKVNGKVVTELGVKVSPQDRIEVDG........ 62
659 5.000e-14UniRef50_A0A2A9CUG0 Ribosome-associated protein YbcJ (S4-like RNA binding protein) n=1 Tax=Propionicimonas paludicola TaxID=185243 RepID=A0A2A9CUG0_9  ali  37  2..EIEIGEETIRLGQLLKFANLVADGAEAKTLIIDGAVRVDGEVETRRGRQVGIGSTVEID......... 60
660 5.000e-14UniRef50_A0A1G3RS30 30S ribosomal protein S4 n=10 Tax=Bacteria TaxID=2 RepID=A0A1G3RS30_9SPIR  ali  14  100...........RLDNVAFRLRFATSRSQARQVVLHGHVLVNGKRVNVPSFVVKPGDVITVH......... 149
661 5.000e-14UniRef50_Q2J2Q0 RNA-binding S4 n=16 Tax=Proteobacteria TaxID=1224 RepID=Q2J2Q0_RHOP2  ali  21  2........ERQRLDKWLWHARIVRARSTAAALVESGHVRVNGVREKSPGHGIKTGDVVTIALDRSVRV.. 61
662 5.000e-14UniRef50_A0A1V4QWC8 30S ribosomal protein S4 n=3 Tax=Bacteria TaxID=2 RepID=A0A1V4QWC8_9BACT  ali  14  98...........RLDNVVFRAGLADSRRQARQLVAHRHFWLNGRVVDRPSFLVRAGDVVEVKPERRNR... 153
663 5.000e-14UniRef50_A0A1I1GSR8 Ribosome-associated protein n=2 Tax=Parapedobacter composti TaxID=623281 RepID=A0A1I1GSR8_9SPHI  ali  26  3.ETYKITGGYIPLIQLLKALNWVEHGGEAQAVVVAGLVKHNGQVDYRKRLKVRPGDVVEFQGKSV..... 66
664 5.000e-14UniRef50_A0A0R1N1Z6 30S ribosomal protein S4 n=90 Tax=Bacteria TaxID=2 RepID=A0A0R1N1Z6_9LACO  ali  10  76...........RLDNLVYRLGFASTRPQARQLVNHGHVTVDGKRVDIASYEVKPGQVIGLREKDLQVVKD 136
665 5.000e-14UniRef50_A0A0P8A9M5 Ribosome-associated heat shock protein Hsp15 HslR n=17 Tax=Rhizobiales TaxID=356 RepID=A0A0P8A9M5_9RHIZ  ali  15  1.....MREDRQRLDKWLWYARFARTRTACAKLVEDGRVRLNGTRIKQPSKGIAAGDVLTVAAEHGTIV.. 63
666 5.000e-14UniRef50_A0A0G1WZ70 30S ribosomal protein S4 n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1WZ70_9BACT  ali  93...........RLDNVVFRLGLVPSRRFARQIIAHGHITINGRRMSIPSYQVRQGDVI............ 139
667 5.000e-14UniRef50_G4REZ7 RNA-binding S4 domain protein n=3 Tax=Rhizobiales TaxID=356 RepID=G4REZ7_PELHB  ali  20  5......TPDRQRLDKWLWHARITKTRTLAQKLIESGAVRVNGQRVLDTDRKVGAGDGLTIQIHTRLKV.. 66
668 5.000e-14UniRef50_R6H665 30S ribosomal protein S4 n=41 Tax=cellular organisms TaxID=131567 RepID=R6H665_9FIRM  ali  11  89...........RLDNVVYRLGYASTRREARQLVNHGHFTVNGKRVNIPSFLVKVGDLVAVCEASV..... 142
669 5.000e-14UniRef50_Q11CX7 RNA-binding S4 n=23 Tax=Bacteria TaxID=2 RepID=Q11CX7_CHESB  ali  20  3......TDERQRIDKWLFFARVVKSRSLAAKLAQAGRVRVNREKINEASQLVRPGDVLTITLDRRILV.. 64
670 5.000e-14UniRef50_UPI00082FB6E9 RNA-binding S4 domain-containing protein n=1 Tax=Alicyclobacillus acidiphilus TaxID=182455 RepID=UPI00082FB6E9  ali  44  2..DIEFDGPFITVGQLLKKLNIVSSGGEVKVFLEEHGVSVNRQAENRRGRKLVDGDIVRIGKQEY..... 64
671 6.000e-14UniRef50_A0A1W9NU63 Multifunctional fusion protein n=25 Tax=Epsilonproteobacteria TaxID=29547 RepID=A0A1W9NU63_9PROT  ali  15  145...........RLDNVVYRMGFATTRASARQFVNHGHVLVDGKRVDIPSFRVKPGQKIEIREKS...... 197
672 6.000e-14UniRef50_E0N1L3 Pseudouridine synthase n=10 Tax=Mobiluncus TaxID=2050 RepID=E0N1L3_9ACTO  ali  23  36....ESTSEPERLQKVLSRAGVA-SRRASEDLIARGRVQINGETVREMGVKVLPTDRITVDGQRI..... 95
673 6.000e-14UniRef50_A0A2A4TPG1 RNA-binding protein n=5 Tax=Bacteria TaxID=2 RepID=A0A2A4TPG1_9FLAO  ali  32  7..NLKEDQEYIQLNNLLQYLSIAQTGGHAKILIQNEEVFLNGEIETRIRKKIYTGDVVKLENAEIFV... 71
674 6.000e-14UniRef50_A0A2M8TYX6 RNA-binding protein n=1 Tax=Ferrovibrio sp. TaxID=1917215 RepID=A0A2M8TYX6_9PROT  ali  17  16...........RLDKWLWMTRFCKTRAIAQKLANKGRIRINGRVVDKPHALVRAADVITLPLPASVKV.. 72
675 6.000e-14UniRef50_A0A1V4RW98 30S ribosomal protein S4 n=31 Tax=root TaxID=1 RepID=A0A1V4RW98_9BACT  ali  12  100...........RLDNVVYRMGFASSRNQARQLILHRHFTVNNRLVNIPSYLLRPGDLVAVREKSRK.... 154
676 6.000e-14UniRef50_A0A1L5P9A5 Heat shock protein 15 n=22 Tax=Rhizobiales TaxID=356 RepID=A0A1L5P9A5_RHIET  ali  15  14...........RIDKWLFFTRMVKSRSLAQGHIQSGHVRINGERVQQPSQTVKAGDRVELALDRRDVV.. 70
677 6.000e-14UniRef50_A5EY77 Heat shock protein 15 n=1 Tax=Dichelobacter nodosus (strain VCS1703A) TaxID=246195 RepID=A5EY77_DICNV  ali  26  1MKSIKLQQETVRLDQWLWAARFFKTRPVAVQNIKNGRVLVNGQR-AKPARTISVGDTLTIQ......... 66
678 6.000e-14UniRef50_A0A0G1B7L5 30S ribosomal protein S4 n=19 Tax=Bacteria TaxID=2 RepID=A0A0G1B7L5_9BACT  ali  14  101...........RLDNVIYRLGFAQSRSQARTLVSHGHFKVNDQKVDIPSFNVQTGDIIKIKESSR..... 154
679 6.000e-14UniRef50_A0A193KH31 Uncharacterized protein n=18 Tax=Vibrionaceae TaxID=641 RepID=A0A193KH31_9VIBR  ali  27  15...VEVTTQPVELYKVLKIADAVSGGGEAKQAISQGYVAVNGEIDTRKRRKLVDGDLVQFNEEFYLVI.. 79
680 6.000e-14UniRef50_K0DBJ2 Uncharacterized protein n=2 Tax=Leuconostoc carnosum TaxID=1252 RepID=K0DBJ2_LEUCJ  ali  48  3.KNVKITTEYITLTQLLKEENIISSGGQAKYYLMDFPVMLNGEEENRRGKKLYDHDQIIIDGETYVI... 68
681 6.000e-14UniRef50_B8ERF0 RNA-binding S4 domain protein n=50 Tax=Alphaproteobacteria TaxID=28211 RepID=B8ERF0_METSB  ali  17  6...........RLDKWLWFARVTKTRTLAARLVLDGHVRLNARRIDAPAKPVAAGDVLTVALERQVRV.. 62
682 6.000e-14UniRef50_A0A1G9E5A3 Heat shock protein Hsp15 n=6 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1G9E5A3_9RHOB  ali  19  18........DAIRLDRWLCHARVFKTRTVAAERIAAGGVRINGAPCRKPGHEVKVGDVVT........... 68
683 6.000e-14UniRef50_A0A2P5KSJ9 RNA-binding protein n=2 Tax=Hyphomicrobium sp. TaxID=82 RepID=A0A2P5KSJ9_9RHIZ  ali  17  22...........RLDKWLWYARLTKSRTHAAALVSEGRVRVNRERTDKPSQTVRPGDVVTATVNRTVRV.. 78
684 6.000e-14UniRef50_A0A1E7I633 Uncharacterized protein n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1E7I633_9DELT  ali  31  3.QQFVISDEYIELNKLLKASGLCDTGGQTKIVIEDELVTVDGETETRKRRKIKDGMIVKYGTHSVKVI.. 69
685 7.000e-14UniRef50_A0A0G1V7Q5 30S ribosomal protein S4 n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1V7Q5_9BACT  ali  16  94...........RLDNIMYRAGIAQTRRMARQLVSHGHVRVNGKKVSIPSYICRAGETIQLK......... 143
686 7.000e-14UniRef50_A0A1Q7WXR9 30S ribosomal protein S4 n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7WXR9_9ACTN  ali  14  101.............DNVLVRLGFAASRRQSRQLIGHGHWLVNGRRVDIPSYQVRPEDVISIRAESADVVRS 159
687 7.000e-14UniRef50_H1Y3P6 RNA-binding S4 domain protein n=27 Tax=Bacteroidetes TaxID=976 RepID=H1Y3P6_9SPHI  ali  25  1MIEFILTGDYIQMIQLLKATNLVQTGGEAQIVVSQGEVKYNGTVDTRKRLKVKQGDLVEFRGHQILV... 67
688 7.000e-14UniRef50_A0A2E1DZX7 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E1DZX7_9FLAO  ali  21  7.....MENQLVRLNKYVSNSGLC-TRREADNYIQSGRVSVNNKLVEKLGSKISVNDEVKVDGNLIF.... 66
689 7.000e-14UniRef50_A0A1V4MUI0 Pseudouridine synthase n=1 Tax=Candidatus Aegiribacteria bacterium MLS_C TaxID=1775674 RepID=A0A1V4MUI0_9BACT  ali  20  2.......TEGIRLNRYLARAGIA-SRRKSDLLIQQGNVRVNGVTVTVPGYRVMEGDRVSFQSEPVQ.... 59
690 7.000e-14UniRef50_A0A1F3SGI3 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F3SGI3_9PROT  ali  26  1MLEFKLTDEHIPLCDLLKIMKLCESGAVAKHLIADGKVKVDGVVELRKRAKIRKNQVVEFDGKRVQVV.. 69
691 7.000e-14UniRef50_D1J7E3 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=D1J7E3_MYCHP  ali  38  2..EIEITGEFIKLSQFLKKIDVCPTGGMAKYFVQVHRILINGNLANGRNAKIYPGDTVWIDDNVYLI... 66
692 7.000e-14UniRef50_A0A1G7ZIA6 Ribosome-associated protein n=1 Tax=Propionivibrio dicarboxylicus TaxID=83767 RepID=A0A1G7ZIA6_9RHOO  ali  26  5...IEVRGDHIQLDQALKTTGLCHSGGFAHAEIEAGRVEVDGSVELRKRAKLRPGQRIAYGGETIELV.. 69
693 7.000e-14UniRef50_A0A0G0QBE8 30S ribosomal protein S4 n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0QBE8_9BACT  ali  11  95...........RLDNVIYRTGLASSRRAGRQLVSHGHVLVNGKKVDIPSFRVKIGEEIALSEKS...... 147
694 7.000e-14UniRef50_UPI0003A3212F S4 domain-containing protein YaaA n=1 Tax=Fusobacterium russii TaxID=854 RepID=UPI0003A3212F  ali  44  4IEKIKISTDFIKLDQFLKWVAVCDSGSEAKDIIISNKVKVNDEIEIRRGRKLYPEYKIEVFN-RIFIIE. 71
695 7.000e-14UniRef50_D1CFA0 Pseudouridine synthase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=D1CFA0_THET1  ali  27  2.......NEPIRLHKLLAQMGVA-SRRAAERMIAEGRVSVNGRIVNTPGAMASPEDEIRVDGKLVRQ... 60
696 7.000e-14UniRef50_A0A0S7BX25 Pseudouridine synthase n=2 Tax=Lentimicrobium saccharophilum TaxID=1678841 RepID=A0A0S7BX25_9BACT  ali  17  278......EDGTIRLNKYLANAGIC-SRREADTLIESGAVSVNGKVVTLLGTRISREDQVQFGGET...... 334
697 7.000e-14UniRef50_A0A0A5HTF5 Urease n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0A5HTF5_9VIBR  ali  34  20.....VSSHPIELYKVFKIANLVGGGGEAKHLIAEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVV.. 82
698 8.000e-14UniRef50_A0A166U512 Uncharacterized protein n=1 Tax=Lactococcus lactis subsp. cremoris TaxID=1359 RepID=A0A166U512_LACLC  ali  49  1MEKYILFEEYITLGQVLKELGLIATGGQAKIFLAEGEIFYNGEAENRRGKKMRNGDLLEFP......... 63
699 8.000e-14UniRef50_I1YES1 Uncharacterized protein n=27 Tax=root TaxID=1 RepID=I1YES1_METFJ  ali  29  7..TVHIHSSPVELYKVLKFEGLVSSGAEAKLVISDGQVTVNGTTETRKRRKLVAGDQIQF.......... 64
700 8.000e-14UniRef50_Q67NH5 Pseudouridine synthase n=17 Tax=Bacteria TaxID=2 RepID=Q67NH5_SYMTH  ali  25  4...........RLQKVMARAGVA-SRRHCEALIQAGRVTVNGQVVTQLGTKVVPGDVIEVDGR....... 55
701 8.000e-14UniRef50_A0A2T4XD33 RNA-binding protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4XD33_9BACT  ali  31  11......TDEFIELVKLLKIKQLAQSGGHASILVEDGEVKVNGETEYRKRKKLRVGDVVELEGIAITI... 71
702 8.000e-14UniRef50_A5G345 Heat shock protein Hsp15 n=15 Tax=Alphaproteobacteria TaxID=28211 RepID=A5G345_ACICJ  ali  20  16...........RLDKFLFHARFVKTRGVAARLVAAGGVRINRQITEKPHARLRPGDVLTLQGVQVVRVVA 77
703 8.000e-14UniRef50_Q97IP6 Putative 30S ribosomal protein S4 C n=347 Tax=root TaxID=1 RepID=RS4C_CLOAB  ali  10  71MKNKEASGSSLRLDNVVYRIGFANSIRQARQMVSHGLILVNGKKLDIPSYEVQVGDVVSLKEKHRQ.... 142
704 8.000e-14UniRef50_A0A291QQA6 Pseudouridine synthase n=2 Tax=Chitinophaga TaxID=79328 RepID=A0A291QQA6_9BACT  ali  10  127.....LDPNEMPLNKYIAHSGIC-SRRKAVELIKEGKVTVNGNVVLEPATKVLPTDSVKLSNKKINITKN 190
705 8.000e-14UniRef50_A0A1Z1FE31 Uncharacterized protein n=2 Tax=Croceicoccus marinus TaxID=450378 RepID=A0A1Z1FE31_9SPHN  ali  16  12.........SLRIDRLLWMLRLAASRGAAQDIVATGHVRRNGQRVTRMAQPVCAGDVLTVPGRSIRVI.. 71
706 8.000e-14UniRef50_K0RTB6 Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RTB6_THAOC  ali  38  81..........IDLQTFLKLCNLVQTGGEAKAAIQSGDVRLNWEVETRRSKKLYAGDEVTYGEVTLDV... 137
707 8.000e-14UniRef50_A0A2G1ZU47 30S ribosomal protein S4 n=27 Tax=Planctomycetes TaxID=203682 RepID=A0A2G1ZU47_9BACT  ali  15  136...........RLDNAVRRSGFARTIWAARQMVVHGHVRVNGKKVDRPSYTIKVGDELSFKPKIEKLVR. 193
708 8.000e-14UniRef50_Q03V53 30S ribosomal protein S4 n=55 Tax=Bacteria TaxID=2 RepID=RS4_LEUMM  ali  94...........RLDSVVYRLGLATTRQQARQLVNHGHILVDGKRVDIPSYSVQPGQVVSVREKSKNI... 149
709 8.000e-14UniRef50_U5PDV8 DNA replication and repair protein RecF n=44 Tax=root TaxID=1 RepID=U5PDV8_9STRE  ali  40  2..NYKLFDEFITLQALFKELGIIQSGGAIKAFLLENQVEVNGEVETRRGRKLRVGDTIKVGDKEIVTIT. 69
710 9.000e-14UniRef50_A0A136PCN3 30S ribosomal protein S4 n=4 Tax=Bacteria TaxID=2 RepID=A0A136PCN3_9BACT  ali  14  50...........RLDNIVYRLGFASSRSAARQLVLHRHLMVNGVLVNIPSYILKPGDVVTVRPKSRK.... 104
711 9.000e-14UniRef50_J2JDG6 Pseudouridylate synthase, 16S rRNA uridine-516 n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=J2JDG6_FLASC  ali  22  68........DEIRLNKFISNSGVC-SRRDADIYIQSGNVKVNGVPVTEMGYLVKLTDVINFDG........ 120
712 9.000e-14UniRef50_A0A1Z9JJ76 RNA-binding protein S4 n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Z9JJ76_9PROT  ali  12  1.....MTGESLRLDKWLWYARFFKTRALATKAIAGGRFRLDGEVMSKPHRAAQPGQVLTFQGDRVRVIR. 66
713 9.000e-14UniRef50_G2IP97 Putative heat shock protein 15 n=51 Tax=Bacteria TaxID=2 RepID=G2IP97_9SPHN  ali  15  6......HGPSLRLDKFLWFVRLAPNRSSAQALAERGIVRLNGRRIDRAHAPVRIGDLITFPGNAVRVIR. 69
714 9.000e-14UniRef50_M7PHR4 Heat shock protein 15 n=5 Tax=Proteobacteria TaxID=1224 RepID=M7PHR4_9GAMM  ali  22  10......DQETQRLDKWLWAARFYKTRALAVEAINGGKVHVNGQR-AKPGRSIRINDELTV.......... 62
715 9.000e-14UniRef50_C5RAN2 30S ribosomal protein S4 n=18 Tax=Firmicutes TaxID=1239 RepID=C5RAN2_WEIPA  ali  94...........RLDNIVYRLGLASTRQQARQLVNHGHILVDGKRVDIPSYEVSVGQEISVREKSQKNV.. 150
716 9.000e-14UniRef50_A0A0G1SLV0 30S ribosomal protein S4 A n=1 Tax=Parcubacteria group bacterium GW2011_GWA2_47_21 TaxID=1618843 RepID=A0A0G1SLV0_9BACT  ali  18  71...........RLDNVVYRLGLAASRAAARQMVCHCHIRVNGKRVNMPSYGVYAGDVISVR......... 120
717 9.000e-14UniRef50_A0A0P6XJD9 RNA-binding protein n=2 Tax=Erythrobacter TaxID=1041 RepID=A0A0P6XJD9_9SPHN  ali  17  1..........MRIDRLLWFLRFAKSRGLAQKWVGEGHIRRNGARVLRLDQAIAAGDVLTLPLSSRVVV.. 58
718 9.000e-14UniRef50_A0A0B7IXM9 Uncharacterized protein n=1 Tax=Candidatus Methylopumilus turicensis TaxID=1581680 RepID=A0A0B7IXM9_9PROT  ali  38  1MQDIEINTEYVELCNLLKLVDLADSGGRGKAMVSEGLVKVDGQLELRKTAKIKPGQIIECEGKRILI... 69
719 9.000e-14UniRef50_A0A202DNS9 30S ribosomal protein S4 n=7 Tax=Bacteria TaxID=2 RepID=A0A202DNS9_9BACT  ali  13  99..........IRLDNVVRRLGFAPSMSLARQLVSHGHILVNGKRVNVPSFLVKVGDTISLSDK....... 151
720 9.000e-14UniRef50_A0A0F7GEE1 30S ribosomal protein S4 n=2 Tax=root TaxID=1 RepID=A0A0F7GEE1_9CHLR  ali  31...........RLDNVVYRLGLADSRAQARQLVRHGHILVGGKKLDIPSYLVREADVISFREQSTK.... 85
721 9.000e-14UniRef50_A0A174SG83 30S ribosomal protein S4 n=17 Tax=Bacteria TaxID=2 RepID=A0A174SG83_9CLOT  ali  12  89...........RLDNMVYRMGFAPSIRAARQMVNHGHFLVNGKKVNIPSYQLSVGDEVVLREKSR..... 142
722 9.000e-14UniRef50_UPI0009E8A246 rRNA pseudouridine synthase n=1 Tax=Kallipyga gabonensis TaxID=1686287 RepID=UPI0009E8A246  ali  11  12......KGYPMRINRYLAKCGLA-SRRKSEDFIREGRVMVAGKVIRDLSYQVQPGDKVFVDGKEVR.... 70
723 9.000e-14UniRef50_Q1J444 Hypothetical cytosolic protein n=9 Tax=Bacteria TaxID=2 RepID=Q1J444_STRPF  ali  41  70...YKLFTEFITLQALLKELGIIQSGGAIKGFLAETTVLFNGEDEKRRGKKIRIGDKISLPDQDLIII.. 134
724 1.000e-13UniRef50_A0A163VUT5 Pseudouridine synthase n=2 Tax=Candidatus Fermentibacteria TaxID=1729712 RepID=A0A163VUT5_9BACT  ali  20  1..........MRLNRFLARAG-VGSRRTCDDLIRQGLVTVNGRRPESLGVQVSPGDRVEYAGRRIV.... 55
725 1.000e-13UniRef50_A0A161QUR3 RNA-binding protein n=9 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A161QUR3_9BRAD  ali  18  2........ERQRLDKWLWHARVVKARTSAAALVEGGKIRINGEREKSPGHGVKIGDVLTVALDRTVRV.. 61
726 1.000e-13UniRef50_A0A1T4KCW1 Pseudouridine synthase n=4 Tax=Treponema TaxID=157 RepID=A0A1T4KCW1_9SPIO  ali  25  6......NDSKIRLQVFLAHSGVA-SRRACEKIIESGRVSVNGSVVTELGTKVSAQDEVLVDGKKVF.... 64
727 1.000e-13UniRef50_A0A2M8NXN2 30S ribosomal protein S4 n=3 Tax=Bacteria TaxID=2 RepID=A0A2M8NXN2_9CHLR  ali  17  99...........RLDNVVYRAGFAATIWAARQMVVHGHILVNGERLDLPSYQVRVGDVITLHEKMRQNV.. 155
728 1.000e-13UniRef50_V5BUC3 Heat shock protein 15 n=24 Tax=root TaxID=1 RepID=V5BUC3_9GAMM  ali  20  4......DVEAIRLDKWLWAARFYKTRSLASDAINGGKVHVNGQR-TKAAKDIKIGTEITINKNGY..... 61
729 1.000e-13UniRef50_M4S4D4 RNA-binding S4 domain-containing protein n=22 Tax=Proteobacteria TaxID=1224 RepID=M4S4D4_9SPHN  ali  19  2.......SETIRIDKFLWFIRLARTRGLAQDIVAAGRMRVTGRIVERAHAAVRVGDVLTFPLHGRVRV.. 62
730 1.000e-13UniRef50_A0A2A4SSC8 Pseudouridine synthase n=1 Tax=SAR324 cluster bacterium TaxID=2024889 RepID=A0A2A4SSC8_9DELT  ali  21  3..........IRLQKVIANAGIA-SRRKAEEMIQMGEVQVNGQVVTKLGTQVDPEDKIRVAGKMI..... 57
731 1.000e-13UniRef50_A0A1G8T3I6 Heat shock protein 15 n=76 Tax=Bacteria TaxID=2 RepID=A0A1G8T3I6_9PSED  ali  15  5......DDDKVRLDKWLWAARFYKTRALAKAAIEGGKVHCRGERC-KPAKEPRVGDELTIRDERTVVVRA 70
732 1.000e-13UniRef50_K7S8N6 Heat shock protein n=37 Tax=Rhodospirillales TaxID=204441 RepID=K7S8N6_GLUOY  ali  25  1.....MSDDYQRLDQWLYYARVAKTRPLCATIVSKGRIRVNRQPTSKPHAKLRVGDVLTLP......... 56
733 1.000e-13UniRef50_Q3Z954 30S ribosomal protein S4 n=10 Tax=Chloroflexi TaxID=200795 RepID=RS4_DEHM1  ali  98...........RLDNVLFRLGFGTSRAQARQIVMHGHILVNGQKTDIPSYLVKEGQEITVRETS...... 150
734 1.000e-13UniRef50_E1SGH2 Uncharacterized protein ybcJ n=139 Tax=root TaxID=1 RepID=E1SGH2_PANVC  ali  31  14............LCDLLKLEGWVQSGAQAKVVIAEGEVKVNGAVETRKRCKIVAGQTVEFAGFRITVVE. 70
735 1.000e-13UniRef50_A0A2E6SE63 Pseudouridine synthase n=22 Tax=Bacteria TaxID=2 RepID=A0A2E6SE63_9BACT  ali  16  10...ISLVLDPMRLNKFLAEAGIA-SRRKSDKLIQMATTEVNGKICLDPAYHVQVDDVVKYDGQKIKPVK. 74
736 1.000e-13UniRef50_A0A0N0I466 Ribosomal large subunit pseudouridine synthase B n=2 Tax=Bacillales TaxID=1385 RepID=A0A0N0I466_9BACI  ali  18  3...........RLQKVIARAGIA-SRRKAEELILQGRVKVNGRVVKELGVKVGPRDDVEVDGIPIER... 57
737 1.000e-13UniRef50_B6BKP1 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=B6BKP1_SULGG  ali  33  1MK-FELKDDYIELFKLLKVLGLADSGAHAKMLIADGYVKRNAEVELRKGAKIVSGDIIEIADAVIEV... 66
738 1.000e-13UniRef50_A0A1Y1S1E6 Pseudouridine synthase n=2 Tax=Marispirochaeta TaxID=1911565 RepID=A0A1Y1S1E6_9SPIO  ali  20  5......KDNEIRLQVFLARSGIA-SRRGSEDLIRQGRVRVNGRVITRMGEKVSLGDTVEVDHKKIY.... 63
739 1.000e-13UniRef50_C6D4J2 30S ribosomal protein S4 n=20 Tax=Bacteria TaxID=2 RepID=C6D4J2_PAESJ  ali  11  92...........RLDNLVFRLGFANSRAGARQLVSHGHVTVNGKKVDIASYTVSTGDVIGLRERSR..... 145
740 1.000e-13UniRef50_UPI00068DCDD5 rRNA pseudouridine synthase n=1 Tax=Sphingobacterium sp. T2 TaxID=1590596 RepID=UPI00068DCDD5  ali  16  101......DDGLIRLNRYIANAGIC-SRRKADELIAAGVITVNGEVVTSLGTKVDPKDEIRYNNERLKR... 161
741 1.000e-13UniRef50_A0A2S5A9N0 Pseudouridine synthase n=1 Tax=Solitalea sp. HR-AV TaxID=2079460 RepID=A0A2S5A9N0_9SPHI  ali  16  340......NPDEVRLNRYIANAGVC-SRRKADELISLGEISVNGQVVTELGYKVHVSDTVHFNGQLLRR... 399
742 1.000e-13UniRef50_E7S8N8 S4 domain protein YaaA n=298 Tax=Bacteria TaxID=2 RepID=E7S8N8_9STRE  ali  44  2..NYKLFDEFITLQALFKELGIIQSGGAIKAFLLENQVEVNGEVETRRGRKLRVGDTIEVIGEKEII... 66
743 1.000e-13UniRef50_A0A223NZN0 RNA-binding protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=A0A223NZN0_9SPHI  ali  27  1MIEFKVTGDYIPMIQLLKAVNLVQTGGEAQIVVTEGEVMYNGHIDYRKRLKVKKGDTVEFRGETIRVI.. 68
744 1.000e-13UniRef50_U2JYL2 S4 domain protein n=3 Tax=Bacteria TaxID=2 RepID=U2JYL2_9FIRM  ali  40  7........ENITLGMTLKISGFIQTGGEAKTRIQQGEVRLNGEVETQRGKKLTIGDYIEFNEDYIEIIK. 67
745 1.000e-13UniRef50_L0E1G0 Heat shock protein 15 n=28 Tax=Proteobacteria TaxID=1224 RepID=L0E1G0_THIND  ali  21  4....EPERASLRIDKWLWAARFFKTRALATEAVAGGKVHVNGDRC-KPGRKLHPGDRLTIRGQEVFDIE. 68
746 1.000e-13UniRef50_A0A0G1TTI5 30S ribosomal protein S4 n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1TTI5_9BACT  ali  15  97...........RLDNVVFRLGFSVSRRAAQQTVAHGHVLVNGKTVTIPSFRVKAGDVITLKER....... 148
747 1.000e-13UniRef50_C0BLA3 Pseudouridine synthase n=33 Tax=root TaxID=1 RepID=C0BLA3_9BACT  ali  18  97......DDNSIRLNRYISNSGVC-SRREADIFIAAGSIKVNGKAVVEMGYKVALSDVVSFDG........ 151
748 1.000e-13UniRef50_E4L9R1 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=E4L9R1_9FIRM  ali  33  1MYIIQITGEYIQLDQLLKKEGLIQTGGETAIFLSEHKVSLNGIKVFEKRKKIRSGDALTIDETVYRIV.. 68
749 1.000e-13UniRef50_A0A1A7TKX4 RNA-binding protein n=33 Tax=Enterococcus TaxID=1350 RepID=A0A1A7TKX4_ENTFC  ali  49  25.QQVILNTEFMTLGQMLKEVTVIGSGGQAKWYLAENTVLVDGEPENRRGRKLYPGMMVEVPEVGTF.... 89
750 1.000e-13UniRef50_A0A2A4YBI1 30S ribosomal protein S4 n=2 Tax=Candidatus Aerophobetes bacterium TaxID=2030807 RepID=A0A2A4YBI1_9BACT  ali  13  94...........RLDNIVYRLGFAATIFHAQQLICHGHIQVNGKKVDRRSFQVKPGMEISVREK....... 145
751 1.000e-13UniRef50_A0A0B7MHR2 Multifunctional fusion protein n=2 Tax=Syntrophaceticus schinkii TaxID=499207 RepID=A0A0B7MHR2_9FIRM  ali  11  69...........RLDNVVYRLGFAQSRAEARQLVRHGHFTVNGKRVNIPSYHIRTEDEIAVQEKSR..... 122
752 1.000e-13UniRef50_W3RPG8 tRNA synthetase RNA-binding protein n=7 Tax=Rhizobiales TaxID=356 RepID=W3RPG8_9BRAD  ali  15  2........DRQRIDKWLWHARIVRTRTSAAELVAKGHVRINGARVVAPGHAVKQGDVLTIALDSRIRV.. 61
753 1.000e-13UniRef50_A0A1E8GL65 Uncharacterized protein n=3 Tax=Lactobacillales TaxID=186826 RepID=A0A1E8GL65_9LACT  ali  48  2..DYILFDEFITLGKLLKEIDIISSGGAAKAFLAENTVILNDEHENRRGKKLYPTDVLIFPELG...... 63
754 1.000e-13UniRef50_U6FAT1 S4 domain protein YaaA n=2 Tax=Lactobacillus TaxID=1578 RepID=U6FAT1_LACHE  ali  49  4IKYFTIVGDCITLGQFLKEESIISSGGQAKFYLQDNPVTLNGALENRRGKK................... 54
755 2.000e-13UniRef50_F5W1D4 S4 domain protein YaaA n=3 Tax=Streptococcus TaxID=1301 RepID=F5W1D4_9STRE  ali  45  2..EYKLFEEFITLQALLKDLGIIQSGGAIKSFLADHLVYFNGELENRRGKKIRVGDSIEIPDLKTQII.. 67
756 3.000e-13UniRef50_I4EQ42 Uncharacterized protein n=9 Tax=Geodermatophilaceae TaxID=85030 RepID=I4EQ42_9ACTN  ali  42  1MRTIELREETIRLGQLLKLVDAVPSGAQVKDVLTSGEVAVNGEPEERRGRQLHRGDIVSVAGQDDVRI.. 70
757 4.000e-13UniRef50_A0A133CM44 RNA-binding protein n=97 Tax=Firmicutes TaxID=1239 RepID=A0A133CM44_ENTFC  ali  49  3.QQVILNTEFMTLGQMLKEVTVIGSGGQAKWYLAENTVLVDGEPENRRGRKLYPGMMVEVPEVGTF.... 67
758 4.000e-13UniRef50_A0A103EGK3 RNA-binding protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A103EGK3_9BURK  ali  23  5..DFTLTGEFVELHNLLKLTGLADSGGSAKMLVASGAVKVDGAIELRKTCKIRAGQAVLVGDTRIAV... 69
759 4.000e-13UniRef50_P0AAS7 Uncharacterized protein YbcJ n=159 Tax=root TaxID=1 RepID=YBCJ_ECOLI  ali  23  1MATFSLKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQVV.. 69
760 4.000e-13UniRef50_W9B5I5 YbcJ protein n=259 Tax=Enterobacterales TaxID=91347 RepID=W9B5I5_KLEPN  ali  20  1MTTFSLKHPHVELCDLLKLEGWSESGAQAKIAIADGLVKVDGAVETRKRCKIVAGQTVSFEGQSVTV... 68
761 5.000e-13UniRef50_D6HAU4 Uncharacterized protein n=1 Tax=Neisseria gonorrhoeae DGI2 TaxID=528348 RepID=D6HAU4_NEIGO  ali  32  30METVYLEDEYIALCDLLKLAGLAESGGQAKAFIAEGLVLRNGGTEIRKTAKIRGGEVIEFDGARLEI... 98
762 5.000e-13UniRef50_A0A2C6MR78 Uncharacterized protein n=1 Tax=Vibrio sp. PID17_43 TaxID=1583451 RepID=A0A2C6MR78_9VIBR  ali  33  25.....VDAHPIELYKLFKIANLVSGGGEAKHVIDEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVV.. 87
763 5.000e-13UniRef50_A0A290Q5X2 RNA-binding protein n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A290Q5X2_9BACT  ali  36  16...VIVRAVPIELGQLLKFAGLGGSGGEIKTAIKDGEVLLNGAVETRRGKKLAVGDKVSL-GSETVIVQ. 80
764 5.000e-13UniRef50_A0A2N6CC81 RNA-binding protein n=1 Tax=Desulfobulbaceae bacterium TaxID=2053307 RepID=A0A2N6CC81_9DELT  ali  41  1MVSITIKTETIRLSQLLKLADAVQDGAEANFRIANEEVRVNGVVEIRRGRKLRNADLVEFAGETYAV... 67
765 5.000e-13UniRef50_A0A2E8MSS9 RNA-binding protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E8MSS9_9RICK  ali  24  1MEKFTLDEDFIQLNDLMKVLNWVGSGGEAKQIILSEQVTVNGSIEMRVRRKLHSGDKVQWGDQSA..... 67
766 6.000e-13UniRef50_L8XJT2 Uncharacterized protein n=354 Tax=Vibrionales TaxID=135623 RepID=L8XJT2_9VIBR  ali  33  25.....VDAHPIELYKLFKIANLVSGGGEAKHIIEEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVV.. 87
767 6.000e-13UniRef50_A0A264VWN9 Ribosome-associated protein n=29 Tax=Bacteria TaxID=2 RepID=A0A264VWN9_PRORE  ali  20  1MDIFNLDGPHVELCDLLKIEGWAESGAMAKAMIADGLVEVDGVVETRKRCKIVAGKIVSMGSEKIKVVE. 70
768 6.000e-13UniRef50_L0DQF6 Uncharacterized protein n=5 Tax=Planctomycetales TaxID=112 RepID=L0DQF6_SINAD  ali  36  12..........INLTQVLKLANWVMHGGEAKALISEGMVRVNGEVELRKRRKMALGDRVEMEDGRSLILVN 71
769 7.000e-13UniRef50_A0A0E0USR8 S4 domain protein n=9 Tax=Bacillales TaxID=1385 RepID=A0A0E0USR8_LISMM  ali  43  8.ETVKINSEFVTLGQLLQMIDVVSTGGMAKAYLSENTIYINGEQDNRRGKKLRNGDVILVPGVGKVKIEQ 76
770 8.000e-13UniRef50_A9BAK8 S4 domain n=2 Tax=Prochlorococcus TaxID=1218 RepID=A9BAK8_PROM4  ali  34  1..........MKLYQFLKWKCLTNSGGQAKHLISTGSVSVNGQIETRRGRRLIHGDLVSFGN........ 52
771 8.000e-13UniRef50_A0A139NK05 Uncharacterized protein n=1 Tax=Streptococcus sp. DD12 TaxID=1777880 RepID=A0A139NK05_9STRE  ali  35  2..EFVLFEDYIPLQALLKKTGVIQSGGAVKEWIANEAITYNGHVETRRRKKVYIGDIITIPSQDITI... 66
772 1.000e-12UniRef50_F4CCZ9 RNA-binding S4 domain protein n=27 Tax=Bacteria TaxID=2 RepID=F4CCZ9_SPHS2  ali  29  1MINFTLDSEYIHLIQLLKAVNVVENGGEAQAVVSEGLVSCNGVTEFRKRYKVRKGDVIEFLQYKIVV... 67
773 1.000e-12UniRef50_C0QLP4 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=C0QLP4_DESAH  ali  25  44.RDVQIEREPVELYKILKFENLVMSGGEAKHVITQGMVTLNGQVETRKRKKIFAGDVILF-GQEVLKIT. 110
774 1.000e-12UniRef50_A0A1W9R1T3 RNA-binding protein n=1 Tax=Bacteroidetes bacterium 4484_276 TaxID=1970779 RepID=A0A1W9R1T3_9BACT  ali  35  2..EFQLNGEYI<