current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|11497067|ref|NP_051170.1| hypothetical protein (BB_P09) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MDKLEFKMELEIGWFGGRAGIAKMHEKGSSNLPARKHLTKIASSSEFREYINNSYINSKFNLDPKSGMEAIGQAFIRYYENYLLSAQVTPALKANTIKSKFKRGSNTAAIPLVDTAKMLSEITYKVTLELast
1 -15.300[R] COG5005 Mu-like prophage protein gpG  ali follow..  16...................................................QRVFARLQFVGGGKDLARSVASSLLSSSEMAFEDGERWHDWSDPYRKWRTRKGNMP-GKILTLNGDLARRLTTDYGDT 97
2 -6.460[L] COG3039 Transposase and inactivated derivatives, IS5 family  ali follow..  10  27MSQWLDAHRDLLNLVTSDLRRQGVTETGRQGLPSEAVLRCALLKQYRQLSYEELAFHLEDSSVLHKTISAIRADTWEAVNKML-------------LASARQERLESGRVVRVDSTVTAALIHE..... 154
3 -4.960[G] KOG0223 Aquaporin (major intrinsic protein family)  ali follow..  28  205.........LPIGFSVFMVHLATIPITGTGINPARSF............................................................................................ 232
4 -4.820[R] KOG2296 Integral membrane protein  ali follow..  170..ENLKVIVVSASNTWGLFLLVVLLGHGLVELP-RSLWHHGNRHYRLRKTYFDIEKLASEKSEAEENVKDIYKKVRVLFNSMKNDSNGQRRKVRTILSKFSDDVIDNLFPSRQVIDNAHLDESGPCSEA 295
5 -4.730[S] COG5454 Predicted secreted protein  ali follow..  15  11..............................................................................................................PRIDSGSPMNALQGRIVQE 29
6 -4.540[S] COG3601 Predicted membrane protein  ali follow..  1MKNYSMKVFVSVAVLGTLAFILMMLQFPLLPSA--PFLKLDFSD-LAVILVELIKNVLLYIVSGSPVGVPVGELANFINGIFY--------VLPIYYLFHWFRSTKGMVLSTA-VGTLVMTGAMVIFN. 128
7 -4.540[D] KOG2864 Nuclear division RFT1 protein  ali follow..  10  174..............FRKLILQEVLKTPGS--LVVRMVFLPFEESSYTIFARFASGDYQERNKKLGIYLTVAGPSYSYSLIRLLYGEKWSDGEASLALQF-----------IVLAMNGTSEAFLHAVGTK 294
8 -4.530[R] COG1783 Phage terminase large subunit  ali follow..  10  319IKEFKETKEVIFADSAEPKTIKYFSDNGFVMYAAHKFPGSRLQ-------------------NTKKVKRFRHIYVSSNCSNTINELK--------HLTFAKDKLGKTIEDEFNIDPHTFSAIWYGLDG. 419
9 -4.530[S] COG3477 Predicted periplasmic/secreted protein  ali follow..  11  120VAEVFPKIKLWQGLLAGALAQLFVHMI----FPLMGLTPPLFDLPWYENVSEIFGHLVWF-------------WSIEIIRRDLRNRITHEPDPEIPLGSNR............................ 204
10 -4.510[T] KOG2417 Predicted G-protein coupled receptor  ali follow..  147IEQVISRVGV-VGV----TIMAILSGFGAVNAPYCYMFTRPVEEFHVCQLEKKLAHTMDLIVLKKRKAARYELEKKRLSGEKTQKERFWDSFSEQSSGSTLASQIDRLKEEIIPLETLARFLFLDLVE. 276

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.