current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|11497097|ref|NP_051174.1| hypothetical protein (BB_P13) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MIMRYKMKILTKNKTYEYPLRVLPVYEWDKVLGFNQSDAVLKLNEVKYLREITSLMISPKFLDEFYVILDQNREFISYYKDYLVAIIYTAQFNTFHLDNDLKKPALVYLSEYENNVGDFVAFDYINENFDYEKVATSLSSSTSNSNELVAKLast
1 -7.010[U] KOG1688 Golgi proteins involved in ER retention (RER)  ali follow..  10  46LLLLFVLRIFIYQGWYIVCY-ALGIYHLNLFIAFLTPKIDPEFDPYSQDDEDEGPNLPTRSNEEFRPFIRRLPEFKFWLSVAKSTLIGLICTFFDFFNVPVFWPILVFCITMKRQIKHMIKYKYLPFTRNKPRYQRVNDLAGSGPGSVAGN 201
2 -6.090[ZUD] KOG2101 Intermediate filament-like protein, sorting nexins, and related proteins containing PX (PhoX) domain(s)  ali follow..  17  1..MNYTFSTNLDNFLFLPNFSGCPFF-WGSEINFEASN---KINQLK--SKIFNKKKSKNKLENEFQFLNFQFFFVQFQKNEI-------------IQPKFQKKNATFFS--------ISVFPFIRHVFRRKKNSKKIHKNATTTQLIMMN 125
3 -5.600[R] KOG2489 Transmembrane protein  ali follow..  17  531....YSIIYVEQRGWYSWVLNML-LLMFGFITMTPQLFINYKLKSVAHLPRMLTYKFINTFIDDLFAFVIK--YRIGCFRDDIIFLIYLYQRWIYRVDPT................................................... 631
4 -5.440[D] KOG0601 Cyclin-dependent kinase WEE1  ali follow..  17  264......FKVLKRMDGCLYAVKHSTR--------YLDSERRKAMMEVQALAALGFHENIVGYYSSWYIQLESEREILVIMHQIAKALHFVHEKGIAHLD----KPDNIYIKNGVCKLGDYMPQEILNEDYEHLD-KVDIFSLGVTVYELIK. 439
5 -5.240[T] KOG3557 Epidermal growth factor receptor kinase substrate  ali follow..  16  66...KYSNSNVIMHETSQYHVQHLATFIMDKSEAISVDDAIRKLVQLSSKEKIWTQEMLLQVNDQSLRLLDESQEELEDF-----PLPTVQRSQTVLNQLRYPSVLLLVCQDSEQSKPDVHFFH---DEVEAELVHEDIESALADCRL.... 204
6 -5.190[U] COG5249 Golgi protein involved in Golgi-to-ER retrieval  ali follow..  16  43LIALFFIRILLVRGWY-IVCYTLAIYLLNLFLAFLTPKFDPSVEQAMKDEEIEEGVLPTSKDDEFRPFIRRLPEFKFWYSSMRATLFALVASFFRIFDVPVFWPILVSFFCFRRQIQHMLKYRYV.......................... 172
7 -5.160[R] KOG1699 O-acetyltransferase  ali follow..  12  167.....SILYLNRHQTEEWKFAAAEIYNAIRIFGFGNFSYYYVRKDFSVAR-FAQMMWRLNFF-VAFCCIVLNNDYMLYYICPMHTLFTLMVYGALGIFSKYNEIGSVMALKI....................................... 291
8 -5.080[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  27  1MTFSYFISIFTANLSPTFPCR--------------------KVNQLNYFYQLLNLKC---FFRSIFKIGHFPRG............................................................................. 51
9 -5.000[D] KOG0580 Serine/threonine protein kinase  ali follow..  19  103....VALKVLFKSQIEKEGVEHQLRRE--EIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEIMEELADALMYCHGKKVIHRD--IKPENLLLGLKGELKIADF................................ 219
10 -4.990[MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon)  ali follow..  16  33.IAEHIINLLKRHHITEVIATL---YLPDVLRDYFQDQMTYAVEEDQPLGTAGCVKNIAELLDETFLVISGDGEAIAFHKQILTRVPNPIEFGVVITDEALEKPSTSEIFSDTVNTGTYIVLEYLPSNTECDFSKDLFPLLLAKDEPMYG. 209

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.