current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343] (Range: 1-245), from B.fragilis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 -12.200[M] COG3209 Rhs family protein  ali follow..  10  848.LERAGTGAEGFRYDRHGNLLDGNGVVWTMEYGPFDLPVARTDGEGHRWQ--KDTLQLTEVINPQGESYLYILDNCGRVTEERDWGGVVCRYRYDADGLCTRVNGLEETILYSRDAAGRLAEVITPEGKTQYAYDKSGRLTIFSPDGTSQRTGYDERGRVNVTTQGRRAIEYHYPDEHTVIHPDGSLLKTTYRYNAAGELTVILPGDETLTFSRDEAGREVRHSNRGFACEQGWNAAGQPVSQR. 1111
2 -5.480[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  54...PETFFPTSLHIFPRSQTKGGQNDVFA--VSTSDGKINILSRNGKVENMVDA----------NGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAIKWKAHDGIILCCDWNPTSDLIVTGGEDLKFKV--DGFGQILSSVHDYPITSISWNTDGTLFAVGSHNILRLCDKSGWSHSLEKMNAGSVMALSWSPDGTQLAV.. 284
3 -5.240[J] KOG2049 Translational repressor MPT5/PUF4 and related RNA-binding proteins (Puf superfamily)  ali follow..  14  246SMVEIYGSVNLMAKDQIGCRVTFHEAKVILLAIIDHVVELSMDPFGNYIDEEQRTLIVSVLTSNPRELIRICLNTYGTRVVQK------ETVKTKQQIALVKSGLKPGFLALVKDLNGNHVIQS-TKYCAEIAIHRHGCCVLQC-----ISNSVGLQRERLVAEISRNSLHLSQDPFGNYVVQ------YLIDQQVSAVKLLVQFRMHYAELATQKFSSHVIEKCVPNFEYLLQDPYANYVIQT. 524
4 -5.220[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  18IFRENTDKINAIDFAPNGEHLISCSEDDQIVITQSRTVNSKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLYPNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKV.... 276
5 -4.980[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  10  1.MTKKLALKRRGKDSEPTNEVVASSEASENEEEEEDLLQAVKDPGEDS-------------TDDEGIDQEYHSDSSEELQFESDEEGNYLGRKQSSSAEEDEESSDEEDNEEEESTDGEEVEDEEKDSKSKQTDDKPSGSGAASKKALTAELPKRDSSKPEYQDSDTSDEEDIRNTVGNIPMH---DEYKHIGYDWDAKKIIKPPQGDQRKIEDPDFWRTVKDPLTGQDVRLTDEDIA....... 228
6 -4.970[K] KOG2478 Putative RNA polymerase II regulator  ali follow..  376.........................................................................PEEEEEEEMETEEKEAGGSDEEQEKGSSSEKEGSEDEHSGSESEREEGDRDEASDKSGSGEDESSEDEARAARDKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQRSRSHSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD................ 531
7 -4.650[G] COG2706 3-carboxymuconate cyclase  ali follow..  52VGVRPEFRVLAYRIAPDDGALTFAAESAL----PGSPTHISTDHHGRFVFVGSYNAGNVSVT-------RLQDGLPVELVDVVEGLDGCHSANITPDNRTLWVPALKQDRICLFTLSDDGHLVAQEPAEVNTVEGAGPRHMVFHPNRQYAYCVNELNSSVDVWQLKNPHGEIECVQTLDMMPADFSDTRADIHITPDGRHLYACDRTASLVFSVSEDGSVLFQPTEAQPRGFNIDNSGKYLI... 290
8 -4.530[S] COG3204 Uncharacterized protein conserved in bacteria  ali follow..  11  90........IAGITNNISSLTWSAQSNTLFSTINKPAAI-VEMTTNGDFIRTIPLDFVLETIEYIGDNQFVISDERDYAIYVISLTPNSEVKILKKIKIPLQDSPTNCGFEGLAYSRQDHTFWFFKEKNPIEVLLSSNELHISKDEALQRQFTLDDVSG--AEFNQQKNTLLVLSHESRALQEVTLVGEVIGEMSLTKGSRGLSHNIKQAEGVAMDASGNIYIVSEPNRFYRFTPQ.......... 320
9 -4.440[S] COG5291 Predicted membrane protein  ali follow..  239.................................................................................................GYSNASTTSGDSMASLTDMADTKSSTENSAVTEESQCCAESFKDSSVVSSQKSMAVSTVVGSSTEAKNNYLDFTEALCDKEVVAEQNPESQSNEEWDEKWGDSDNESECS...................................... 348
10 -4.240[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  13ILKGHEGAVLAARFNGDGNYALTCGKDRTIRL-HRGILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRRKFRGHDGEVNAVKFNDSSSVVVSAGFDRSLRVWDCRSHSVVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMSDNLGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELLQVISKSFKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLSK.. 265

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.