current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683425|ref|YP_213569.1| 30S ribosomal protein S14 (BF3990) [Bacteroides fragilis NCTC 9343] (Range: 1-99), from B.fragilis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MAKESMKAREIKRAKLVAKYAEKRAALKQIVRTGDPAEAFEAAQKLQELPKNSNPIRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASWLast
1 -64.000[J] COG0199 Ribosomal protein S14  ali follow..  55  1MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 101
2 -56.200[J] KOG1741 Mitochondrial/chloroplast ribosomal protein S14/S29  ali follow..  25  1......MIRDVKRRKCVKENAVERLRVNSLRKNDILPPREVADAEIAAFPRDSSLVRVRERCALTSRPRGVVHKYRLSRIVWRHLACYRLLWEEVNTNF 95
3 -6.190[H] KOG1506 S-adenosylmethionine synthetase  ali follow..  16  273........KDPTKVDRSAAYAARWVAKSLVKAGLCRRCLVQVSYAIGVAKPLSVMVFSFGTSALSERPGKIIKNLDLKRPIYEPTAENGHF-GHNNFPW 375
4 -5.530[S] KOG2637 Uncharacterized conserved protein  ali follow..  13  417PRSKNESKEDKRRKQAIKEERKERRVEKKANKLAFKLEKRRQEKELLNLKKNVEGLKL......................................... 475
5 -5.490[A] KOG3026 Splicing factor SPF30  ali follow..  12  225.KKIHAFKSKARFEQLEVVQNKKQNDWQQFQTTKAKTKKVGFFTGRKKESIFKSPEDPFGKVGVTGSGKGLTDFQKREKHLHLK............... 307
6 -5.440[H] COG0192 S-adenosylmethionine synthetase  ali follow..  16  266........KDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPARPYGLIQMLDLLHPIYKETAAYGHF-GRENFPW 368
7 -5.260[S] COG3084 Uncharacterized protein conserved in bacteria  ali follow..  17  1..........................MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSAKDAVIPGLQK... 70
8 -5.220[I] KOG1325 Lysophospholipase  ali follow..  11  81LRPASEGLNEGEQSYINKRISKVNSELRSFISKTGLNVDLDKVVNSSDGPRLG--------AFSGGGLRAMVNGGGFDSRFESDSPLSGLLSGLSGGSW 182
9 -4.850[J] COG0293 23S rRNA methylase  ali follow..  16  697.IKKVLEAQGRKKMRTIKRLQRVAKKAEGISESGDMTESEKAK-EISRLVSRATKSKPKAKPTLKSRPKGVKGKYKMVDSRMKK............... 788
10 -4.850[AR] KOG1098 Putative SAM-dependent rRNA methyltransferase SPB1  ali follow..  16  697.IKKVLEAQGRKKMRTIKRLQRVAKKAEGISESGDMTESEKAK-EISRLVSRATKSKPKAKPTLKSRPKGVKGKYKMVDSRMKK............... 788

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.