current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680681|ref|YP_210825.1| hypothetical protein (BF1156) [Bacteroides fragilis NCTC 9343] (Range: 1-221), from B.fragilis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MKPTIKKVQPVKVVAPFLNSQSESPVPLDALTDQEKVSDLYFLKGTVHQIAKPYLSINNCTFKQQIFSECQFKSAQLTDVRFENCDLSNVSFAGTTFYRVEFISCKLLGTGFLEATLNHVLMDHCYGQYINLSMVKMRTARFSHCNFRNGSLNDSKLMPAAFDTCELLEADFSHTSLKGIDLRNSRIAGIQLNIADLKGAIVSSLQAIDLLPLLGVKIEDDLast
1 -51.400IDP01014 gene: pipB2; secreted effector protein STM2780 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  140..PQDSVILTAQGGMNLKGAVLTGANLTSENLCDADLSGANLEGAVLFMADCEGANFKGANLSGTSLGDSNFKNACLEDSIMCGATLDHANLTGANLQHASLLGCSMIECNCSGANMDHTNLSGATLIRADMSGATLQGATIMAAIMEGAVLTRANLRKASFISTNLDGADLAEANLNNTCFKDCTLTDLRTEDATMSTSTQTLFNE.............. 344
2 -49.400IDP04710 hypothetical protein [Yersinia pestis CO92] YPO0510 [Yersinia pestis CO92]  ali follow..  16  118..TSCQLDDAQLQDIQLNYWTVQDTPMTHLTMSDSKMQDSSWHGCTIQQSVWKNSELIRQVMGSCVLKECQYQAIQSDTVVWSQCQLEQVDFRHQPLENSNFHKSTLTQCGFSDANLAAALFSEATLEGCDFNMAQLAAAQFVDATLRDCNFDTADLQNASLLRANLTRCHLTQVNLTKADLRSCMLSESSLQASKLSKTRIHGAQIPTL........... 325
3 -47.800IDP04356 hypothetical protein [Yersinia pestis CO92] YPO0509 [Yersinia pestis CO92]  ali follow..  15  290..KQAEWQKAAFTHCKWEKSTFEYGVFKHAQFTDNALDNCLINHSDFSLGTFDHCTLNGCFFSETHCDQTQFNQVIITSCIFEKCDGPKACFTESTIEKTSFISSSWVGGRLSNTNLSESHFEQCSLNKMGFLKVNLQSSTFINCSMLESCCDKADFSQATLIACDMTAVRLKDANLVHSHWQNTSLQQSMFYNADLRDATFQRCNLAG-ANLAMISQNMD 518
4 -45.700IDP91553 gene: ECs5048; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38471 [Escherichia coli O157:H7 str. Sakai]  ali follow..  16  175..QNAIFQDCNMYKTNFNFAIMEKILFDNCILDDSYFAQIKMTDGTLNSCSAMHVQFYNATMNRANIKNTFLDYSNFYMAYMAEVNLYKVIAPYINLFRADLSFSKLDLINFKHADLSRVNLNKAILQNINLIDSKLFFTRLTNTFLEMVICTDSNMANVNFNNANLNNCHFNCSVLTKAWMFNTRLYRVNFDEASVQGMGISILRGEE............ 381
5 -44.500IDP91554 gene: ECs5021; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38444 [Escherichia coli O157:H7 str. Sakai]  ali follow..  11  6..SKFDGNNSLIKHGVVQGNNIVDFDLLRNFNGGPGLNRENF--IYISNIFLNIKQRNEKNHSINMFREVSISGDIVSVKFYRNEKIECADLSELDLTSCHFKGDVISKVSFISSNLQHVTFECKEIGDCNFTTAIVDNVIFKCRRLHNVIFIKASGDYVDFSKNILDTVDFSQSQLTHSNFCECQIRNSNFDHCYLYASHFTRAEFLTDSNLTAVMFDH. 241
6 -30.700IDP91562 gene: ECs0876; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34299 [Escherichia coli O157:H7 str. Sakai]  ali follow..  4..SKCNGYATMLLNMVQGSDPVNLLELHGFLEHFAYYVSFGKFNAGHQRYNAFKKFVSEISEISANDINMTIKTGQSRHENVISINMNDARDEKGITVRIDNINGKKNNSNSSDVFIPYVNTFPDLKNKILRMKIELTEGSGFSKSLSDSQIEMHILRTVNSVGEKLNDDNLADHSIFTNEFSVIIPPSYYDATSAVNANNIVREKLFESDSKVKDIVDD. 225
7 -29.000IDP91599 gene: ECs0061; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB33484 [Escherichia coli O157:H7 str. Sakai]  ali follow..  1.................MKVSVPGMPATLLNMSNNDIYKM----VSGDKMDMKMNIFQRLWETLRHLFWSDKQTEAYKLLNFVNKKAGNINASKYFTGAVNTFGDIELSVTFFIENKEICTQTLQLHKGPGNLGVDLREAYLPGVDMRDCYLGLKTMHNKVLYLEPGWNANLDGATLDGATLDGATVDGATHLYDEVIIINKITPKKIDTEEV........ 233
8 -28.000IDP91561 gene: ECs0472; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB33895 [Escherichia coli O157:H7 str. Sakai]  ali follow..  11  139..MIRGTISIVNEVVKTYSLPIEKDDNGYYDFSGLYLAHSNISGKDPNGIDMGNCNCSNVNFEHTYFYGVKFTNANCTNANFNNCRFKKCDLTNMNCTGAILDNAMIYGKRITYQKSDGNETKGMILTNCSCVKTTFNWADLSESDCQNVDFSEANLSNTILPDVRMKGTKLYRTDLFNPILKTEAESTEEKDISPLAKIILDYIES---KNPESLNFEEK 379
9 -24.800IDP91558 gene: ECs4653; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38076 [Escherichia coli O157:H7 str. Sakai]  ali follow..  11  180..YSVKLATLIKNKIPIINTTINLSSLSKNSLKYCSFKNVIFSGV-INSPNLEGPVFENCYFDDCKFNNIQLYETNDDTVESGNKKPIKGMFKGCFISKCKIENYRCETSKIYTVTQPD--SIQEKLGSYLFMQSFVQDCIIQGGCCPGSSILLSHFYNCNIIGLDAHGMDFLANSFNKSNYDEIRGPGTVFYNCNLKHIKINDGLREDGSDRTMFNPKE. 399
10 -18.700IDP91552 gene: ECs5295; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38718 [Escherichia coli O157:H7 str. Sakai]  ali follow..  10  391..EGLNLAEMDLTDIDLSKMALRNVNFNGSILRNAKFSGTICEGVDFTDCDLRNAEFENASLENNDFRKVHLTYVNFKNANLRNSNFNGKVLTGVTFTGSDLSNAYLEHIDFTTVILPKVILTGAILNYSDLSGKDLSEYNLTGILCMYTNFSNANLTNCKISNANFSNAKFYNTNCTGANCSNILFDYAWFDNTIFIKTLFKNTCFYNVVYLEGAYLNN. 631
11 -18.200IDP91560 gene: ECs0073; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB33496 [Escherichia coli O157:H7 str. Sakai]  ali follow..  11  110.............................................................................................................AKDPENMAAKASLSPEGTLCVSFFIGDEAIFTLELQLKKSTRTGGIDLSNAYFNGVVICGIDCLEVDLSNAETNNSRWYD................................ 189
12 -17.500IDP91556 gene: ECs4657; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38080 [Escherichia coli O157:H7 str. Sakai]  ali follow..  13  155..DNEKLSVYLKNKIPFENMIIDLSALKKDVLVS--LKQCCFKKMTFTG-NISYENLNGPVFENCFFEECNFESVSLVGFDKVTCESNNKIPIYGMFKGCFLYQCEMKNFKIETSKIYSINQDPQRGDKK-VGAYLFMQSFVYASNLQDGVCKEASVIASSLLSCNIAKLNGVGMDFIETSFYGKTRGGFNFYDCDFRYVNMT.................. 364
13 -13.600IDP91618 gene: ECs2674; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36097 [Escherichia coli O157:H7 str. Sakai]  ali follow..  175..................................LHSNELDLSYLFLGSVPPLPDWIEMLSLVYNELDSIQVPE-SCKELELDFNNLTEFPQVPDGITLISVNNNLISHIDSFPPKAKKIFISHNKLSETPAIPDTAKVFDCGYNKIQEIRYFPKNLKEARIGYNNIEVVPAIPGNLKILFMECNPIKEAFLMPWTLTGICYEISQRKYIVTN........ 352
14 -13.600IDP91619 gene: ECs2672; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36095 [Escherichia coli O157:H7 str. Sakai]  ali follow..  176...................................HSNELNLSSLSLGSVPPLPEWIEMLSLVYNELDSIQVPE-SCKELELDFNNLTEFPQVPDGITLISVNNNLISYIDSFPPKAKKIFICHNKLSEIPALPDTAKVFDCSENNIKEIRWFPKNLKEAYIEYNKIEVIPAIPGNLKLLCMKCNPIKEAFLMPWTLTGIRYEISQRKYIVMN........ 352
15 -10.900IDP02440 hypothetical protein lmo0331 [Listeria monocytogenes EGD-e] lmo0331 [Listeria monocytogenes EGD-e]  ali follow..  14  124..................................TGLEVLNLEDNQLKSIDVSKLNLKELTCSNNPLANLDVSKLALEELTCENNELTQLDVSQTALEYLYCPRNQLTKLDVSKSALRYLACDVNQLTNLDVSKPALTNLGCTKNQLTDLDVSQPNLGTLVCSDNQLTNLDVSQQALENLACDNNELKNIDINQLSLKELSCENNQLTNL........... 307
16 -10.800IDP91566 gene: ECs1568; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34991 [Escherichia coli O157:H7 str. Sakai]  ali follow..  12  38.......................................................ASGRLYIKDCDIEYLPQLPNEITSVTIENCNLTTLTGLPVNTQNLSVINCEKLQITDMPSTVKNLHIELTDSPFIHFISEGIECLTVCHCYISGV----ESVRYLEIKGSATDSIKNVPNGLSSLSINSYNARIDNLISPSLKTLSLTGCSNIILPEKLPESVTS. 204
17 -10.500IDP91625 gene: ECs2073; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB35496 [Escherichia coli O157:H7 str. Sakai]  ali follow..  11  41..................................GEIHRPECRNEAAKRINCAFLKQNDIDLSGLNLSTQPPGLQNFTSINLDNNQLTHFDATNDRLVKLSLNSNTLESINIHNVSITHISMNNNCLRNIDIDRSSITYFSAAHNKLEFVQLESEWLQYLNLSHNQLTDIVTGNEELLLLDLSHNKLASLHNALPNLNTLLINNNLLSEIKMFYS...... 230
18 -9.880IDP01745 hypothetical protein lmo2821 [Listeria monocytogenes EGD-e] lmo2821 [Listeria monocytogenes EGD-e]  ali follow..  10  91................................QLATLTSLDCHNSSITDMT-KLTGLTKLICTSNNITTLDLSQTNLTYLACDSNKLTNLDVTPTKLTYLNCDTNKLTKLDVSQPLLTYLNCARNTLTEIDVSNKKITKLDVTPTQLTTLDCSFNKITELDVSQKLLNRLNCDTNNITKLDLNQIQLTFLDCSSNKLTEIDVTPLTQLTYFDCSVNPLTE. 298

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.