current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343] (Range: 1-245), from B.fragilis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 -20.000IDP05456 putative wall-associated protein [Bacillus anthracis str. Ames] BA_1094 [Bacillus anthracis str. Ames]  ali follow..  12 1511.TYDEEGQKNTFTYDASGNKKSEKGNTKLYDYNKDNLLNYRYDHNGNTTEEYDVDNKNTVYIDALNRRIENTYDENANKIKTKMPNGSILESVYDTADRVVEKRNGKDSFTFERDQNGQVTKVKDNGVERTKTYDKADRVTATDSRGGKIDWAYHDKANTVTQGGYTNKVSYDYNTLDQNIRVTDGSQTYRFDYDDQGNVRYTAGNGSGSTFNYDQANKIKTSNSILLSERYEYDQSGNRTKIK. 1800
2 -10.600IDP93832 gene: tccC; putative insecticidal toxin complex protein [Yersinia enterocolitica W22703] CAI77380 [Yersinia enterocolitica W22703]  ali follow..  205.RLRRESFVTRCTTDVLGQQTDAKGHTQRMAYNRAGQLSLDYSAAGQKLREESGNXVVTEYRYEAETQRLIGIKTTRPAIKERPTLLQDLRYDYDPVGNILAIHNDAEATTYRYDALYQLTATGRESDSNRAQNASLPALSSLTDGNQTRRYSYDRAGNLLXSGASQYSTNITISNISNHGIQQQDGADIRCQFDAAGNQQQLQPGQPLQWDARHQLQQVTENTPNDDYEHYLYASDGMRVVX.. 495
3 -10.300IDP00513 putative insecticidal toxin YPO3674 [Yersinia pestis CO92]  ali follow..  10  276.RLSEQPFVSHSTTDALGQLLTAKGHIQRMAYNRAGQLSLTYSAAGQKLREESGNGVITEYRYEPQTQRLIGIKTTRPAKKDRPTRLQDLRYDYDPVGNILAIHNDAEATTYRYDALYQLIEATGREADTNGIQNSQLPALASLNDSNQRSYHYDRAGNLLKTGASQYSTHITVSDSSNHGIQQQEGIDIRSQFDAAGNQQQLQPGQPLRWNSRNQLQQVE-NDGISDSESYLYDGGGSRVVK.. 563
4 -6.860IDP91918 surface protein PspA, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100009348 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  122YLNANGSMATGWLQNNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWLQNNGSWYYLNANGSMAT-GWLQNNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWLQNNGSWYYLNANGSMATGWLQNNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWLQNNGSWYYLNANGSMATGWLQNNGSWYYLNANGSMATGWLQNNGSWYYLNANGAMATGWAKVNGS...... 359
5 -6.380IDP01817 gene: csgB; curlin minor subunit [Salmonella typhimurium LT2] STM1143 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  27........................................................................................................................ARSEYNFAVNELSKSSFNQAAIIGQVGTDNSARVRQEGSVISQEGGNNRAKVDQAGNYNFAYIEQTGNANDASISQSAYAIIQKGSGNKANITQYGTQKTAVVVQKQSHMAIR............ 147
6 -6.130IDP01997 putative inner membrane protein [Salmonella typhimurium LT2] STM4310 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  101WLTTEGQLVGRMPLDPESIAWSGGNQFQIGSEKDGAVYKTQVDIQRGTMQIISMVKLEGYDKAKNKGLEGTAWDAKNERLYAAKERKPIMIKEVEMSKNGITRALPSAITASVSDVSG--LEYHAPTDSLLVLSDESKMILEVSSEWRVRDRLFLTAEWSGLRDDIPQPEGIAMDNENNLYIVSEPNLFYKFSCDIQND.............................................. 301
7 -5.830IDP05359 putative lipoprotein [Bacillus anthracis str. Ames] BA_1311 [Bacillus anthracis str. Ames]  ali follow..  47..KQTKKLITTWELNMAGTLLLPNGEDILVYGKQLEYMYVYSLVEGRQVEKYKTGKGIVNVIVSEDKKQLFAADQTAQKVRFFTIKG--KETGNVSTGKGPITMVEYDNQLSVLNFYDTKLTTIDTKKKEVIQSSPDGKEIWIGGHGDGNQVNESLQSGEMVRSLHAPFMPVNITKDNKYVYALSHGSNTLRKFDVSTYKEVASVEVGSNPFAFLKSGAEGYVASYDSDEVCVMDMKNLKIKQTI 306
8 -5.420IDP04356 hypothetical protein [Yersinia pestis CO92] YPO0509 [Yersinia pestis CO92]  ali follow..  225.............................................................................TNVTFLGTDFSGMTLDNKQFRYCMFTGCHFDKATFKDCTFEHCQFTQSDFENSRWNNVHLSGCLFKQAEWQKAAFTHCKWEKSTFEYGVFKHAQFTDNALDNCLINHSDFSLGTFDHCTLNGCFFSETHCDQTQFNQVIITSCIFEKCDGPKACFTESTIEKTSFIS. 391
9 -5.090IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1814.............................................................TESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTP--QIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDLAGRT..... 1990
10 -4.740IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  10  2...........................................KKGNRKALLISLIMILSMVVSTIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENEDYGFVVKINNNTIETESMKKISFNL 203

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.