current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681337|ref|YP_211481.1| hypothetical protein (BF1846) [Bacteroides fragilis NCTC 9343] (Range: 1-71), from B.fragilis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst MFDNYAALSYNERENDFINIIIIYNTASYFISHLKMFLSFFIFRNKEKVYECNTLINNTLLNIDSETLSETLast
1 -5.650IDP05644 gene: bclA2; exosporium glycoprotein [Clostridium difficile 630] CD3230 [Peptoclostridium difficile 630]  ali follow..  508..KAVNTLTSSDVSVSLSFLVDARAAAVTLSFTFGSGTTGTSAAGYVSVYRIQ.................. 558
2 -4.940IDP91283 single-stranded DNA-binding protein [Bacillus anthracis str. Sterne] NT05BA5557 [Bacillus anthracis str. Sterne]  ali follow..  25  41..........GEREADFINCVIWRKQAENVANYLKKGSLAGV-RLQTRNYEGQDGKRVYVTEVLAESVQ.. 100
3 -4.770IDP06427 gene: B21R; B21R [Monkeypox virus Zaire-96-I-16] NP_536609 [Monkeypox virus Zaire-96-I-16]  ali follow..  21 1788MFKEFDK-NYLNSSPDIYHIIYIIGGTILLLLVIILILAIYIARNKYRTRKYEIMKYDNMSIKSDETVS.. 1871
4 -4.490IDP01687 hypothetical protein Cj0740 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0740 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  33  22.............NNNFSNIYVYHNLENGYIDEGQNFLSL............................... 48
5 -4.400IDP06063 7-cyano-7-deazaguanine reductase [Helicobacter pylori J99] NP_224026 [Helicobacter pylori J99]  ali follow..  20  44..KEFTSLCPITSQPDFGVIFIRYIPKDKMVESKSLKLYLFSYRNHGSFHEINTILLDLVQLLEPKYLE.. 112
6 -4.320IDP92066 gene: GAPDH2; apicoplast glyceraldehyde-3-phosphate dehydrogenase 2 [Toxoplasma gondii] ABO93620 [Toxoplasma gondii]  ali follow..  23  1.......MSLYPRSSVRLRTRGLFFSSSLPLSHC-LFLALFLFLSFDNFLPTSRSLNSAALRLDPETFSSS 77
7 -4.170IDP06261 7-cyano-7-deazaguanine reductase [Streptococcus pneumoniae TIGR4] NP_346210 [Streptococcus pneumoniae TIGR4]  ali follow..  22  40...DMSLLGQITAQPDFATIHISYIPDKLCVESKSLKLYLFSYRNHGDFHEINTIGKDLVNLLDPRYLE.. 107
8 -4.080IDP90321 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_795 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  20  43VFYSYAEGLEHARDEGKLTLVVLLDTSGYSFETL..................................... 76
9 -4.050IDP90534 gene: ssb; single-strand DNA-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1071 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  35..RRFTANGEKREETCFIDISFYGRTAEVANQYLTKGSKVLI-RLRFEQWSDQNGQNRSKHSIQVENME.. 102
10 -4.030IDP00329 7-cyano-7-deazaguanine reductase Cj1724c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  35...EFMCCCPRSGYPDFATIYLEYMPDKFVVELKAIKLYINTFMYRNVSHEINEIYNTLKDKLKPKWIK.. 102

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.