current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682225|ref|YP_212369.1| putative two component system response regulator (BF2753) [Bacteroides fragilis NCTC 9343] (Range: 1-225), from B.fragilis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKILIIEDEPSLRELIQRSLEKERYVVEAAADFQSGLRKIEDYDYDCVLLDIMLPDGNGLNLLEQLKKMRKRENVIIISAKDSLDDKVLGLELGADDYLPKPFHLAELNARIKSVIRRQRRDGEMDIRLANIRIVPDTFQVFVDDKEIELNRKEYDILLYFANRPGRLVNKNTLAESVWGDHIDQVDNFDFIYAQIKNLRKKLKDAGALAELKAVYGFGYKMTVELast
1 -94.900IDP95294 response regulator protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] YP_494943 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  28  2VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKND-YDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWG--YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENH 223
2 -94.000IDP01662 hypothetical protein lmo2583 [Listeria monocytogenes EGD-e] lmo2583 [Listeria monocytogenes EGD-e]  ali follow..  28  3.QILVVDDDRHILKLVGHYLRAEGFHVLEASDGVEAEKIVETEQVHLAVIDVMMPNMDGFELCQKMRASYPDIPVIMLTAKDALADKSRGFEVGTDDYVTKPFEPEELIFRIRALLRRSNQASEVKINIGNITIDQKSYGIKIGNQERMIPVKEFELLYQLASYPGRIFTREELIERIWQ--RDYDGSDRTVDVHIKRLRDHFDEEKDGIRIVTVRGVGYKLEET 224
3 -92.200IDP91359 response regulator [Vibrio vulnificus CMCP6] VV1_2847 [Vibrio vulnificus CMCP6]  ali follow..  32  1MKILVVEDDPRLGEQIIESLEKTGWVPELSQDGIDALYRATSEEWDAIVLDLGLPKLDGLTVLKGIRDENINTPVVILSARDTLTQRVEGLNAGADDYLTKPFEMVELIARIRAQLRRASGNASPVMQIGDLSLDTRTSKVMWQGQAVSLTALEYKVVAYFVHNADKVISRTELVEHIYKQDFD--RDSNTIEVFIGRIRKKIA----PNIIKTVRGLGYQLNAN 219
4 -92.100IDP91441 response regulator [Vibrio vulnificus CMCP6] VV1_0468 [Vibrio vulnificus CMCP6]  ali follow..  33  4.RILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLAEPFPDLVLLDWMLPGGSGINFIKHMKREERNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIRRVTPTAEDVIDVQGLKLDPVSHRVTANDAPVDMGPTEFKMLHFFMTHQERVYSREQLLNNVWG--TNVYVEDRTVDVHIRRLRKALEDAGHDKLIQTVRGAGYRFSTK 228
5 -92.100IDP02231 gene: lisR; two-component response regulator [Listeria monocytogenes EGD-e] lmo1377 [Listeria monocytogenes EGD-e]  ali follow..  30  3.RILIVEDEKNLARFIELELQHENYETAVANDGRAGLELALNEEWDAILLDLMLPHLNGVEVCRRVRQVK-QTPIIMITARDSVIDRVSGLDHGADDYIVKPFAIEELLARLRSLLRREQSAKQTTLQYRNLIVEKENRIVKRDEEIIDLTKREYELLLTLMENVNIVLTREVLLNKVWG--YETEVETNVVDVYVRYLRNKIDHPDEESYIQTVRGTGYVMRT. 226
6 -91.600IDP95461 DNA-binding response regulator [Bacillus anthracis str. Sterne] YP_028080 [Bacillus anthracis str. Sterne]  ali follow..  32  33.NILIVDDDPHIRELVSVFLECEGFQTYEAIDGLDALQKINQVKVDMVILDIMMPNMDGFDVCFELRKY-YDIPILILTAKGETSQKVKGFHLGTDDYLVKPFDPIELVVRVKALLKRYQITVSQSIQVGTVLLNRKTFEVTIGEQTVTLPLKEFELLFTLGSKAGRTCSREQLIEDVWG--YDFEGNERTLDVHINRLREKFQEEKSKFSIKTIRGLGYRLEVS 253
7 -90.100IDP91279 DNA-binding response regulator [Bacillus anthracis str. Sterne] NT05BA4913 [Bacillus anthracis str. Sterne]  ali follow..  26  3.KILIVEDDPNISSLLQSHIQKYGYEAVVAENFDDIMESFNAVKPHLVLLDVNLPKFDGFYWCRQIRHE-STCPIIFISARAGEMEQIMAIESGADDYITKPFHYDVVMAKIKGQLRRAPNISERIVEVEGLKLFPERPEIHFGSEQVLLTKKEAILAEMLLSKFPRTASREDLLAALWDD--ESFVEENTLNVNITRLRKKFNELGIENAIETVRGLGYRFNAT 228
8 -89.800IDP00057 lantibiotic biosynthesis DNA-binding response regulator, putative BA_3900 [Bacillus anthracis str. Ames]  ali follow..  31  3.RILAIDDEDGILYIIKSALEKEGHEVTAVSNP-LTIPKEKFCHYDLILLDVMMPEIDGFTLCKEIRDF-VDSPIVFLTAKTMEKDLITGLSLGGDDYITKPFGIGELRARVSAHVRREHREKQNAFFLSGLTFHLSCKEIWYDDTSIAFTKSEYGICEYLALNHGQVFSREKIYENVFG--YEGESDNQVIVEHIKNIRHKLSKYGM-NPIETVWGIGYKWRK. 220
9 -89.800IDP90005 gene: qseB; quorum sensing Escherichia coli regulator B [Escherichia coli O157:H7 EDL933] Z4377 [Escherichia coli O157:H7 str. EDL933]  ali follow..  29  1MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTARDALEERVXGLRLGADDYLCKPFALIEVAARLEALMRRTNGQASNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLELLMRNAGRVLPRKLIEEKLYT--WDEEVTSNAVEVHVHHLRRKLGS----DFIRTVHGIGYTLGEK 219
10 -89.200IDP95471 hypothetical protein [Listeria monocytogenes 10403S] YP_005962623 [Listeria monocytogenes 10403S]  ali follow..  33  1MKLLMIEDNVSVCEMIEMFFMKEEINATFVHDGKMGYEAFFKDDYDIAIIDLMLPNMDGMTICRKIREVS-DVPIIILTAKESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNENNEDILETTYFKISKRTREIFYQDELLDLTPKEFDLLYFLMQHPRQVFSREQLLEQVWG--YQFYGDERTVDVHIKRLRQKIAT-ETKPFLHTVWGVGYKFDET 227
11 -89.100IDP91043 gene: vanRG; response regulator [Enterococcus faecalis] EFE0003 [Enterococcus faecalis]  ali follow..  31  4.KILIVDDEKEIADLIELYLKNDGYKVYKFYNGIDALKCVESEKMDLAILDVMLPDVDGFHICQKIRER-YFYPIIMLTAKVEDADKIMGLTIGADDYITKPFNPLEVAARVKTQLRRKENVLVTEYDINGLVINKNTHKCTLYGKAVTLTPIEFSVLWYLCENRGKVISSEELFENVWG--EKFLDNNNTVMAHIGRLREKLKPARNPKFIKTVWGVGYTIEE. 235
12 -88.800IDP02446 hypothetical protein lmo0287 [Listeria monocytogenes EGD-e] lmo0287 [Listeria monocytogenes EGD-e]  ali follow..  33  5.KILVVDDEKPIADIVKFNLNKEGFDVYCAYDGDEALELVEEVQPDLILLDIMLPGRDGIEVCREVRKKY-DMPIIMVTAKDSEIDKVIGLELGADDYVTKPFSNRELIARVKANLRRHSEEENSELEIGSLIIHPDAYVASKRGETIELTHREFELLHYLAKHMGQVMTREHLLQTVWG--YDYFGDVRTVDVTVRRLREKIENPSHPAWLVTRRGVGYYLRNP 234
13 -88.400IDP01942 hypothetical protein lmo1745 [Listeria monocytogenes EGD-e] lmo1745 [Listeria monocytogenes EGD-e]  ali follow..  25  2VKVYIVEDDEVIRDTIRKHLSKWGFEIGVVEDFNNILQEFLAFEPQLVILDVNLPFFDGFYWCNQIREV-SNVPIIFLSSRNSRMDQIMGMNMGADYYIEKPVDLDVLMARINALLRRADLEEANVMEHNNVFLHIDTNTLTHLEDKIELTKNEFLILYELMKQKGSIVSRDEIMRALWE--DESFVDDNTLTVNVVRIRKKLAEIGLSEFIKTKKGQGYMIE.. 225
14 -87.900IDP04024 DNA-binding response regulator YycF [Bacillus anthracis str. Sterne] BAS5319 [Bacillus anthracis str. Sterne]  ali follow..  33  5.KILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKATEEQPDMVLLDIMLPGKDGLEVCREIRKSS-EMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQKEENTEMVIGPIVINPNAYSVTKREENIELTHREFELLHYLAKHLGQVMTREHLLQTVWG--YDYFGDVRTVDVTVRRLREKIENPSHPTLIVTRRGVGYYLRDP 232
15 -86.700IDP91047 gene: vanRD; response regulator [Enterococcus faecium] EFA0003 [Enterococcus faecium]  ali follow..  31  4.KILVVDDEKELADLVEVYLKNDGYTVYKFYNGKDALKCIESVELDLAILDIMLPDVDGFQICQKIREK-FYFPVIMLTAKVEDGDKIMGLS-VADDYITKPFNPLEVVARVKAQLRQKQEAECTEYDIRGMTISKSSHKCILFGKEIQLTPTEFSILWYLCERQGTVVSTEELFEAVWG--ERFFDSNNTVMAHIGRLREKMKPSRNPKFIKTVWGVGYTIEK. 232
16 -85.000IDP91042 AdeR [Acinetobacter baumannii] ACB0002 [Acinetobacter baumannii]  ali follow..  28  14.VILVVEDDYDIGDIIENYLKREGMSVIRAMNGKQAIELHASQPIDLILLDIKLPELNGWEVLNKIRQKA-QTPVIMLTALDQDIDKVMALRIGADDFVVKPFNPNEVIARVQAVLRRTQKATNKNKIYKNIEIDTDTHSVYIHSENLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMN---DSDALERTVDSHVSKLRKKLEEQGIFQMLVNVRGVGYRLDNP 240
17 -83.900IDP92626 gene: cpxR; DNA-binding response regulator in two-component regulatory system with CpxA [Escherichia coli str. K-12 substr. MG1655] b3912 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  34  3.KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDD-SIDLLLLDVMMPKKNGIDTLKALRQT-HQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHDNGSPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLT--PFDRAIDMHISNLRRKLPDKDGHPWFKTLRGRGYLMVSA 231
18 -56.700IDP04262 gene: spo0A; Spo0A protein [Clostridium perfringens ATCC 13124] CPF_2067 [Clostridium perfringens ATCC 13124]  ali follow..  19  6ISVLIADDNKEFCNILNDYLLSQRDITGIAKDGLEALKLIEEKQPDLVVLDIIMPHLDGLGVLERINSLGKTPRVIVLSAVGQDKITQRAITLGADYYVVKPFDMDVFTERIRQMFNSTISEESEDSSSDDNKEPMDLEVEITSIIHEIGVPAHIKGYMYLREAITMVVNDMELLSAITKELYPSIA--KKYNTTASRVERAIRHA-----IEVAWGRGQIDAIN 242
19 -49.300IDP01029 gene: cheY; chemotaxis regulator transmitting signal to flagellar motor component STM1916 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  6LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 128
20 -40.500IDP01814 gene: hnr; response regulator of RpoS [Salmonella typhimurium LT2] STM1753 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  28  8KQILIVEDEPVFRSLLDSWFSSLGATTALAGDGVDALELMGRFTPDLMICDIAMPRMNGLKLVENLRNRGDQTPILVISATENMADIAKALRLGVEDVLLKPVDLNRLRETVFACLYPNMFNSR..................................................................................................... 132
21 -38.400IDP91348 response regulator [Vibrio vulnificus CMCP6] VV1_3127 [Vibrio vulnificus CMCP6]  ali follow..  24  9.EILVVDDTVDNVKLLSQLLQNEGYLVKGALSAKSALRMCQKKKPDLILLDIMMPEVDGYELCRQLKKDPQDIPVIFLSALDHVQDKVRAFQIGGVDYIQKPFEVMEVLARVRTHAGLVTLQRALIEQNEQLKRMATTDMAGKVSGNFALILFDIDVLVRIAEITRRVIGQHGYCARWGGEEF-PNFDAKRAYDLAACIQDEFNE.................... 246
22 -38.200IDP90946 gene: bvgA; virulence factors transcription regulator [Bordetella pertussis Tohama I] BP1878 [Bordetella pertussis Tohama I]  ali follow..  19  3NKVLIIDDHPVLRFAVRVLMEKEGFEVIETDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVIARLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCKHENLHEVINAAKAVMAGYTYFPSTTLS----EMRMGDNAKSDSTLISVLSNRELTVLQLLAQG----MSNKDIADSM---------SNKTVSTYKTRLLQKLNATSLVELIDLAKRNN...... 207
23 -37.700IDP93893 regulatory protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005758 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  18  2................................................................................................................................SSSVVLDKLKNVLMINNEAHALSKNEVLLLEYLYLRGGEVIPRDELISHCWPDRV---VSAVSLPVAIKHIRDVLRKATLNEVIKTHKSVGYSLQKD 95
24 -37.300IDP00102 gene: evgA; putative positive transcription regulator (sensor EvgS) NT01SF2944 [Shigella flexneri 2a str. 2457T]  ali follow..  20  1MNAIIIDDHPLAIAAIRNLLIKNDIEILELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNR-------FVGSLTSDQQKLDSLSKQEISVMRYILDG----KDNNDIAEKM---------SNKTVSTYKSRLMEKLECKSLMDLYTFAQRNK...... 202
25 -36.600IDP02322 gene: cheY; chemotaxis response regulator CheY [Listeria monocytogenes EGD-e] lmo0691 [Listeria monocytogenes EGD-e]  ali follow..  25  2LKLLIVDDAMFMRTMIKNIVKDSDFEVVEAENGLEAVKKYDEVKPDIVTLDITMPEMDGLEALAQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKPFQADRVLEALEKAAK............................................................................................................ 119
26 -35.800IDP92614 gene: vraR; DNA-binding response regulator [Staphylococcus aureus subsp. aureus USA300_FPR3757] SAUSA300_1865 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  17  3IKVLFVDDHEMVRIGISSYLSTQS-VVGEGASGKEAIAKAHELKPDLILMDLLMDDMDGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSR------GESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKG----YSNQEIASASH--------TIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNL..... 207
27 -35.400IDP95113 two-component response regulator [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001333743 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  18  6VDVLIIEDESELARLHAELVQKHP-LAGMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEKTLQGLFSDREAHCFSVDEVVSAA---------SKTTARRYLEHGVET....................... 206
28 -34.400IDP00850 transcriptional regulatory protein DegU, putative SACOL2389 [Staphylococcus aureus subsp. aureus COL]  ali follow..  19  1MKIVIADDHAVVRTGFSMILNYQN-VVATAADGVEAYQKVMEYKPDVLLMDLSMPGESGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKG----YGNKEIAEKLF--------SVKTVEAHKTHIMTKLGLKSKPELVEYALKKK...... 213
29 -31.800IDP00997 putative chemotaxis signal transduction protein STM2314 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  19  188.VAIVAEDSKVARAMLEKGLNAMGIPHQMHVTGKDAWERIQQEKIALVLTDLEMPEMDGFTLTRKIKTDEKKIPVVIHSSLSGSANEDHIRKVKADGYVAKF-EINELSSVIQEVLERAATNSQGPL.................................................................................................. 327
30 -31.100IDP95126 transcriptional regulator RcsB [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001336285 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  19  4MNVIIADDHPIVLFGIRKSLEQIE-VVGEFEDSTALINNLPKLDAHVLITDLSMPGGDGITLIKYIKRHFPDLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRL--------EKISASGYGDKRLSPKESEVLRLFAEG----FLVTEIAKKL---------SIKTISSQKKSAMMKLGVENDIALLNYLSSVS...... 209
31 -30.900IDP91817 gene: rcsB; DNA-binding response regulator in two-component regulatory system with RcsC and YojN [Escherichia coli str. K-12 substr. MG1655] b2217 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  4MNVIIADDHPIVLFGIRKSLEQIE-VVGEFEDSTALINNLPKLDAHVLITDLSMPGGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRL--------EKISAGGYGDKRLSPKESEVLRLFAEG----FLVTEIAKKL---------SIKTISSQKKSAMMKLGVENDIALLNYLSSVT...... 209
32 -30.200IDP93897 response regulator protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007718 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  20  7LNIAMIEDEPFSRLALMEILKKYPYVVGCVSNTPELITLLESNEIEVLLLDYSLVAQDGVGLIKRLLQLRPALKIIVHTAHKSLAVARLAWQAGAWGFVQKSSDIQELFFAISYVARGKKFFPIEL---------ASLSQSAQKNTHHTLTGRETEVLRMLLNG----LKQKEISVRL---------SFKTVSNTKTRAFKKLGLTSNTDFFKYAHEIS...... 235
33 -29.100IDP91185 AAC46367 [Vibrio cholerae]  ali follow..  21  5.KVLIVEDDEGLREALIDTLALAGYEWLEADCAEDALLKLKSHSVDIVVSDVQMAGMGGLALLRSIKQHWPNLPVLLMTAYANIQDAVSAMKDGAIDYMAKPFAPEVLLNMVSRYAPVKSDDNGDAVDTKSLKLLALADKVAKTDANVMILGPS-EVMSRYIHNASPAIPDNMLEATLFGYEKGAFTGADEISEMDLNLQAKLLRVLQEREVKRLGS........ 255
34 -29.100IDP95163 positive regulator for ctr capsule biosynthesis, positive transcription factor [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001336074 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  1MSTMIMDLCSYTRLGLTGYLTSRGQEIVEVNSAADLQKHCTSCCPAVVFLNEFVHDDESNGIIRQIITQNPATLFVIFMSLANIH--DRYLRVRKNLLISSKSITPKDLDVILVNYLKYKNTSVGQL----------------TLPTLSLSKTESNMLQMWMAG----HGTSQISTQM---------KAKTVSSHKGNIKKKIQTHNKQVIYHIVRLTEN..... 197
35 -28.500IDP04184 sensor histidine kinase/response regulator LuxN [Vibrio cholerae O1 biovar eltor str. N16961] VCA0522 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  25  568RRILVVDDNQSIRTFTAILLEQQGYEVVQANDGSEVLKHMESQNIDLVLMDIEMPNVGGLEATRLIRNSEKNIPIIGYTGDNSPKTLALVQTSGMNDFIVKPADRDVLLNKVAAWV............................................................................................................. 686
36 -27.800IDP04495 sensory box sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar eltor str. N16961] VC0622 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  33  770PLLLVADDEPVNLRVLDSFLRLEGYRVHTAQDGHQVLEAIKREKPELVLLDIMMPGMSGYQVCEKLRQTYDELPIIMLTALNQSDDRVRGFEAGANDYLSKPFNKQELAARIVAHLTASKAELRRI................................................................................................... 897
37 -27.100IDP02145 gene: psaE; putative regulatory protein [Yersinia pestis CO92] YPO1301 [Yersinia pestis CO92]  ali follow..  17  3.................................................................................................................................HCVVLNKLESVLIIGDSRYALSKNEVLLLECLYLRAGDVISHDELLTTCWP---DRVVSPTSLPVAIKHIRDVFRKITRSEVIKTYKNEGYSYQKD 95
38 -26.500IDP02415 sensory box sensor histidine kinase/response regulator, putative [Coxiella burnetii RSA 493] CBU_1761 [Coxiella burnetii RSA 493]  ali follow..  19  410VPVLLVEDTPLAQKAIGIKLEELGCAVDLADNGEAAIKKASQNRYSLIFMDIGLPGIDGYEAAARIRAWEKETPIVALTAHVNEEGEQQCYKVGMNLVLHKPMLGQYGQRILNRFVNNERREIGS.................................................................................................... 539
39 -26.000IDP04164 sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar eltor str. N16961] VC1445 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  25  454HHILVVEDTKTNQMVIQLLLNKLGYDVTIAENGLQAVELLEKNHFDLVLMDISMPIMDGIAATKILRDKHIEIPIIALTAHTAGSDKQNCIDAGMNDIVLKPIRSKDIMEVVKRFL............................................................................................................. 570
40 -25.400IDP02403 sigma-54 dependent DNA-binding response regulator [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1024c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17  1MNLVIVEDDINMRKSLEIALAEEEFNIKSYKSATEALKKIDD-NTDLIITDINMPGIDGIEFVKACENK---YDFIIMTGNATLSRAIEAVRLGVKDFLTKPFDVDTLVEAIKRAKIIREKTADKKSKKNEKKFSTSPNLEKTLNLSQKAAKTDASVMFFGESGVGKEVFSRYI------HTHSKRSNKPFIAINMAAIPANLIES................... 203
41 -24.700IDP04341 putative aerobic respiration control sensor protein arcB [Coxiella burnetii RSA 493] CBU_0634 [Coxiella burnetii RSA 493]  ali follow..  23  512VRVLLIEDDKLSQNIEKIFLEEFGCKVDTASNAEEALVKFNE-SYELICTDIGLPDKDGYALVREIRQSHKPVPILAMTAHVFDREKNKCLEAGMNGFINKPVTVEEIRRALLDYL............................................................................................................. 629
42 -24.600IDP04733 two component system histidine kinase [Coxiella burnetii RSA 493] CBU_0789 [Coxiella burnetii RSA 493]  ali follow..  16  577LSVLVVEDNALAATAVAVVLKPFNCAVDFAESGAQAIEKARKGIYDLILMDVGLPDISGIEATQRIRAAKAQVPIIALTGHADNGERQECLEAGMQEVLSKPLQRLAIESTLEQFIFRAKAEKEAKSGPPVTSMPESTEVIDWNACVRMCNGSPEFTRQLLTILDEDLKSTRAKLEKAYQER-----NNEILRAELHRLRGGVSYLKLPQLDNALKMF....... 794
43 -23.700IDP04664 sensor histidine kinase/response regulator [Bacillus anthracis str. `Ames Ancestor`] GBAA0996 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  776KTIMIVDDDHRNIFALQNALKKQHANIITAQNGLECLEILKNNNIDLILMDIMMPNMDGYETMEHIRMNLHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNLHQLYSVMSVWLIK........................................................................................................... 896
44 -23.700IDP91057 gene: agrA; accessory gene regulator protein A [Staphylococcus aureus subsp. aureus USA300_TCH1516] USA300HOU_2035 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  18  1MKIFICEDDPKQRENMVTIIKNKPMEIALATDNPYEVQAKNMNDIGCYFLDIQLSDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRIIDCLETTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIES........................ 212
45 -23.300IDP91425 aerobic respiration control sensor protein ArcB [Vibrio vulnificus CMCP6] VV1_0550 [Vibrio vulnificus CMCP6]  ali follow..  25  527LSIFMVEDIALNVTVARSLLESLGHKVTVAMTGDEAIRSFDPSRYDLVLLDIQLPDMTGFDVAAYYRKHSQLPPLVALTA-NVLKDKREYLDNGMDEAISKPLAVQAIQDVIEKLIIKQESTTIE.................................................................................................... 651
46 -22.900IDP93815 sensor kinase protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007719 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  22  662RRLLVVEDEPLLLEVQYELFSSMGFQVDAVANTQQAYQSWLQHHHTIIVTDCRLDESDGFELVRHLRKSPEPVLIIGQSASLKTEDAQRAREVGMDYLLQKPVAREQWQQLIRDYFASKEKEHD..................................................................................................... 789
47 -22.900IDP01805 sensory box sensor histidine kinase/response regulator [Coxiella burnetii RSA 493] CBU_1084 [Coxiella burnetii RSA 493]  ali follow..  23  565MNVLVVEDNLINQRISKIMLEQVGCQVDIAGCGKDAIEKMKK-HYDMVFMDIGLPDMDGFETTQCIRHNGQRVPIVAMTAHVFAQDRKRCFDVGMDEVMAKPIMQDDLIKVLKRWA............................................................................................................. 682
48 -22.900IDP01829 hypothetical protein lmo0051 [Listeria monocytogenes EGD-e] lmo0051 [Listeria monocytogenes EGD-e]  ali follow..  19  2LPVFICEDNRRLTKYIEDYIMVEHFDMKLELSTGDPFELVTHQGMGLYFLDIDLPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKVEALDYIIKDDIHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDD--FETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKNIHELDTT....................... 218
49 -22.500IDP01845 hypothetical protein STM0017 [Salmonella typhimurium LT2] STM0017 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  8.................................................................................................................................SNCIYNEGKYELRTNSQVIKMTAMRAKCLSFIIENAHEIIERQKITTALWG-SRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNSD 105
50 -22.300IDP04484 gene: barA; two-component regulatory protein [Yersinia pestis CO92] YPO3381 [Yersinia pestis CO92]  ali follow..  15  668FRVMAVDDNPANLKLIGTLLEEQIEETVLCDSGAMAITYAREHTLDIILMDIQMPEIDGIRASEIIHQIPQETPIIAVTAHAVKGQQEQLLRLGMADYLAKPIDEARLLQVLSRYQSDNPPLSTASTASTASTASTAESLPLPVPKGAGVIDWAQAV--------RQAANKEDLARDLLTMLLEFMPQITA---RVQAILAGADDGDILNLVHKFHGS....... 876
51 -22.100IDP04543 sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar El Tor str. N16961] VC2453 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  665LCVMAVDDNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTACKAIKQLKRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHWSPHTRSKQVAKVTPPDGAAVISNALPSSPPAEEAIIDWPVAL--------RQSANKEDLAKEMLGMLVDYLREVET-VVNTALEDEEYPASDLLHHIHKLHGS....... 875
52 -22.000IDP04186 sensor protein TorS [Vibrio cholerae O1 biovar eltor str. N16961] VCA0709 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  746ANVLLVEDNEVNCLVAQGFLTSLGHQVTLAKSVQEAKLCFQQQRFDIALLDIHLPDGNGVDLLRDLRQMEDVIPFIAVSAHVFNEEVAGYLAAGFDGYLPKPLVKEQLAAMLRQQLTAKSGDDAD.................................................................................................... 875
53 -21.100IDP01908 gene: ssrA; sensor kinase [Salmonella typhimurium LT2] STM1392 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  23  689LQILLVDDADINRDIIGKMLVSLGQHVTIAASSNEALTLSQQQRFDLVLIDIRMPEIDGIECVRLWHDEPPDCMFVALSASVATEDIHRCKKNGIHHYITKPVTLATLARYISIAAEYQLLRNIE.................................................................................................... 817
54 -20.800IDP04166 sensory box sensor histidine kinase/response regulator VieS [Vibrio cholerae O1 biovar eltor str. N16961] VC1653 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  918GHVLVADDDAINRLLIKKQLSELGLSATLVSDGLQAFEKLSQEQYDLLITDCHMPHLDGFALTRKVKQEISKGAVVGCTAEDSRLAAEQALQAGMDKVIYKPYTLANLRKVLSRYLTTQWVALPEQSWLDAYQAMVVAESLAQDIALLNQPDCDVKALAHRIKGAAGSLQLQRLADLA--KTVEKQNDPQQLVADKQQLINAMHE.................... 1131
55 -20.700IDP04401 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC1831 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  602LRVLIVEDNRTNIMILEAFMRNKGFECHSVMDGVQAITALQESSFDLVLMDNHMPLKDGIQATREIRQLPAKILLFGCTADVFKDTRDKMLSAGADDIIAKPIAEHELDMALEQHSERLYQFHRE.................................................................................................... 729
56 -20.700IDP02181 two-component sensor/regulator [Yersinia pestis CO92] YPO0256 [Yersinia pestis CO92]  ali follow..  24  694MHILLVDDSETNRDITGMMLQQLGHQVTRADSGTTALAIGRQHRFDLVLMDIRMPVLDGLATTARWRHIDSHCMITALSANASPDEQIKTSQAGMNHYLSKPVTLGQLAEMLDLTAQFQLERGVD.................................................................................................... 822
57 -19.000IDP90302 sensory transduction histidine kinase, putative [Borrelia burgdorferi B31] BB_0420 [Borrelia burgdorferi B31]  ali follow..  14 1156INVLIAEDNQVNQKVLKDILVVIGINIDVVDDGVKALKSLKDKKYTISFIDIRMPRYDGFSVAKEIRKFEKPCVLVAVTAHALQEYKDKCLASGMNDYISKPIHISSIKTILKKYLQFEVDDIGENENLNQLVLDVNRALKELNLSYVSYS----ELCRGLVDFISINIID------------------------LEKAFDEEDLSLIKDISHSISGALSNMRSE 1364
58 -18.300IDP04163 sensory box sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar eltor str. N16961] VC1349 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  992QSLLLVEDNEVNQEVALGLLQDTGLNVVVANHGQEALERLEHADFDLVLMDMQMPVMDGITATEHIRANPHSLPIVAMTANAMAIDIERCLQAGMNDHLSKPIEVDKFYQVLRHFLQVSDEQSFSSHSPNKPSASKPAMNALLDLPQLTGVDLEQAI--------FRIGGNQQRYFEI-----HFIDSQVDELNSVTGLIEAQDWSSATRVAHTLKGSAANLGLE 1207
59 -17.400IDP91337 EAL domain-containing protein [Vibrio vulnificus CMCP6] VV2_0138 [Vibrio vulnificus CMCP6]  ali follow..  15  397ICALVIDECSVSSSALTKQLQRASSQVLIARNLDQAVKTLRDYPVNLVVVDIFMSDATNYTLLTDIDQRFSG-RMILLTEQSNPDIVLLPELTARSTILSKGSALFDTVQEILAHSKLEKTDFSAQ-----------------QNKLDQLSERELAVAQMLFKG----LGNKQIANQL---------NQKTVSTYKTRVQTKLGIKSAMELVRFF.......... 585
60 -12.800IDP95482 response regulator VieA [Vibrio cholerae O1 biovar El Tor str. N16961] NP_231289 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1MKIMIVEDDRIQATSLKLKLRQLGLDVILAENGFAALELCNKVGIDLMFCDIRMPQMDGISLLSQLSLQAPKLGVVILSAVEDTILELTHNMCSLAGFLPKPYEVEDLQRVVEGFQKQTEPETSHKFLHDHIQFDFRSGAMVGVEALVRYEHPTHGMLS-LSVNISQRNLQHSICDPILAICERYGFPASKLTLEMTEHEVYNGTPTSLANLARLRMYGVGLSID 286
61 -12.500IDP95483 gene: vieA; response regulator VieA [Vibrio cholerae O1 str. 2010EL-1786] YP_004937306 [Vibrio cholerae O1 str. 2010EL-1786]  ali follow..  15  23MKIMIVEDDRIQATSLKLKLRQLGLDVILAENGFAALELCNKVGIDLMFCDIRMPQMDGISLLSQLSLQAPKLGVVIFSAVEDTHNMCSLAGFAYVDRLPKPYEVEDLQRVVEGFQKQTEPETSHKFLHDHIQFDFRSGAMVGVEALVRYEHPTHGMLS-LSVNISQRNLQHSICDPILAICERYGFPASKLTLEMTEHEVYNGTPTSLANLARLRMYGVGLSID 308
62 -12.200IDP04409 putative hybrid two-component system regulatory protein [Yersinia pestis CO92] YPO3965 [Yersinia pestis CO92]  ali follow..  27  739.LVLVLEDEPDVRQTLCEQLHQLGYLTLETGDSRQALALMADVDISIVISDLMLPGMTGAEVLQQARSVYPHLKLLLISGQDLRRSKNFMPEV---ELLRKPFNQQQLVQALQRV.............................................................................................................. 851
63 -9.970CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  18  180..VIIADDHPIVLFGIRKSLEQIEWVVGEFEDSTALINNLPKLDAHVLITDLSMPG-DGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRL---------EKISAGG-DKRLSPKESEVLRLFAEG----FLVTEIAKKL-------NRSIKTISSQKKSAMMKLGVENDIALLNYLSSV....... 382

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.