current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682801|ref|YP_212945.1| nicotinate phosphoribosyltransferase (BF3334) [Bacteroides fragilis NCTC 9343] (Range: 1-388), from B.fragilis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MIIRTILDTDLYKFTTSYAYIKLFPYAIGTFSFKDRDGTEYSDEFVERLRTEISQLSHVALTEKELEYMIKNCRFLPRVYWEWLSSFRFQPEKIEIRLDENRQLHIEVNDYLYKATLYEVPLLAIVSEIKNQSSGNVANLEDILYKLSEKTELSNKHQLLFSEFGTRRRFSFDVQNQVIGHLKQTAHYCIGTSNCHFAMKYGMKPMGTHPHEWFMFHGAQFGYKHANYMALENWVNVYDGDLGIALSDTYTSAIFLSNLSRKQAKLFDGVRCDSGDEFRFIDQLTARYKELGIDPTTKTIVFSNALDFDKALDIQEYCQGKIRCSFGIGTNLTNDTGFKPSNIVMKLSQCKMNMNQEWRECVKLSDDIGKHIGSPEEVRACLYDLRLELast
1 -96.800IDP90895 gene: pncB; nicotinate phosphoribosyltransferase [Yersinia pestis CO92] YPO1413 [Yersinia pestis CO92]  ali follow..  33  8.ILTSLLDTDAYKLHMQQAVFHHYRHITVAAEFRCRSDE-LLGVYADEIRHQVTLMGQLALTSDEFIYLSSL-PFFQDDYLHWLRDFRFKPEQVSVAV-HDGKLDIRIAGLWCEVIMWEVPLLAVISEIVHRRRSTQVTTDQAVQQLRTKLEQFDITHFKLMDFGTRRRFSREIQHTVVSTLKDEFPYLVGTSNYDLARTLALAPVGTQAHEWFQAHQQISPTANSQRVALQVWLDEYPNQLGIALTDCITMDAFLRDFDLAFANRYQGLRHDSGDPIEWGEKAIAHYEKLGIDPMKKVLVFSDNLDLEKALFLYRHFYQRIKLVFGIGTRLTCDIDVKPLNIVIKLVEC------NDKPVAKLSDSPGKTICQPAFVDQLRKAFALP 395
2 -90.000IDP05265 putative nicotinate phosphribosyltransferase [Clostridium difficile 630] CD3543 [Peptoclostridium difficile 630]  ali follow..  19  1.MRNLTLLTDLYQLTMLNGYFEKNHEDIVVFDMFFRKACDGGYTIVCGIDQVVEYIDNLHFSDEDLEYLKNL-NLFSDKFLKFLKEFKFTGDVEEGTIMFPNEPLITVKAPLYQAQLIETALLTIVNFQSLIATK-------------ASRVCFAAQGDPVFEFGLRRAQGPDAGIYGARA--AVVGGCAGTANVLAGKMFDIPIIGTQAHSWVQKFD-------NELEAFQAYADVYPDKCLLLVDTYDVLNSGVPNAIKEKGYKPMGIRLDSGDLAYLSKEAKKQLDNAGFSD--ISITASNDLDEYTITSLKAEGAT--INSWGVGTKLITSFDSPSLGGVYKL--AASCEKGVLEPKIKISENPEKINGYKKVIRIYNED.... 367
3 -89.500IDP04595 nicotinate phosphoribosyltransferase [Bacillus anthracis str. Sterne] BAS0565 [Bacillus anthracis str. Sterne]  ali follow..  19  6.DDSYALHTDLYQINMAYTYWKDGINRRSVFDLYFRKPFENGYAVFAGLEKIVEYIENFSFTESDIAYLAE--LQFEEEFLHYLQNMKFTGTVREGEVVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAAR-------------MKHAANNDELLEFGTRRAHEFDAALWGTRA--AFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYR-------DEYVAFKKYAETHKKCVFLVDTYDTLKSAIRVAKEFGDRIDFYGIRLDSGDMAYLSKKARKLLDEAGFTN--TKIIASSDLDEYTIMHLKSQGAK--INVWGVGTKLITSFEQPALGAVYKLVAI-EDTDGKLNDTIKISSNPEKIPGLKRIYRIINRV.... 370
4 -87.700IDP06296 nicotinate phosphoribosyltransferase [Streptococcus pneumoniae TIGR4] NP_345878 [Streptococcus pneumoniae TIGR4]  ali follow..  19  4.DDSLTLHTDLYQINMMQVYFDQGHNKKAVFEVYFRQPFKNGYAVFAGLERIVNYLEDLRFSDSDIAYLESLG--YHGAFLDYLRNFKLELTAQEGDLVFANEPIVQVEGPLAQCQLVETALLNIVNYQTLVATKAAR-------------IRSVIEDEPLMEFGTRRAQEMDAAIWGTRA--AVIGGANGTSNVRAGKLFDIPVLGTHAHALVQVYGNDYEAFKAYAATHKNCVFL----VDTYDTLRIGVPAAIQVAREGDQINFMGVRIDSGDIAYISKKVRQQLDEAGFTE--AKIYASNDLDENTILNLKMQKAK--IDVWGVGTKLITAYDQPALGAVYKIVAI-EDETGQMRNTIKLSNNAEKVSGKKQVWRITSRE.... 368
5 -10.100IDP00555 gene: nadC; quinolinate phosphoribosyltransferase YPO3424 [Yersinia pestis CO92]  ali follow..  11  26.TVAQALSEDL-DLTAQLL-----ADKQATATIITRED-----GIFCGQRWLNEVFIQLG------------------------AQISIQWLVTDGDKLTANQTLCHLTGPARILLTGERTALNFLQTLSGVATEV-----------SRYVVQLAGLKTQLLD--TRKT----------------------LPGLRTALKYAVLCGGGNNHRLFLIKENHIIAAGSIKEAVAKAFWIHADVPIEVEVES------LDELQQALEAGADIVMLDNFTIPMM-RDAVKMRDDHAKTQGSAQLEVSGNVTLETLRSYAETG----IDFISVGA-LTKHITALDLSMRFQ.......................................... 302
6 -9.780IDP05064 gene: nadC; nicotinate-nucleotide pyrophosphorylase (carboxylating) [Clostridium difficile 630] CD2370 [Peptoclostridium difficile 630]  ali follow..  15  1.MIQDALIEDV-DITTNSIV----ENSKSTVDLICKQD-----GIIAGLG-------------------------VFKRVFEILGDVDVKLYKNDGDRVKNREKIAVLTGSTRNLLVGERVALNYLQRMSGIATIT-----------SRYVEKLEGTNTKLLD--SRKT----------------------IPNLRILDKYSVKVGGGCNHRFILLKDNHIGAAGSVKKAVELARKNTSFVRKIEVE------ETLDMVKEAIEANADIIMLDNMSLEMAKQAVDIINGRAIVE-------FSGNVNLDTIEDIGKIG----VDVVSVGA-LTHSV--KALDISMKNLR....................................... 268
7 -9.530IDP04688 gene: nadC; nicotinate-nucleotide pyrophosphorylase [Bacillus anthracis str. `Ames Ancestor`] GBAA4661 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  9.ALNRFFLEDI-DVTSQLIF----DNLLSKGTFLAKDT-----GVFTGRLVIEEGFNLID------------------------ERIKVELHKKDGDLVEKGEIIATVQGPIASLLTAERVILNVIQRMSGIATMT-----------RKAVLALDSSHTRICD--TRKT----------------------MPGLRMFDKYAVVCGGGFNHRFVMIKDNHIAFAGSITKAVTSVKEKLGHMVKVEVE------ETEEQVREAVAAGADIIMFDNRTPDEIREFSKIVPSAIVTE-------ASGGITIEDLSKYGKTG----VDYISLGA-LTHSVKALDISFNIE.......................................... 276
8 -8.850IDP90842 gene: nadC; quinolinate phosphoribosyltransferase [Shigella flexneri 2a str. 2457T] S0108 [Shigella flexneri 2a str. 2457T]  ali follow..  12  26.AVAQALREDL-DITAKLL-----ENSRSHATVITREN-----GVFCGKRWVEEVFIQLAGDDVTIIWHVD-----------------------DGDVINANQPLFELEGPSRVLLTGERTALNFVQTLSGVASKV-----------RHYVELLEGTNTQLLD--TRKT----------------------LPGLRSALKYAVLCGGGANHRLFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVEN------LEELDEALKAGADIIMLDNFETEQMREAVKRTNGKALLE-------VSGNVTDKTLREFAETG----VDFISVGA-LTKHVQALDLSMRFR.......................................... 297
9 -8.700IDP90669 quinolinate phosphoribosyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC2422 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  25.SVIDTLKEDL------------GGTLDPAADITASLIPADRISTATIITREAGVFCGQLWADEVFKQLGG--------------QVSIEWHVQDGDTLTPNQTLCTLTGPARILLTGERNAMNFIQTLSGCATAT-----------ARYVQELKGTQCRLLD--TRKT----------------------IPGLRSALKYAVACGGGYNHRIYLIKENHIIACGGIRQAISTAKQLNPGKPVEVETET------LAELEEAISAGADIIMLDNFSLEMMREAVKINAGRAALE-------NSGNITLDNLKECAETG----VDYISVGA-LTKHLKALDLSMRFK.......................................... 295
10 -4.710IDP05544 gene: acpS; putative Ni/Fe-hydrogenase small subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1409 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  2............................................................................................................................................................................................................................................................................RVGCD----IIAISRIEKIHSRHGKNFLDKFLNPKEQILIKNPATLAGLWAAKEAASKALGVGICEL---------CSFFDIEISKDEKNAPKLKYSQKITKDFNITQTSLSISHDNGF. 107

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.