current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683425|ref|YP_213569.1| 30S ribosomal protein S14 (BF3990) [Bacteroides fragilis NCTC 9343] (Range: 1-99), from B.fragilis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MAKESMKAREIKRAKLVAKYAEKRAALKQIVRTGDPAEAFEAAQKLQELPKNSNPIRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASWLast
1 -43.300IDP04080 30S ribosomal protein S14 [Bacillus anthracis str. Sterne] BAS0123 [Bacillus anthracis str. Sterne]  ali follow..  38  3........................................KKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVKKASW 61
2 -5.780IDP90798 S-adenosylmethionine synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0472 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  267........KDPSKVDRSAAYAARYVAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSQRPYGLQEMLNLLQPIYKKTAAYGHF-GREEFPW 369
3 -5.590IDP90419 gene: euo; CHLPS Euo Protein [Chlamydia trachomatis D/UW-3/CX] CT_446 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  12  35....................................................................TQAAKLHNVTRQAIYVAIKQKKLKASKTTRW 65
4 -5.550IDP91486 hypothetical protein VP1698 [Vibrio parahaemolyticus RIMD 2210633] VP1698 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  12  1MRRRTQMKKQHRRRSLFPDSIVTQRKVTVLQRGARYESASQPLQDLN-------VVHVNHRQLLS---EGVLNDDQLS--LLQRLLDRSVVDSLCASQL 88
5 -5.200IDP90872 gene: metK; S-adenosylmethionine synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1096c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  293LAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSL----------TPNWIRDKFHLDKFLYADVAARGQV-GQKDYPW 385
6 -5.130IDP06473 gene: C19L; C19L [Monkeypox virus Zaire-96-I-16] NP_536472 [Monkeypox virus Zaire-96-I-16]  ali follow..  261.IIEAAINRGVKIRLLVGNWDKNDVYSMATARSDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFNSIDKQLVSEAKKIFERDW 362
7 -4.770IDP00453 putative iron-sulphur protein YPO2969 [Yersinia pestis CO92]  ali follow..  13  7VARDERYYKAYLESRTISRRGLFRGLLKGVQPSTTTAPSDITAPPPLRPPYAIDEPHFQQSCTGCGV................................ 73
8 -4.300IDP92129 ftsJ-like methyltransferase domain-containing protein [Toxoplasma gondii ME49] TGME49_007990 [Toxoplasma gondii ME49]  ali follow..  860..RKVREARARKKMREQRRLQKVKSQVAAVAESTEFTEASKAR-AIDKIARKARHAEEKRGKDYVGKKGGGNNRVKLVDRRLKK............... 955
9 -4.210IDP00724 gene: arsR; arsenical resistance operon repressor SACOL1822 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  6LATFLKVLSDSSRLEI----------LDLLSCGELCACDLLAHFQFSQPTLSYHMKALVKTNLVTTRKIGNKHLYQLNHNIFESVIN............ 82
10 -4.200IDP01626 gene: metK; S-adenosylmethionine synthetase [Bacillus anthracis str. `Ames Ancestor`] GBAA5017 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  280........KDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVS-RPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDSW 384

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.