current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680681|ref|YP_210825.1| hypothetical protein (BF1156) [Bacteroides fragilis NCTC 9343], from B.fragilis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MKPTIKKVQPVKVVAPFLNSQSESPVPLDALTDQEKVSDLYFLKGTVHQIAKPYLSINNCTFKQQIFSECQFKSAQLTDVRFENCDLSNVSFAGTTFYRVEFISCKLLGTGFLEATLNHVLMDHCYGQYINLSMVKMRTARFSHCNFRNGSLNDSKLMPAAFDTCELLEADFSHTSLKGIDLRNSRIAGIQLNIADLKGAIVSSLQAIDLLPLLGVKIEDDLast
1 -47.900sp|Q7L273|KCTD9_HUMAN BTB/POZ domain-containing protein KCTD9 OS=Homo sapiens GN=KCTD9 PE=2 SV=1  ali follow..  13  192..................QPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRYINFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDLQEANLRGSNVKGAIFE--EMLTPLHMSQS..... 387
2 -35.200sp|P78332|RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RBM6 PE=1 SV=5  ali   11  33..PPLKSHAQERHSGNFPGRDSLPFDFQGPPFANVEEHSFSYGARDGPHGDYRGGEGPGHDFRGGDFSSSDFQSRDSSQLDFRGRDIHSGDFRDREGPPMDYRGGDGTSMDYRGREAPHMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGS.............. 240
3 -31.200sp|P78332|RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RBM6 PE=1 SV=5  ali   2..................HMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGSGTTDLDFRDRDTPHSDFRGRHRSRTDQSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNRREESTIERPAFGIQKGEFEHSETREGETQGVAFEHESPADF........... 207
4 -27.700sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1  ali   1..........................................RGMDARGLEMRGPVPSSRGPMTGGIQGINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQTPQDQEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS................. 166
5 -22.100sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1  ali   75.PSSHEMRGGPLGDPRLLIGEPRGPMIDQRGLPMDGRGGRDSRAMETRAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVTPQDQEKAALIMQVLQLTADQIAMLPPE 297
6 -21.500sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=2 SV=1  ali   14  113.....DMIRYFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYLVSFLGSL----SVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQ............................ 296
7 -19.200sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2  ali   2..TRQNQELMEKVQILENFEKDETQMEVEALAEVIPLALYDSLRAEFDQLRRQHAEALQALRQQETREVPREEGAACGESEVAGATATKNGPTHMELNGSVAPETKVNGAETIDEEAAGDETMEARTMEAEATGAEATGAEATGAKVTETKPTGAEVREMETTEEEANETKPTGAQATDTETTGVEAMGVEATKTKAEEAEMQAYGV.............. 207
8 -16.700sp|Q86XI8|CS068_HUMAN Uncharacterized protein C19orf68 OS=Homo sapiens GN=C19orf68 PE=1 SV=2  ali   11  1............................GPWLEDEPGRGAQGEN--ERVRGLETGDWGGAPKEGSIWRGAQMEKEWARAL--ETRDWGGAQFEGEKGRALQIRDWR--GGRLENQKPRG--LEGGVLRGSKLEKGHLRGPEIRD--WRGPQLEGE--KDWGLEGYVWRGSQLEDQALRGLEWRVAQLED-RRSTTDLRGTQFDYERGK------GESTEDR 177
9 -12.400sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4  ali   10  1...............................MDSQMLASSTMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATSTMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSKSPDPYRLAQDPYRLAQ............... 175
10 -10.900sp|Q86W28|NALP8_HUMAN NACHT, LRR and PYD domains-containing protein 8 OS=Homo sapiens GN=NLRP8 PE=2 SV=2  ali   11  94.........................DLCSVFATNDKLEVLTMTNSVLGPPFLKALRHPQCKLQKLLLRRVNSTMQDLIGVLTGNQHLRYLEIQHVEVESKAVKRCRLQCLRLEDCLATPRIWTD--LGNNLQGNGHLKTLILRKNSLENCGLSVAQLERLSIENCNLTQLTC--ESLASCLRQSKMLTHLSLAENALKDEGAK.................. 285
11 -10.600sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4  ali   1................MAAGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVTTSELSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAPESHILASNTMETHILASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSSMDSQMLATSSMDSQMLATSTM.............. 191
12 -10.400sp|Q6PIJ6|FBX38_HUMAN F-box only protein 38 OS=Homo sapiens GN=FBXO38 PE=1 SV=3  ali   10  6.....................................................................................STSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDC---------PKMMFIHATRCRLKHLKVENAIVNRFDYAQCKLNMDQVLDLRMPPERNRIIYLRPMQVDTLTLEQKLFSGPYPYHICIIHEFS.... 134
13 -10.300sp|P59045|NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens GN=NLRP11 PE=2 SV=2  ali   11  16LCDALLHPNCTLISLVLVFCCLTENALGRVLLFSPTLRQLDLCVNRLKNYGVLPLLFPTCQLEELHLSGCFFSSDYIAIVIATNEKLRSLEIGSNKIEDAGMQNCMLVNIGLEECMLTSACCRS--LASVLTTNKTLERLNLLQNHLGNDGVADCVLKVVGLPLTGLNTQTQRKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSLDYMFFKFPRMSA. 270
14 -9.870sp|P59046|NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens GN=NLRP12 PE=2 SV=2  ali   13  12...................................................................................TCKLQTLRLGICRLGSAACEG--LSVVLQANHNLRELDLSFNDLGDWGLWLL-AEGLQHPACRLQKLWLDSCGLTAKACE--NLYFTLGINQTLTDLYLTNNALGDCKLRVLWLFGMDLNKMTHSRLAALR....... 151
15 -9.870sp|Q8WX94|NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens GN=NLRP7 PE=1 SV=1  ali   13  10.................................KCNLQYLRLGGHCATPEQWA--EFFYVLKANQSLKHLRLSANVLLDEGAMLL-YKTMTRPKHFLQMLSLENCRLTEASCKD--LAAVLVVSKKLTHLCLAKNPIGDTGVKDCKLQTLVLQQCSITKLGCR--YLSEALQEACSLTNLDLSINQIARCNLKHLRLKTYETNLEIKKLLEEVK....... 205
16 -9.840sp|Q86W24|NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens GN=NLRP14 PE=2 SV=1  ali   15  64.........................DLCSVLHTNEHLRELDLYHSNLDKSAMNNCKLQKLLLKFITFPDGDISTSLIHNKNLMHLDLKGSDIGDNGVKECKLQTLRLESCNLTVFNISNALIRSQSLIFLNLSTNNLLDDGVQKCYLERLSLESCGLTEAGCE--YLSLALISNKRLTHLCLADNVLGQCTLKSLVLRRCHFTSLSSEYLSTSL....... 296
17 -9.770sp|Q9BXR5|TLR10_HUMAN(removed signalp:1-19) Toll-like receptor 10 OS=Homo sapiens GN=TLR10 PE=1 SV=2  ali   16  100..................................TSVEHFQIRNVTFGGKDHNSFDYSNTVMRTIKLEHVHFRVLLLTKMDIENLTISNAQMPHTKFQYLNFANNILTDELFKRPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHETVVNMNLSYNKLSDSVFRCKSIQILDLNNNQIQTVPKETIHLMALR.................... 300
18 -9.740sp|Q96P20|NALP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens GN=NLRP3 PE=1 SV=3  ali   15  11LCETLQHPGCNIRRLWLGRCGLSHEDISLVLSSNQKLVELDLSDNALGDFGIRGLKHLLCNLKKLWLVSCCLTSADLASVLSTSHSLTRLYVGENALGDSGVAQCNLQKLGLVNSGLTSVCCSA--LSSVLSTNQNLTHLYLRGNTLGDKGIKDCKLQVLELDNCNLTSHCCSSQSLRKLSLGNNDLGSCLLQNLGLSEMYFNYETKSALETLQ....... 272
19 -9.660sp|P59047|NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens GN=NLRP5 PE=2 SV=2  ali   12  14LSDALRVSQCALQKLILEDCGITATSLASALVSNRSLTHLCLSNNSLGNEGVRSMRLPHCSLQRLMLNQCHLDTAFLALALMGNSWLTHLSLSMNPVEDNGVKSCHLQDLELVKCHLTAACCES--LSCVISRSRHLKSLDLTDNALGDGGVANSVLARLGLKACGLSLALSCNRHLTSLNLVQNNFSPSNLQIIGLWKWQYPVQIRKLLEEVQ....... 275
20 -9.640sp|Q8N5Z5|KCD17_HUMAN BTB/POZ domain-containing protein KCTD17 OS=Homo sapiens GN=KCTD17 PE=1 SV=3  ali follow..  11  155.................................................TQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEVEQVQVEADAQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHPLRPEAELAVRASPRPLARPQSCHPCCYKPEAP--GCEAPDHLQGLGVPI... 321
21 -9.630sp|Q86W24|NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens GN=NLRP14 PE=2 SV=1  ali   1...................................SLTHLDLGSNWLQDNGVKVFRHPSCNLQDLELMGCVLTNADLASVILNNPNLRSLDLGNNDLQDDGVKNCNIQRLGLEYCGLTSLCCQD--LSSALICNKRLIKMNLTQNTLGYEGIVKCKLQVLGLCKEAFDEEAQKLLE-AVGVSNPHLIIKPDCNYHNEEDVSWW.................. 190
22 -9.600sp|Q9NX02|NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens GN=NLRP2 PE=1 SV=1  ali   10  24LCEVLRHPECNLRYLGLVSCSATTQDLSLALEVNQSLTCVNLSDNELLDEGATTLRHPKCFLQRLSLENCHLTEADLAAVLVVSRELTHLCLAKNPIGNTGVKECKLQTLVLWNCDITSDGCCD--LTKLLQEKSSLLCLDLGLNHIGVKGMKLCNLRCLWLWGCSIPPFSCCNQSLVTLDLGQNPLGSGTLRTLRLKIDDFNDELNKLLEEIE....... 285
23 -9.540sp|Q9C000|NALP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens GN=NLRP1 PE=1 SV=1  ali   11  49.........................ILFSVLKVTRNLKELDLSGNSLSHSAVKTLRRPRCLLETLRLAGCGLTAEDLAFGLRANQTLTELDLSFNVLTDAGAKSCKLQRLQLVSCGLTSDCCQD--LASVLSASPSLKELDLQQNNLDDVGVRACKLIRLGLDQTTLSDEMR--QELRALEQEKPQLLIFSRRKPSVMTPTEG.................. 247
24 -9.400sp|Q96MN2|NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens GN=NLRP4 PE=2 SV=3  ali   12  48.........................YISEMLLRNKSVRYLDLSANVLKDEGLKALKHPDCCLDSLCLVKCFITAADLASALISNQNLKILQIGCNEIGDVGVQDCRLEILGLEECGLTSTCCKD--LASVLTCSKTLQQLNLTLNTLDHTGVVECALQVLGLRKTDFDEETQ--ALLTAEEERNPNLTITDDCDTITRV...................... 242
25 -9.360sp|Q86W28|NALP8_HUMAN NACHT, LRR and PYD domains-containing protein 8 OS=Homo sapiens GN=NLRP8 PE=2 SV=2  ali   13  1..........................LIGVLTGNQHLRYLEIQHVEVESKAVRVLRSPRCRLQCLRLEDCLATPRDLGNNLQGNGHLKTLILRKNSLENCGAYVAQLERLSIENCNLTQLTCES--LASCLRQSKMLTHLSLAENALKDEGAKRCPLQRLVLRKCDLTFNCCKNKTLKSLDLSFNSLKDCTLQILELENCLFTSICCQAMASML....... 227
26 -9.330sp|Q7RTR0|NALP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens GN=NLRP9 PE=2 SV=1  ali   13  20.................................HCALERLMLMYCCLTSVSCD--SISEVLLCSKSLSLLDLGSNALEDNGVASL-CAALKHPGCSIRELWLMGCFLTSDSCKD--IAAVLICNGKLKTLKLGHNEIGDTGVRHCKLECLGLQTCPITRACCD--DIAAALIACKTLRSLNLDWIALDDCALQMLGLHKSGFDEETQKILMSVE....... 216
27 -9.330sp|Q7RTR0|NALP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens GN=NLRP9 PE=2 SV=1  ali   14  21.........................ELCSMFITNKNFQILDMENTSLDDPSLKALAQPVCKLRKLIFTSVYFGHDSLFKAVLHNPHLKLLSLYGTSLSQSDIRMCKIEELILGKCDISSEVCED--IASVLACNSKLKHLSLVENPLRDEGMTHCALERLMLMYCCLTSVSCCSKSLSLLDLGSNALEDCSIRELWLMGCFLTSDSCKDIAAVL....... 252
28 -9.320sp|P59046|NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens GN=NLRP12 PE=2 SV=2  ali   14  68.........................EMASVLGTNPHLVELDLTGNALEDLGLQGLRHPVCRLRTLWLKICRLTAAELASTLSVNQSLRELDLSLNELGDLGVLTCKLQTLRLGICRLGSAACEG--LSVVLQANHNLRELDLSFNDLGDWGLWACRLQKLWLDSCGLTAKACINQTLTDLYLTNNALGDCKLRVLWLFGMDLNKMTHSRLAAL........ 300
29 -9.190sp|Q9NX02|NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens GN=NLRP2 PE=1 SV=1  ali   10  90.........................DLCSIFGSNKDLMGLAINDSFLSASLVEQIASDTCHLQRVVFKNISPADANLCLALRGHKTVTYLTLQGNDQDDLRHPECNLRYLGLVSCSATTQQWAD--LSLALEVNQSLTCVNLSDNELLDEGAKKCFLQRLSLENCHLTEANC--KDLAAVLVVSRELTHLCLAKNPIGNTGVK.................. 286
30 -9.180sp|P59046|NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens GN=NLRP12 PE=2 SV=2  ali   13  50..........................SSFCLKRCRSAQVLHLYGATYSADGEDRARCSAHTLLVQLPERTVLLDAHLAAALCTNPNLIELSLYRNALGSRGVKNCKLQNLRLKRCRISSSACED--LSAALIANKNLTRMDLSGNGVGFPGMMQCRLQMIQLRKCQLESVLGTNPHLVELDLTGNALEDCRLRTLWLKICRLTAAACDELASTL....... 280
31 -9.120sp|Q96P20|NALP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens GN=NLRP3 PE=1 SV=3  ali   112.................................SHAACSHGLVNSHLTSSFCR--GLFSVLSTSQSLTELDLSDNSLGDPGMRGCNIRRLWLGRCGLSHECCFD--ISLVLSSNQKLVELDLSDNALGDFGIRLCNLKKLWLVSCCLTSADLASVLSTSHSLTRLYVGENALGDSGVAKAKNPQCNLQKLGLVNSGLTSV..................... 299

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.