current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680762|ref|YP_210906.1| putative transmembrane conjugate transposon protein (BF1242) [Bacteroides fragilis NCTC 9343] (Range: 1-110), from B.fragilis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MADYPINRGIGKPVEFKGLKSQYLFIFAGGLLALFVLFIIMYMVGINQWVCIIFGVTSATLLVWLTFRLNEKYGTHGLMKLSARKSHPFHIINRKAISRLFTKNQKQASKLast
1 -8.820sp|P31431|SDC4_HUMAN(removed signalp:1-18) Syndecan-4 OS=Homo sapiens GN=SDC4 PE=1 SV=2  ali follow..  23  109..........NKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAV-------------FLILLLMYRMKKK-GSYDLGKKPIYKKAPT..................... 175
2 -8.660sp|P41594|GRM5_HUMAN(removed signalp:1-18) Metabotropic glutamate receptor 5 OS=Homo sapiens GN=GRM5 PE=1 SV=2 (Range: 751-1050)  ali follow..  2...................EAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVY----IILAKPERNVRSAFTTSTVVRMHVGDGKSSSAA 88
3 -8.540sp|Q13255|GRM1_HUMAN(removed signalp:1-24) Metabotropic glutamate receptor 1 OS=Homo sapiens GN=GRM1 PE=1 SV=3 (Range: 751-1050)  ali follow..  2..........NVPANFN--EAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMY----IIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRS 95
4 -8.310sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 (Range: 451-669)  ali follow..  16..........SSTKVYDDMAFRYLSWILFPLLGCYAVYSLLYLEHKGWYSWVLSMLYGFLLTFGFITMTPQLFINYKLKSVAH........................... 88
5 -8.170sp|Q8N3S3|PHTF2_HUMAN Putative homeodomain transcription factor 2 OS=Homo sapiens GN=PHTF2 PE=2 SV=2 (Range: 301-600)  ali follow..  13  177MSVLEISGMIMNRVNSHIPGIGYQ-IFGNAVSLILGLTPFVFLTAHSASELYVIAFGSNEDVIVLSMVIISFVVRVSLLLCVAERTYKQRLLF--AKLFGHLTSARRARK 299
6 -8.120sp|Q16821|PPR3A_HUMAN Protein phosphatase 1 regulatory subunit 3A OS=Homo sapiens GN=PPP1R3A PE=1 SV=3 (Range: 901-1122)  ali follow..  170.......KYTNSKIPYFLL---FLIFLITVYHYDLMIGLTFYVLSLSWLSW........................................................... 210
7 -8.030sp|Q9HC56|PCDH9_HUMAN(removed signalp:1-23) Protocadherin-9 OS=Homo sapiens GN=PCDH9 PE=1 SV=2 (Range: 751-1050)  ali follow..  12  15.....IRRTMETPLSQPYQNEDYLTIMIAIIAGAMVVIVVIFVT------------------------VLVRCRHASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRK 102
8 -7.810sp|O00327|BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-like protein 1 OS=Homo sapiens GN=ARNTL PE=1 SV=2 (Range: 451-626)  ali follow..  35  154MSLLEADAGLGGPVDFSDLP.......................................................................................... 173
9 -7.750sp|Q9P2G4|K1383_HUMAN(removed signalp:1-23) Uncharacterized protein KIAA1383 OS=Homo sapiens GN=KIAA1383 PE=1 SV=2 (Range: 451-750)  ali follow..  10  23.......................................................................LYGLTNTLRLRLKLTNPDMLVVHEKRELYRKRQSQMLGT 61
10 -7.590sp|Q96G30|MRAP2_HUMAN Melanocortin-2 receptor accessory protein 2 OS=Homo sapiens GN=MRAP2 PE=2 SV=2  ali follow..  32  31...........GPVSFEGLKAKYSIVIGFWVLAVFVIFMFFVLTLLTK.............................................................. 69

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.