current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343], from B.fragilis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 -27.700sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2  ali   13..CDCKNDANCDCFSGDDGKDAKLNTPSSLAVCADGELYYLFDTTGKHLYTQSLPTGDYLY--------NFTYTGDGDITLITDNNGNMVNVRRDSTGMPLLVVPDGQVYWVTMGTNSALKVTTQGHELAMMTYHGNSGLLATNENGWTTFYEYDSFGRLTVTFPTGQVSSFRSDTDSSVHVQVETSSKITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAGTVN. 292
2 -26.300sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3  ali   10  7.ISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIISKHFDTHGRIKEQYDSMGRVIKRELKLGTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVMPLRYDLRDRITRLGDQRGSDIFEYNSKGLLTYNKASGWSVQYRYDGVGRRAYKTNLGHHLQYFYSDLHNPTYNHSNSEITSLYYDLQGHLFMESSSGEEYYVASDNTGTPLVFSINGLMIQLQYTAYGEIYYD.. 300
3 -25.700sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2  ali   12  1..TPLP--IDLYRYDDVSGKTEQFGKFGVIYYDINQIITKHFDAYGRMKEQYDNMGRVVKKELKVGTRYSYEYDADGQLQTVSINDKPLWRYSYDLNGNLHSPGNSARLTPLRYDIRDRITRLGDQRGGDIFEYNSAGLLAYNRAGSWSVRYRYDGLGRRVSKSSHSHHLQFFYADLTNPTYNHSSSEITSLYYDLQGHLFMELSSGDEFYIACDNIGTPLVFSGTGLMIQILYTAYGEIYMDT. 292
4 -24.600sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2  ali   36.IASPADQ-ELYQFTVNGTHLH-----TLNLITRDYVYNFTYNSEGDL----------GAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKVSAQGYNLALMTYPGNTGLLATNENGWTTVYEYDPEGHLTATFPTGEVSSFHSDLEKLTKVEKQENTQSTYRVNPDGSLRVTFASGMEIGLSSEPHILAGAVNPTLGKCNISGEHNANLIEWRQRKEQNKGNVSAFERRLRAH. 292
5 -24.500sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2  ali   30RLRVHNRNLLSLDFDRVTRTEK--KFTLRILYDQAGRVNVTYSPGGYIAG-----------IQRGIMSERMEYDQAGRITSRIFADGKTWSYTYLEKSMVLLLHS-QRQYIFEFDKNDRLSSVTMPNVARQETIRSVGYYRNPPEGNASVIQDFTEDGHLLFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGMLKTQNEGFTCTIRYRQIGPLIDRQIVNARFDYNYDNSFRVTSMQ. 295
6 -24.000sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3  ali   11  3.QVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDNSPSSLAVAPDGTIYIADLGNIRIRAVAASPGEQELYVFNADGIHQYTVSTGEYLYNFTYSTDNDVTLIDNNGNSLKIRRDSSGMPRLLMPDNQIITLTVGTNGGLKVSTQNLELGLMTYDGNTGLLATDETGWTTFYDYDHEGRLTVTRPTGVVTSLHREMEKSSYTVVQDQVRNSYQLCNNGTLRVMYANGMGISFHSEPHVLAGTIT. 300
7 -23.800sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2  ali   10IYDDHRKFTLRILYDQTGRPILSRYNEVNITYSPSGLVKMEYDQSGKIISRTWADGKIWSYLLHSQRRYIFEYDQPDCLLSVTMPSMVRHSLQTMLSVGIYTPPDSSTSFIQDYSRDGRLLLHLGTGRRVLYKYTKQARLSEVLYDTTQVTLTYEESSGVIKTMHDGFICTIRYRQTGPLI-EGLVNARFDYSYNNFRVTSMQAVINETPLYRYVDVSGRTEQ----GKFSVINYDLNQVITTT. 294
8 -23.700sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3  ali   60IYDDHRKFTLRIIYDQVGRPFLWLPS------SGLAAVNVSYFFNGRLAG-----------LQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDKSMV-LLLQSQRQYIFEYDSSDRLLAVTMPSVARHSTHTSIGYIRNPPESNASVIFDYSDDGRILSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMQSGGFSCTIRYRKIGPLVDKQIVNARFDYTYHDNSFRI.... 300
9 -23.000sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3  ali   12  12.....DSTRVSFTYDETAGVLKSDGFICTIRYRQIGPLDYSYDNSFRVTSMQGVINDISGKVEQFGKFGVIYYDINQIIS----TAVMTYTKHFDAHGRIKEIQYEIFRSTIQYDNMGRVTKREANTTKYAYEYDVDGQLQVYLNEKIMWRYNYDLNGNLHNPSNSARLTPLRYDLRDRIT----RLGDVQYRLDEDGFLRQR----GTEIFEYSSKGLRVYSKGSGWTVIYRYDGLGRRVSSKY 300
10 -22.400sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3  ali   2....PDNQIITLTVG-------TNGGLKVVSTQNLELGLMTYDGNTGLL---------ATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDVQDQVRNSYQLCNNGTLRVMYANGMGISFHSEPHVGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTIIYDQVGRPFLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVRMFADGKVWSYSYLDKSMVLL... 294
11 -22.400sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2  ali   13.VTTQGHELAMMTYHGNS------GLLATKSNENGWTTFYEYDSFGRL----------TNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDTTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLGRRLRVHNRNLLSLDFDRVTRKIYDDHRKFTLRILYDQAGRPSSPSSRLNGVNVTYSPGGYIAGIQRGIMSERMEYDQAGRITRIFADGKTWSYTYLEKSMVLLLEF 297
12 -22.200sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2  ali   13  31..PPEGNASVIQDFTEDGHLLHGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGMLKTINNEGFTCTIRYRQIGPLIDREGMVNARFDYNYDNSFRVTSMQAVINETPDLYRYDDVSGKTEQFGKFGVIYYDINQIIT---TAVMTHTKHFDAYGRMKEVQYEIFRSTVQYDNMGRVV-PYANTTRYSYEYDADGQLQVSINDKPLWRYSYDLNGNLHSPGNSARLTPLRYDIRDRIT.... 296
13 -21.900sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2  ali   11  10.LHLGTGRRVLYKYTKQAREVLYDTTQVTLTYEESSICTIRYRQTGPLIGRYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVIT---TTVMKHTKIFSANGQVIILKAIAYWMTIQYDNVGRMVICDANITRYFYEYDADGQLQVSVNDKTQWRYSYDLNGNLLSHGKSARLTPLRYDLRDRITR-----GEIQYKMDEDGFLRQR----GNDIFEYNSNGLLQKAYY 300
14 -21.800sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3  ali   10WLPSSKLMAVNVTYSSTGQIAS--------IQRGTTSEKVDYDGQGRIVSRVFADGKTWSYTLHSQRQYIFEYDMWDRLSAITMPSVARHTMQIRSIGYYRNIPESNASIITDYNEEGLLLAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGTVNLQSDGFICTIRYRQIGPLIDRGMVNARFDYSYDNSFRVTSMQGVINETLYQFDDISGKVEQSTAVMTYTKHFDAHGRIKEIQY 292
15 -21.700sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2  ali   11  1.........TVYEYDPEGHATFPTGEVSSFHSDLEKLTKVELDTSNRSLRVTFASGMEIGLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKERRLRAHNRNLLSIDFDHITRTGKIYDDHRKLRILYDQTGRPISPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQSGKIIRTWADGKIWSYTYLEKS-VMLLLHSQRRYIFEYDQPDCLLVTMPSMVRHSLQTMLSVGYYRNIY 287
16 -20.800sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3  ali   1..........NKPLLNSMNFYE---------ASPTDQELYIFDINGTHQYTVSLVTGDYLY--------NFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVVVSPDNQVIWLTIGTNGCLKMTAQGLELVLFTYHGNSGATKSDETGWTTFFDYDSEGRLTVTFPTGVVTNLHGDMDKATVDIESSSREEDVSITSNLSSIDSFQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLA..... 224
17 -20.500sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3  ali   13  2..........IFEYDSSDRLLAPSVARHSMSTESNASVIFDYSDDGRILKTSF---------LGTGRQVFYKYGKLSKLSEIVYDST-AVTFGYDETTGVLKMQSGGFSCTIRYRKIGPLVDKQIVNARFDYTYHDNSFRIASEHFGKFGVIYYDINQIIT---TAVMTLSKHFDTHGRIKEVQYEMFRSTVQYDSMGRVIKREANTTKYTYDYDGDGQLQVAVNDRPTWRYSYDLNGNLHLLRY 298
18 -20.500sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3  ali   12  2.........ITIQYDNMGRVTK---EIKIGPFANTTKYAYEYDVDGQL----------QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTLRYDLRDRITRLGD----VQYRLDEDGFLRQR----GTEIFEYSSKGLLVYSKGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTHVYNHSSSEITSLYYDLQGHLFMEISSGDEFYIASDNTGTPLAVFSSNGLMLIQYTAYGEIYFDS. 228
19 -19.700sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2  ali   10  1............IFSANGQVIE----QYEILKAIAYWMTIQYDNVGRMVICDIRVG-----VDANITRYFYEYDADGQLQTVSVNDKTQWRYSYDLNGNINSHGKSARLTPLRYDLRDRIT----RLGEIQYKMDEDGFLRQR----GNDIFEYNSNGLLAYNKASGWTVQYYYDGLGRRVASKSSLGQTSLYYDLQGHLIMELSSGEEYYVACDNTGTAVFSSRGQVIKEILYTPYGDIYHDT. 249
20 -19.400sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3  ali   35YTMVQDQLRNSYQIGYDGSIIYASGLDSHYQTEAKRNMTLPGENGQNLVEQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLRIAYDTSGHPTLWLPSSKAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVRVFADGKTWSYTYLEKSM-VLLLHSQRQYIFEYDMWDRLSITMPSVARHTMQTIRSIGIYNPPESNASIITDYNEEGLLL---------QTAFLGTSRRVLFKY 300
21 -18.100sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2  ali   1.........VQYKMDEDGFLRQR--GGDIFEYNSAGLLRYRYDGLGRRVSSKSSHSHHLQFFYADSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMQILYTAYGEIYMDTNPNFQIIIGYDLAGRWTSPDHELWKHLSSSNVMPFNLYM--KNNNPISNSQDIKCFM-TDVNSWLLTFGFQLHNVIPYPKPDMDAMEPSYELIHTQMTQEWDNSKSILGVQCEVQKQLKAF 283
22 -16.000sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3  ali   10  3RITRLGD--VQYKIDDDGYLC------------QRGSDIFEYNSKGLLTRAYNK---------ASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNHVYNHSNSEITSLYYDLQGHLFMESSSGEEYYVASDNTGTPLAVFSINGLMQLQYTAYGEIYYDSNPDFQMVIGF....................................................................... 161
23 -10.600sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4  ali   2.......................................................................................DSQMLASSTMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATSTMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGS. 158
24 -9.670sp|Q9HC77|CENPJ_HUMAN Centromere protein J OS=Homo sapiens GN=CENPJ PE=1 SV=2  ali   18  106...........................................PDGKVEKVYKN---CRVILFPNGTRKEVSAD--GKTITVTFFNGDVKQVMPD--QRVIYYYAAAQTTHTTYPE-GLEVLHFSSGQIEKHYPD--GRKEITFPDQTVKNLFPD--GQEESIFPDGTIVRVQRD--GNKLIEFNNGQRELHTAQ---FKRREYPDGTVKTVYAN--GHQETKYRSGRIRVKDKE--GNVLMDT. 286

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 8 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.