current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343] (Range: 1-245), from B.fragilis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 -27.700sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 (Range: 1501-1800)  ali follow..  13..CDCKNDANCDCFSGDDGKDAKLNTPSSLAVCADGELYYLFDTTGKHLYTQSLPTGDYLY--------NFTYTGDGDITLITDNNGNMVNVRRDSTGMPLLVVPDGQVYWVTMGTNSALKVTTQGHELAMMTYHGNSGLLATNENGWTTFYEYDSFGRLTVTFPTGQVSSFRSDTDSSVHVQVETSSKITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAGTVN. 292
2 -26.300sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 2101-2400)  ali follow..  10  7.ISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIISKHFDTHGRIKEQYDSMGRVIKRELKLGTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVMPLRYDLRDRITRLGDQRGSDIFEYNSKGLLTYNKASGWSVQYRYDGVGRRAYKTNLGHHLQYFYSDLHNPTYNHSNSEITSLYYDLQGHLFMESSSGEEYYVASDNTGTPLVFSINGLMIQLQYTAYGEIYYD.. 300
3 -25.700sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 (Range: 2101-2400)  ali follow..  12  1..TPLP--IDLYRYDDVSGKTEQFGKFGVIYYDINQIITKHFDAYGRMKEQYDNMGRVVKKELKVGTRYSYEYDADGQLQTVSINDKPLWRYSYDLNGNLHSPGNSARLTPLRYDIRDRITRLGDQRGGDIFEYNSAGLLAYNRAGSWSVRYRYDGLGRRVSKSSHSHHLQFFYADLTNPTYNHSSSEITSLYYDLQGHLFMELSSGDEFYIACDNIGTPLVFSGTGLMIQILYTAYGEIYMDT. 292
4 -24.600sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2 (Range: 1501-1800)  ali follow..  36.IASPADQ-ELYQFTVNGTHLH-----TLNLITRDYVYNFTYNSEGDL----------GAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKVSAQGYNLALMTYPGNTGLLATNENGWTTVYEYDPEGHLTATFPTGEVSSFHSDLEKLTKVEKQENTQSTYRVNPDGSLRVTFASGMEIGLSSEPHILAGAVNPTLGKCNISGEHNANLIEWRQRKEQNKGNVSAFERRLRAH. 292
5 -24.500sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 (Range: 1801-2100)  ali follow..  30RLRVHNRNLLSLDFDRVTRTEK--KFTLRILYDQAGRVNVTYSPGGYIAG-----------IQRGIMSERMEYDQAGRITSRIFADGKTWSYTYLEKSMVLLLHS-QRQYIFEFDKNDRLSSVTMPNVARQETIRSVGYYRNPPEGNASVIQDFTEDGHLLFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGMLKTQNEGFTCTIRYRQIGPLIDRQIVNARFDYNYDNSFRVTSMQ. 295
6 -24.000sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 1501-1800)  ali follow..  11  3.QVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDNSPSSLAVAPDGTIYIADLGNIRIRAVAASPGEQELYVFNADGIHQYTVSTGEYLYNFTYSTDNDVTLIDNNGNSLKIRRDSSGMPRLLMPDNQIITLTVGTNGGLKVSTQNLELGLMTYDGNTGLLATDETGWTTFYDYDHEGRLTVTRPTGVVTSLHREMEKSSYTVVQDQVRNSYQLCNNGTLRVMYANGMGISFHSEPHVLAGTIT. 300
7 -23.800sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2 (Range: 1801-2100)  ali follow..  10IYDDHRKFTLRILYDQTGRPILSRYNEVNITYSPSGLVKMEYDQSGKIISRTWADGKIWSYLLHSQRRYIFEYDQPDCLLSVTMPSMVRHSLQTMLSVGIYTPPDSSTSFIQDYSRDGRLLLHLGTGRRVLYKYTKQARLSEVLYDTTQVTLTYEESSGVIKTMHDGFICTIRYRQTGPLI-EGLVNARFDYSYNNFRVTSMQAVINETPLYRYVDVSGRTEQ----GKFSVINYDLNQVITTT. 294
8 -23.700sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 1801-2100)  ali follow..  60IYDDHRKFTLRIIYDQVGRPFLWLPS------SGLAAVNVSYFFNGRLAG-----------LQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDKSMV-LLLQSQRQYIFEYDSSDRLLAVTMPSVARHSTHTSIGYIRNPPESNASVIFDYSDDGRILSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMQSGGFSCTIRYRKIGPLVDKQIVNARFDYTYHDNSFRI.... 300
9 -23.000sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3 (Range: 1951-2250)  ali follow..  12  12.....DSTRVSFTYDETAGVLKSDGFICTIRYRQIGPLDYSYDNSFRVTSMQGVINDISGKVEQFGKFGVIYYDINQIIS----TAVMTYTKHFDAHGRIKEIQYEIFRSTIQYDNMGRVTKREANTTKYAYEYDVDGQLQVYLNEKIMWRYNYDLNGNLHNPSNSARLTPLRYDLRDRIT----RLGDVQYRLDEDGFLRQR----GTEIFEYSSKGLRVYSKGSGWTVIYRYDGLGRRVSSKY 300
10 -22.400sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 1651-1950)  ali follow..  2....PDNQIITLTVG-------TNGGLKVVSTQNLELGLMTYDGNTGLL---------ATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDVQDQVRNSYQLCNNGTLRVMYANGMGISFHSEPHVGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTIIYDQVGRPFLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVRMFADGKVWSYSYLDKSMVLL... 294
11 -22.400sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 (Range: 1651-1950)  ali follow..  13.VTTQGHELAMMTYHGNS------GLLATKSNENGWTTFYEYDSFGRL----------TNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDTTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLGRRLRVHNRNLLSLDFDRVTRKIYDDHRKFTLRILYDQAGRPSSPSSRLNGVNVTYSPGGYIAGIQRGIMSERMEYDQAGRITRIFADGKTWSYTYLEKSMVLLLEF 297
12 -22.200sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 (Range: 1951-2250)  ali follow..  13  31..PPEGNASVIQDFTEDGHLLHGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGMLKTINNEGFTCTIRYRQIGPLIDREGMVNARFDYNYDNSFRVTSMQAVINETPDLYRYDDVSGKTEQFGKFGVIYYDINQIIT---TAVMTHTKHFDAYGRMKEVQYEIFRSTVQYDNMGRVV-PYANTTRYSYEYDADGQLQVSINDKPLWRYSYDLNGNLHSPGNSARLTPLRYDIRDRIT.... 296
13 -21.900sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2 (Range: 1951-2250)  ali follow..  11  10.LHLGTGRRVLYKYTKQAREVLYDTTQVTLTYEESSICTIRYRQTGPLIGRYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVIT---TTVMKHTKIFSANGQVIILKAIAYWMTIQYDNVGRMVICDANITRYFYEYDADGQLQVSVNDKTQWRYSYDLNGNLLSHGKSARLTPLRYDLRDRITR-----GEIQYKMDEDGFLRQR----GNDIFEYNSNGLLQKAYY 300
14 -21.800sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3 (Range: 1801-2100)  ali follow..  10WLPSSKLMAVNVTYSSTGQIAS--------IQRGTTSEKVDYDGQGRIVSRVFADGKTWSYTLHSQRQYIFEYDMWDRLSAITMPSVARHTMQIRSIGYYRNIPESNASIITDYNEEGLLLAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGTVNLQSDGFICTIRYRQIGPLIDRGMVNARFDYSYDNSFRVTSMQGVINETLYQFDDISGKVEQSTAVMTYTKHFDAHGRIKEIQY 292
15 -21.700sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2 (Range: 1651-1950)  ali follow..  11  1.........TVYEYDPEGHATFPTGEVSSFHSDLEKLTKVELDTSNRSLRVTFASGMEIGLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKERRLRAHNRNLLSIDFDHITRTGKIYDDHRKLRILYDQTGRPISPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQSGKIIRTWADGKIWSYTYLEKS-VMLLLHSQRRYIFEYDQPDCLLVTMPSMVRHSLQTMLSVGYYRNIY 287
16 -20.800sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3 (Range: 1501-1800)  ali follow..  1..........NKPLLNSMNFYE---------ASPTDQELYIFDINGTHQYTVSLVTGDYLY--------NFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVVVSPDNQVIWLTIGTNGCLKMTAQGLELVLFTYHGNSGATKSDETGWTTFFDYDSEGRLTVTFPTGVVTNLHGDMDKATVDIESSSREEDVSITSNLSSIDSFQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLA..... 224
17 -20.500sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 1951-2250)  ali follow..  13  2..........IFEYDSSDRLLAPSVARHSMSTESNASVIFDYSDDGRILKTSF---------LGTGRQVFYKYGKLSKLSEIVYDST-AVTFGYDETTGVLKMQSGGFSCTIRYRKIGPLVDKQIVNARFDYTYHDNSFRIASEHFGKFGVIYYDINQIIT---TAVMTLSKHFDTHGRIKEVQYEMFRSTVQYDSMGRVIKREANTTKYTYDYDGDGQLQVAVNDRPTWRYSYDLNGNLHLLRY 298
18 -20.500sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3 (Range: 2101-2400)  ali follow..  12  2.........ITIQYDNMGRVTK---EIKIGPFANTTKYAYEYDVDGQL----------QTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTLRYDLRDRITRLGD----VQYRLDEDGFLRQR----GTEIFEYSSKGLLVYSKGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTHVYNHSSSEITSLYYDLQGHLFMEISSGDEFYIASDNTGTPLAVFSSNGLMLIQYTAYGEIYFDS. 228
19 -19.700sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=ODZ1 PE=1 SV=2 (Range: 2101-2400)  ali follow..  10  1............IFSANGQVIE----QYEILKAIAYWMTIQYDNVGRMVICDIRVG-----VDANITRYFYEYDADGQLQTVSVNDKTQWRYSYDLNGNINSHGKSARLTPLRYDLRDRIT----RLGEIQYKMDEDGFLRQR----GNDIFEYNSNGLLAYNKASGWTVQYYYDGLGRRVASKSSLGQTSLYYDLQGHLIMELSSGEEYYVACDNTGTAVFSSRGQVIKEILYTPYGDIYHDT. 249
20 -19.400sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=ODZ3 PE=2 SV=3 (Range: 1651-1950)  ali follow..  35YTMVQDQLRNSYQIGYDGSIIYASGLDSHYQTEAKRNMTLPGENGQNLVEQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLRIAYDTSGHPTLWLPSSKAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVRVFADGKTWSYTYLEKSM-VLLLHSQRQYIFEYDMWDRLSITMPSVARHTMQTIRSIGIYNPPESNASIITDYNEEGLLL---------QTAFLGTSRRVLFKY 300
21 -18.100sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=ODZ4 PE=2 SV=2 (Range: 2251-2550)  ali follow..  1.........VQYKMDEDGFLRQR--GGDIFEYNSAGLLRYRYDGLGRRVSSKSSHSHHLQFFYADSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMQILYTAYGEIYMDTNPNFQIIIGYDLAGRWTSPDHELWKHLSSSNVMPFNLYM--KNNNPISNSQDIKCFM-TDVNSWLLTFGFQLHNVIPYPKPDMDAMEPSYELIHTQMTQEWDNSKSILGVQCEVQKQLKAF 283
22 -16.000sp|Q9NT68|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=ODZ2 PE=1 SV=3 (Range: 2251-2550)  ali follow..  10  3RITRLGD--VQYKIDDDGYLC------------QRGSDIFEYNSKGLLTRAYNK---------ASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNHVYNHSNSEITSLYYDLQGHLFMESSSGEEYYVASDNTGTPLAVFSINGLMQLQYTAYGEIYYDSNPDFQMVIGF....................................................................... 161
23 -10.600sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4 (Range: 751-1050)  ali follow..  2.......................................................................................DSQMLASSTMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSTMDSQMLATSTMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGS. 158
24 -9.670sp|Q9HC77|CENPJ_HUMAN Centromere protein J OS=Homo sapiens GN=CENPJ PE=1 SV=2 (Range: 1051-1338)  ali follow..  18  106...........................................PDGKVEKVYKN---CRVILFPNGTRKEVSAD--GKTITVTFFNGDVKQVMPD--QRVIYYYAAAQTTHTTYPE-GLEVLHFSSGQIEKHYPD--GRKEITFPDQTVKNLFPD--GQEESIFPDGTIVRVQRD--GNKLIEFNNGQRELHTAQ---FKRREYPDGTVKTVYAN--GHQETKYRSGRIRVKDKE--GNVLMDT. 286

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.