current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681243|ref|YP_211387.1| hypothetical protein (BF1751) [Bacteroides fragilis NCTC 9343] (Range: 1-157), from B.fragilis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MDKEQFKSIVHPVMKANSFRRKGNSWYKTTAECIVVFNLQHSLYGKMFYINLAALLRKGDDLLFPKEYQCDIRMRFPIMEIEGYSTQMILDLESTIDEQLRSRLIENIINISIPILQKLESIDGIIELYGEKPELNNIYPFSSILYRKEMNNKLKAILast
1 -7.490sp|Q5T011|SZT2_HUMAN Protein SZT2 OS=Homo sapiens GN=SZT2 PE=2 SV=3 (Range: 301-600)  ali follow..  13  96..PADLVSTVSVRLRE-GYSVREVTLAKGGSQLEVKLVLL---WKHNMRIEYVAMAPWPLEPEGPRVTRVEVTME--------GGYDILHDVSCALRQPIRSLYRTHVIRRFWNTLQSINQTDQMLAHLQS.......................... 212
2 -7.080sp|Q13428|TCOF_HUMAN Treacle protein OS=Homo sapiens GN=TCOF1 PE=1 SV=3 (Range: 1-300)  ali follow..  1MKRRELLPLIYHHLLRAGYVRAAREVKEQSGQ............................................................................................................................. 36
3 -6.700sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 (Range: 601-816)  ali follow..  10  22VKKQSQLSLLDYFLQEHGFLSAQRNFVQSCAGYCLVCNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKL 204
4 -6.260sp|Q8N3P4|VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens GN=VPS8 PE=1 SV=3 (Range: 901-1200)  ali follow..  10  32.REEEVFNYIHNILSIPGHSAEEKQSVWQKDHIEELVSLKPCKAAELVATHFSGHIETVIKKLQNQVLLFKFLRSLLDPREGIHVNQELLQISPCITEQFIELLCQFNPTQVIETLQVLERLEETIQITQKYQLHE-----VTAYLLEKKGDIHGAF 186
5 -6.260sp|Q96DY7|MTBP_HUMAN Mdm2-binding protein OS=Homo sapiens GN=MTBP PE=1 SV=1 (Range: 751-904)  ali follow..  13  80.HTRILKEVVTETLKKHSITETHECFTACSQRLFEISDLKTSRGLFEEMKKTA........................................................................................................ 136
6 -6.250sp|Q9UG01|IF172_HUMAN Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2 (Range: 601-900)  ali follow..  194.ANTELVEHITAALIKGELYERAGDLFEKIHNPQKALECKGNAFMKAVEL----------------------------------------------ARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIE-----AALGARQWKKAI 300
7 -6.220sp|A8K979|ERI2_HUMAN ERI1 exoribonuclease 2 OS=Homo sapiens GN=ERI2 PE=2 SV=2 (Range: 1-300)  ali follow..  1MATKRLARQLGLIRRKSIAPANGNLGRSKSKDYLIVIDFESTCWNDG-IIEFPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKWI............................................. 121
8 -6.040sp|Q9UG01|IF172_HUMAN Intraflagellar transport protein 172 homolog OS=Homo sapiens GN=IFT172 PE=1 SV=2 (Range: 1201-1500)  ali follow..  130.RNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAEGEEWNKAKRV-------------------------AKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQNYKILHKYVALATHLIREGSSAQAL 263
9 -5.930sp|Q8IWG1|WDR63_HUMAN WD repeat-containing protein 63 OS=Homo sapiens GN=WDR63 PE=2 SV=1 (Range: 1-300)  ali follow..  13  69INKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYLIATNYLNPPEVPEEQEEYKEHIPEDVYIYKPPVSKPWVSLGSEKEIEEESVTESTKQITYMISRKRSEFGAPIKFSD.............................. 200
10 -5.900sp|Q9ULN7|PNML2_HUMAN PNMA-like protein 2 OS=Homo sapiens GN=PNMAL2 PE=2 SV=2 (Range: 1-300)  ali follow..  10  30LEQADVEAVLQPTLLPLGFRLRHMKALMNEKAQAALVEFVED-------VNHAAIPREI---------------------PGKDGVWRVLWKDRAQDTRVLRQMRRLLLDD.............................................. 113

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.