current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681243|ref|YP_211387.1| hypothetical protein (BF1751) [Bacteroides fragilis NCTC 9343] (Range: 1-157), from B.fragilis

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MDKEQFKSIVHPVMKANSFRRKGNSWYKTTAECIVVFNLQHSLYGKMFYINLAALLRKGDDLLFPKEYQCDIRMRFPIMEIEGYSTQMILDLESTIDEQLRSRLIENIINISIPILQKLESIDGIIELYGEKPELNNIYPFSSILYRKEMNNKLKAILast
1 -6.770sp|Q9P260|K1468_HUMAN LisH domain and HEAT repeat-containing protein KIAA1468 OS=Homo sapiens GN=KIAA1468 PE=1 SV=2 (Range: 255-403)  ali follow..  1.EKRALNFLVNEFLLKNNYKLTSITFSDENDD............................................................................................................................. 31
2 -5.940sp|Q9Y6X0|SETBP_HUMAN SET-binding protein OS=Homo sapiens GN=SETBP1 PE=1 SV=3 (Range: 1032-1093)  ali follow..  23  2...........PFLQGFSYPIPSGSYYAP----------YGMPYTSMPMMNLGYY...................................................................................................... 35
3 -5.520sp|A6NGR9|CH073_HUMAN Putative uncharacterized protein C8orf73 OS=Homo sapiens GN=C8orf73 PE=2 SV=2 (Range: 107-282)  ali follow..  11  20AGTQATVLTLSSALEARG-----ERLEDQVHALVRGLLAQVPSLAEGRPWRAALRVLSALALEHARDVVCALLPRSLPADRVAAELWRSLSRNQRVNGQVLVQLLWALKGASGPEPQALAATRALGEMLAVSGCVGATRGFYPHLLLALVTQLHKLA 171
4 -5.430sp|P48553|TPC10_HUMAN Trafficking protein particle complex subunit 10 OS=Homo sapiens GN=TRAPPC10 PE=1 SV=2 (Range: 1-428)  ali follow..  96.DTEVYKATVKDDLTK--WQNVLKAHSSVDWLIVIVENDAKKKNKTNILPRTSIVDK--------------IRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFTNLGKFEDDMRTLREKRTEPGMVQEELAFVFEMLQQFEDAL 243
5 -5.310sp|Q9H7D7|WDR26_HUMAN WD repeat-containing protein 26 OS=Homo sapiens GN=WDR26 PE=1 SV=3 (Range: 124-301)  ali follow..  1..DEDVIRLIGQHLNGLGLNQTVDLLMQESG.............................................................................................................................. 29
6 -5.230sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 (Range: 505-565)  ali follow..  10  18.LTSIYRPFVDKALKQMGLRKLILRLHKLMDGSLQRARI...................................................................................................................... 55
7 -5.130sp|Q8IWG1|WDR63_HUMAN WD repeat-containing protein 63 OS=Homo sapiens GN=WDR63 PE=2 SV=1 (Range: 38-126)  ali follow..  14  32INKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYGLNFYL........................................................................................................... 81
8 -5.110sp|P48995|TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens GN=TRPC1 PE=1 SV=1 (Range: 256-350)  ali follow..  4.....................................................................................................EELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAI 59
9 -5.110tr|E9PPP7|E9PPP7_HUMAN Uncharacterized protein OS=Homo sapiens GN=C8orf73 PE=4 SV=1 (Range: 107-270)  ali follow..  11  20AGTQATVLTLSSALEARG-----ERLEDQVHALVRGLLAQVPSLAEGRPWRAALRVLSALALEHARDVVCALLPRSLPADRVAAELWRSLSRNQRVNGQVLVQLLWALKGASGPEPQALAATRALGEMLAVSGCVGATRGFYPHLLLALV....... 164
10 -4.960sp|Q96PV4|PNMA5_HUMAN Paraneoplastic antigen-like protein 5 OS=Homo sapiens GN=PNMA5 PE=2 SV=2 (Range: 1-109)  ali follow..  30CSEVEIQDTVKAGLQPLCYRVLGRMFRREDNAKAVFIELADTVNYTTLPSHIPGKGGSWEVVVKPRNPDDEFLSRLNYF.............................................................................. 109

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.