current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683425|ref|YP_213569.1| 30S ribosomal protein S14 (BF3990) [Bacteroides fragilis NCTC 9343] (Range: 1-99), from B.fragilis

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MAKESMKAREIKRAKLVAKYAEKRAALKQIVRTGDPAEAFEAAQKLQELPKNSNPIRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASWLast
1 -7.660sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 (Range: 2455-2663)  ali follow..  15  48..KELFRQQEAVRGKLRLQHSIEREKLIVSCEQEILRVHCRAARTIANQAVPFSACTMFNARQFISWLQDVDDKYDRMKTCLRQQHEAAALNAVQRMEW 170
2 -5.990sp|C9J6K1|CS081_HUMAN Putative uncharacterized protein C19orf81 OS=Homo sapiens GN=C19orf81 PE=4 SV=1 (Range: 51-144)  ali follow..  19  2.............RQVIAEYEALDRELPCIRKFPTPPASQPLCLCMETLP-EEDFTHLEVLQALEAQLPGAMESGRVSSIRFENMNVICGTAGR-RNRW 85
3 -5.620tr|A6NI33|A6NI33_HUMAN Uncharacterized protein OS=Homo sapiens GN=PGAP1 PE=4 SV=2 (Range: 82-182)  ali follow..  3.........DADTKQITQNSKKKLSVLYHHFIRHPSKHFEENPAIISDLTGTSMWVLVKVSKWTYVAYNESEKIYFTFPLENHRKIYT-QSTMLDTNSW 95
4 -5.380sp|Q6ZU69|F205A_HUMAN Protein FAM205A OS=Homo sapiens GN=FAM205A PE=2 SV=4 (Range: 656-743)  ali follow..  23  12............................................HLLTQVKAILQSHIDSKC----------------------QIHQGKIPACVHRSW 45
5 -5.380sp|Q63HN1|F205B_HUMAN Protein FAM205B OS=Homo sapiens GN=FAM205B PE=2 SV=1 (Range: 386-473)  ali follow..  23  12............................................HLLTQVKAILQSHIDSKC----------------------QIHQGKIPACVHRSW 45
6 -5.200sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens GN=USP9X PE=1 SV=3 (Range: 1191-1260)  ali follow..  22  8.........................................LQSALQSIPNPSSECMLRNVSVRLAQ--------QISDEASRYMPDICVIRAIQKIIW 57
7 -5.150sp|O60287|NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens GN=URB1 PE=1 SV=4 (Range: 989-1084)  ali follow..  19  2......LDMESVASLELANDQTLEEVLVAILRHPTL-EGWFLALEQQALPPHTSPVLVKLLA--THFSAGVLQLLAASAPILQNIGQLGLLARYSEA.. 90
8 -4.900sp|Q9H2M9|RBGPR_HUMAN Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens GN=RAB3GAP2 PE=1 SV=1 (Range: 74-349)  ali follow..  14  18IAREQKAV--LVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPKRSSTGRPDWTCIVVGFTSGYVRFYT-GVLLLAQLLNEDPVLQLK.... 116
9 -4.820sp|Q9BUA3|CK084_HUMAN Uncharacterized protein C11orf84 OS=Homo sapiens GN=C11orf84 PE=1 SV=3 (Range: 77-139)  ali follow..  10  15.............................................................CMVCGAEIRAPSADTARSHILEQHPHTLDLSPSEKSAW 56
10 -4.790sp|Q14814|MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens GN=MEF2D PE=1 SV=1 (Range: 310-364)  ali follow..  10  6....................................................ATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLNVTAW 55

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.