current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683563|ref|YP_213707.1| putative SufE Fe/S-cluster-related protein (BF4142) [Bacteroides fragilis NCTC 9343] (Range: 1-142), from B.fragilis

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MSINELQDEVVAEFSDFDDWMDRYQLLIDLGNEQEPLDEKYKTEQNLIEGCQSRVWLQADEVDGKIIFKAESDALIVKGIIALLIKVVSGHTPDEILNSELYFIDKIGLKDHLSPTRSNGLLSMVKQMRMYALAFKAKEAKGLast
1 -5.660tr|Q8WVX6|Q8WVX6_HUMAN Uncharacterized protein OS=Homo sapiens GN=WAPAL PE=2 SV=1 (Range: 326-402)  ali follow..  13  2......................................................................HMEDCIVASYTALLLEYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEH............ 76
2 -5.560sp|Q7Z5K2|WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens GN=WAPAL PE=1 SV=1 (Range: 1112-1190)  ali follow..  13  4......................................................................HMEDCIVASYTALLLEYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEH............ 78
3 -4.260sp|Q14699|RFTN1_HUMAN Raftlin OS=Homo sapiens GN=RFTN1 PE=1 SV=4 (Range: 279-388)  ali follow..  13  20VTIPLHVSKNGQTVSGLDNWLEHMSDHFRKGGMLVNAVFYLGIVNDSLHGLTDGVFIFEAVSTEDSKTIQGYDAIVVEQWTVL........................................................... 103
4 -4.140sp|Q9UHC7|MKRN1_HUMAN E3 ubiquitin-protein ligase makorin-1 OS=Homo sapiens GN=MKRN1 PE=1 SV=3 (Range: 415-482)  ali follow..  15  2...................................................RNHFWELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEW....................................... 53
5 -4.100sp|P42858|HD_HUMAN Huntingtin OS=Homo sapiens GN=HTT PE=1 SV=2 (Range: 2498-2622)  ali follow..  14  2........................................................................NVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKREN. 70
6 -3.970sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens GN=KIF14 PE=1 SV=1 (Range: 1236-1536)  ali follow..  12  73IQTACAFEQLVVLMKHWLSDLLPCTNIARLEDELRQEVKKLGGYQLFLQGCCLDISSMIKEAQKNAIQIVQQAVKYV-GQLAVL-------KGSKLHFLENGNNKAASVQEEFMDAVCDGVGLGMKILLDSGLEKAKELQH. 206
7 -3.970tr|F8W1V5|F8W1V5_HUMAN Uncharacterized protein OS=Homo sapiens GN=ATP2B1 PE=4 SV=1 (Range: 28-101)  ali follow..  15  7...................................................................................LRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGEFY................... 46
8 -3.840sp|Q9P2D8|UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens GN=UNC79 PE=2 SV=3 (Range: 941-1210)  ali follow..  101...ADIFWTIINGNFNSKDWKMRFEAVEKVAVICRFLDIHSVTKNHLLKYSLAHAFFLTAVEDVNPAVATRAGLTIKRPALQGLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCN 244
9 -3.720sp|Q8IZ81|ELMD2_HUMAN ELMO domain-containing protein 2 OS=Homo sapiens GN=ELMOD2 PE=1 SV=1 (Range: 1-111)  ali follow..  13...........................................................................FFRFWMKWLLRQMTGKELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDD.... 76
10 -3.700sp|Q96ER9|CCD51_HUMAN Coiled-coil domain-containing protein 51 OS=Homo sapiens GN=CCDC51 PE=1 SV=2 (Range: 57-180)  ali follow..  12  68EVHQAKLKEVRDRLDRVSREDSQYLELATLEHRMLQEEKRLRTAYLRAEDSEREKF...................................................................................... 123

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 5 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.