current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680681|ref|YP_210825.1| hypothetical protein (BF1156) [Bacteroides fragilis NCTC 9343] (Range: 1-221), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MKPTIKKVQPVKVVAPFLNSQSESPVPLDALTDQEKVSDLYFLKGTVHQIAKPYLSINNCTFKQQIFSECQFKSAQLTDVRFENCDLSNVSFAGTTFYRVEFISCKLLGTGFLEATLNHVLMDHCYGQYINLSMVKMRTARFSHCNFRNGSLNDSKLMPAAFDTCELLEADFSHTSLKGIDLRNSRIAGIQLNIADLKGAIVSSLQAIDLLPLLGVKIEDDLast
1 -73.3002w7z_A mol:protein length:214 PENTAPEPTIDE REPEAT FAMILY PROTEIN  ali model follow..  24  2..SHMKITYPLPPNLPEQLPLLTNCQLED----EAILENHLYQQIDLPNQEVRNLVFRDAVFDHLSLANGQFASFDCSNVRFEACDFSNVEWLSGSFHRVTFLRCNLTGTNFADSYLKDCLFEDCKADYASFRFANFNLVHFNQTRLVESEFFEVTWKKLLLEACDLTESNWLNTSLKGLDFSQNTFERLTFSPNYLSGLKVTPEQAIYLASALGLVI... 213
2 -71.3002xt4_A mol:protein length:194 MCBG-LIKE PROTEIN  ali model follow..  20  1..........................MPAKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQAGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELSD. 194
3 -68.4006fls_A mol:protein length:239 Pentapeptide repeat family protein  ali model follow..  24  24............IPADLIMVDDFSSYAQGYLYEEIPITQIKIYGEHIEYFDFSKSEINTSIFENCTFLDCSFEGASFVDVVFQNCNLSNSNFTDAYFERCQFIACKCVGVNMIDTIFKQTSMQRSNFQYSYFDKAKMTDIAFEDIDFTEVSITEAKLKRFKAKNSHFIKNNFFKTMLTGVDFTKNELVAPTVSSPEFQGAKISMVQAADLIGLWGIIVEQ. 233
4 -67.2002xt2_A mol:protein length:200 MCBG-LIKE PROTEIN  ali model follow..  21  1..........................MPAKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQWPSVSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELSD. 200
5 -62.8002bm4_A mol:protein length:186 PENTAPEPTIDE REPEAT FAMILY PROTEIN  ali model follow..  21  5.......................................QQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA.. 184
6 -58.2003pss_A mol:protein length:216 Qnr  ali model follow..  18  2................IKDKCFEGVRFEQQDLEGEQFQGCRFIGCNFSWLDLAECRFVDCSFYDRESQSCLLQGCDLREASFLRCDLTMADCSRSQCLGLELRDCQALGINFSRASFANAHLTGNNFSYANFEGCLLEQCELSGNRWQGANLFGASLAGSDLSGSEFGQIDWASVNLQGCDLRQCDLPGLDLRRVNLDGVQINEDQQQALLEQIGLIV... 214
7 -58.0002xtw_A mol:protein length:217 QNRB1  ali model follow..  19  4.................MALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMNAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAV... 215
8 -56.0004yc5_A mol:protein length:235 beta1  ali model follow..  14  18........GEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLA.. 228
9 -55.7004yfo_A mol:protein length:259 beta1_ex1  ali model follow..  14  32..QHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGADLNGADLKQADLSGADLGGANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG. 249
10 -55.0005dra_A mol:protein length:219 3beta1  ali model follow..  17  1............MGSSSSGLVPRGSHMNGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQANLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG. 209
11 -54.9005di5_A mol:protein length:246 beta1 t801 loop variant  ali model follow..  16  15MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLRGANLEEANLEAANLRGADLIGANLSGADLQEANLTQAQLGLGGGLGADLSDANLEQADLAGANLAGAVLDGANLHGANLNNANLDYAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG. 237
12 -54.8005dn0_A mol:protein length:247 beta1 t1555 loop variant  ali model follow..  15  15MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGADLAGANLSGADLQEANLTQAMLGDGVVYGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG. 237
13 -54.6005dqa_A mol:protein length:247 t3284  ali model follow..  16  15MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLEGANLEEANLEAANLRGARLAGANLSGADLQEANLTQANLGGPGDPGADLSDANLEQADLAGANLAGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG. 237
14 -54.1005dns_A mol:protein length:247 t1428 beta1 loop design  ali model follow..  16  15MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNANLSHANLSGANLEEANLEAANLRGANLVGANLSGADLQEANLTQAMLGQTGTVGADLSDANLEQADLAGAQLVGAVLDGANLHGANLNNANLDNAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG. 237
15 -52.4002j8k_A mol:protein length:201 NP275-NP276  ali model follow..  21  1.................MGSSSSGLVPRGSHMDVEKLRQLYAAGRDFSIVDLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGGNNNLAT.......... 195
16 -51.7003du1_X mol:protein length:257 All3740 protein  ali model follow..  16  15MNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYADLRQTRLGKSNFSHTCLREADLSEAILWGIDLSEADLYRAILREADLTGAKLVKTRLEEANLIKASLCGANLNSANLSRCLLFQADLRPSSNQRTDLGYVLLTGADLSYADLRAASLHHANLDGAKLCRADLSGASLQGADLSYANLESAILRKANLQGADLTGAILKDAAIMPDGSIHD. 251
17 -45.3002f3l_A mol:protein length:184 RFR-Domain  ali model follow..  15  2......................................................SSGLVPRGSGMKETAAKFERQHMDSPDL-GTDDDDKAMAMVTGSSASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLDRADGVNPKT. 167
18 -42.0002o6w_A mol:protein length:150 Repeat Five Residue (Rfr) protein or pentapeptide repeat protein  ali model follow..  12  3................................................TNNLYRLELE-RECVGCNLEGVNLPRENFGLKYR--IPRSSSPLVTTPFGMDKAKPVDLTRANLSNANLYQSDLSSIILENAILVETNLSETDLENAILIGANLQGANLENANLQGANLENANLRGAILTGVNLEETHLKGIETDKNTVW....................... 149
19 -39.2003n90_A mol:protein length:152 Thylakoid lumenal 15 kDa protein 1, chloroplastic  ali model follow..  19  1.....................................................................AFKGGGPYGQGVTRGQDLSGKDFSGQTLIRQDFKTSILRQANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGATMGNTSFKGSNITGADFTDVPLRDDQRVYLC---KVADGVNATTGNATR--DTLLCNLE.. 146
20 -37.8004jra_C mol:protein length:136 Synaptic vesicle glycoprotein 2C  ali model follow..  13  3.......................................................KGSLVPRGSDVIKPLQSDEYALLTRNVERDKYANFTI-NFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNKTG........................................... 124
21 -37.7005jw7_A mol:protein length:282 E3 ubiquitin-protein ligase SopA  ali model follow..  11  27.......................AKKLTDAVLRQKAGETLTAADRDFSNADFRNITFSKILPPSMERDGDIIKGFNFSNSKFTYSDISHLHFDECRFTYSTLSDVVCSNTKFSNSDMNEVFLQYSIT---TQQQPSFIDTTLKNTLIRKANLSGVILNEPDNSSPPSVSGGGNFIRLGDIWLQMPLLWTENAVDGFLNHEHNNGKSILMTIDSLPDKYSQ. 222
22 -37.6005jmc_B mol:protein length:124 Synaptic vesicle glycoprotein 2C  ali model follow..  13  4............................................................VIKHLQSDEYALLTRNVQKDKYANFSIN------FTMENQVHTGMEYDNGRFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDTLFENTDFEPYKFIDSEFQNCSFLHNKTGCQITFDDDY.................................. 124
23 -35.7006es1_B mol:protein length:117 Synaptic vesicle glycoprotein 2C  ali model follow..  14  2..................................................................SSGVDLGTENLYFQSMERDKYANFTI-NFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK............................................. 110
24 -35.1005jlv_C mol:protein length:117 Synaptic vesicle glycoprotein 2C  ali model follow..  14  1....................................................................SSGGGSGGGIEGRVERDKYANFTI-NFTMENQIHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNCSFFHNK............................................. 107
25 -29.5003sqv_A mol:protein length:616 secreted effector protein  ali model follow..  14  1......................SNASQGRACLSKAELTADLLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIR-ALFENSNFSNSNLKNASFKGSSYIQPILNEADLTGAIIPGMVLSGAILGDVKLFSEKSNTINLGGCYIDLSDIQENILS.................. 186
26 -28.5002qyu_A mol:protein length:627 Secreted effector protein  ali model follow..  11  1.....................MATSSPSSPADWAKKLTDAVLRQKAGETLTAADRDFSNADFRNITFSKILPPSMERDGDIIKGFNFSNSKFTYSDISHLHFDECRFTYSTLSDVVCSNTKFSNSDMNEVFLQYSTQQQPSFIDTTLKNTLIRKANLSGVILNEPDNSSPPSVSGGGNFIRLGDIWLQMPLLWTENAVDGFLNHEHNNGKSILMTIDSLPD 204
27 -15.2003g06_A mol:protein length:622 SspH2 (Leucine-rich repeat protein)  ali model follow..  10  61..............AHITTLVIPDNNLTSLPALPPELRTLEVSGNQLTSLPVLPPGLLELSIFSNPLTHLPALPSGLCKLWIFGNQLTSLPVLPPGLQELSVSDNQLASLPALPSELCKLWAYNNQLTSLPMLPSGLQELSVSDNQLASLPTLPSELYKLWAYNNRLTSLPALPSGLKELIVSGNRLTSLPVLPSELKELMVSGNRLTSLSGLLSLSVYRN 271
28 -13.6004ow2_A mol:protein length:448 Yop effector YopM  ali model follow..  10  261...................................SLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPPSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPPSLVELDVRDNQLIELPALPPHLERLIASLNHLAEVPELPQNLKQLHVEHNALREFPDIPE...... 440
29 -12.3001g9u_A mol:protein length:454 OUTER PROTEIN YOPM  ali model follow..  238.........................FLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSQNLKQLHVETNPLREFPDIPESVEDLRMNSERVVDPYEFAHET.... 438
30 -9.9503cvr_A mol:protein length:571 Invasion plasmid antigen  ali model follow..  13  11..................................FSLSQNSFYNTISGTYADYFSAWDKWEKQALPGENRNEAVSLLKECQFSELQLNRLNLSSPQITVLEITQNALISLPELPASLEYLDACDNRLSTLPELPASLKHLDVDNNQLTMLPELPALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPELPESLEALDVSTNLLESL........... 195
31 -9.9105kh1_A mol:protein length:591 Invasion plasmid antigen  ali model follow..  11  66.................................QNQETNLDLSELGLTTLPEIPPGIKSINISKNNLSLISPLPASLTQLNVSYNRLIELPALPQGLKLLNASHNQLITLPTLPISLKELHVSNNQLCSLPVLPELLETLDVSCNGLAVLPPLPFSLQEISAIGNLLSELPPLPHNIHSIWAIDNMLTDIPYLPENLRNGYFDINQISHIPESI....... 246
32 -9.7603bz5_A mol:protein length:457 Internalin-J  ali model follow..  10  64..................................TGLTKLICTSNNITTLDLSQTNLTYLACDSNKLTNLDVTPTKLTYLNCDTNKLTKLDVSQPLLTYLNCARNTLTEIDVSNKKITKLDVTPTQLTTLDCSFNKITELDVSQKLLNRLNCDTNNITKLDLNQIQLTFLDCSSNKLTEIDVTPTQLTYFDCSVNPLTELDVSTLSKLTTLHCIQTDLLE. 268
33 -9.6304im6_A mol:protein length:206 NACHT, LRR and PYD domains-containing protein 1  ali model follow..  11  15.........................ILFSVLKVTRNLKELDLSGNSLSHSAVKTLRRPRCLLETLRLAGCGLTAEDLAFGLRANQTLTELDLSFNVLTDAGAKSCKLQRLQLVSCGLTSDCCQD--LASVLSASPSLKELDLQQNNLDDVGVRACKLIRLGLDQTTLSDEMR--QELRALEQEKPQLLIFSRRKPS......................... 206
34 -9.5405y3s_A mol:protein length:205 NACHT, LRR and PYD domains-containing protein 1  ali model follow..  12  13..................................QILFSVLKVTRNLKELDLSGNSLSHSAVKSL-CKTLRRPRCLLETLRLAGCGLTAEDCK--DLAFGLRANQTLTELDLSFNVLTDAGAK---CQRLRQPSCKLQRLQLVSCGLTSDCCQ--DLASVLSASPSLKELDLQQNNLDDVGVRGLRHPACKLIRLGLDQTTLSDEMRQELRALE....... 190
35 -9.2704nkg_A mol:protein length:246 E3 ubiquitin-protein ligase sspH1  ali model follow..  12  58...........................................................................HITTLVIPDNNLTSLPELPEGLRELEVSG-QLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLT...... 198

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.