current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343] (Range: 1-245), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 -27.6002fkg_A mol:protein length:320 Outer Surface Protein A  ali model follow..  10  12.LPGEMKVLVSKEKNKDGVDKLELKGTSDKNNGSGVLEGVKADKSKVK----------LTISDDLGQTTLEVFKEDGKTLVSKSKDKSSTEEKFNEKGELSITRADKSSTEEKFNEKGEKKITRADKSSTEEKFNEKGELSITRADKSSTEEKFNEKGEVSGTLTAEKTTLVVKEGTVTLSKNSKSGEVSVELNDTDSSAATKNSGTSTLTITVNSKKTDLVFTKENTITVQQYDSNGTKLEGS. 305
2 -27.3002af5_A mol:protein length:297 Engineered Outer Surface Protein A (OspA) with the inserted two beta-hairpins  ali model follow..  10  28.....GKYDLIATVDKLELKGT-----SDKNNGSGVLEGVKADKSKVKLTISDDLGQTTLEV-------FKEDGKTLVSKKVTSKDKSSTEEKFNEKGELSITRADKSSTEEKFNEKGELSITRADKSSTEEKFNEKGEVSEKIITRADTGIKSDGSGKAKEVLKAEKTTLVVKEGTVTLSNISKSGEVSVELNDTDSSTAAWNSGTSTLTITVNSKKTKDVFTKENTITVQQYDSNGTKLEGS. 282
3 -23.2002fkj_A mol:protein length:366 Outer Surface Protein A  ali model follow..  68.ISDDLGQTTLEVFKEDGKTLV----SKKVTSKDKSSTEEKFNEKGELSEK--------KITRADKSSTEEKFNEKGEEKKITRADKSSTEEKFNEKGELSITRADKSSTEEKFNEKGEKKITRADKSSTEEKFNEKGELSITRADKSSTEEKFNEKGEVSKIITRADGTRLEYTGIKSSKNISKSGEVSVELNDTDSSAATKNSGTSTLTITVNSKKTKDVFTKENTITVQQYDSNGTKLEGS. 351
4 -23.0002hkd_A mol:protein length:320 Outer Surface Protein A  ali model follow..  12.LPGSMKVLVSKSSNADGKKNNGSGVLEGVKADASKVKLTISDDLGQTTLEV-STLVSKKVTSKDKSSTEEKFNEKGEEKKITRADKSSTEEKFNEKGEKKITRADKSSTEEKFNEKGEKKITRADKSSTEEKFNEKGEVSITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLSKSGEVSVELNDTDSSKKTAAWNSGTSTLTITVNSKKTKDTSSNTITVQQYDSNGTSLEGS. 305
5 -22.7002ol6_O mol:protein length:250 Outer surface protein A  ali model follow..  1.....GSHMVSVDLPGSMKSSNADGKYDLIATVDALELSGTSDKNNGSGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKTSNGSSTEEKFNEKGEVSITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEG--------TLTAEKTTLVVKEGTVTLSNISKSGEVSVELNDTDSSKKTAAWNSGTSTLTITVNSKDLVFTSSNTITVQQYDSNGTSLESAVEITKLDEIKNA......... 248
6 -21.6003ec5_A mol:protein length:320 Outer Surface Protein A  ali model follow..  68.ISDDLGQTTLEVFKSDGSTLV----SKKVTSKDKSSTYELFNEKGELSLK--------YITRADKSSTYELFNEKGELKYITRADKSSTYELFNEKGELSITRADKSSTYELFNEKGELSLKRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSK-------NISKSGEVSVELNDTDSSAATKNSGTSTLTITVNSKKTDLVFTSSNTITVQQYDSNGTSLEGS. 305
7 -21.0003cka_A mol:protein length:320 Outer surface protein A  ali model follow..  12.LPGSMKVLVSKSSNADGKYDL----IATVDALELSGTSDKNNGSGVLEGKADASKVKLTISDDLGQTTLEVFKSDGSSKKVTSKDKSSTYELFNEKGEKYITRADKSSTYELFNEKGEKYITRADKSSTYELFNEKGELSITRADKSSTYELFNEKGELSFKRADGTRLEYTGIKSDGSKNISKSGEVSVELNDTDSSKKTAAWNSGTSTLTITVNSKDLVFTSSNTITVQQYDSNGTSLEGS. 305
8 -20.4003eex_A mol:protein length:320 Outer Surface Protein A  ali model follow..  68.ISDDLGQTTLEVFKSDGSTLV----SKKVTSKDKSSTFELFNEKGELSFK--------LITRADKSSTFELFNEKGEFKLITRADKSSTFELFNEKGEKLITRADKSSTFELFNEKGELSFKRADGTRLEYTGIKSDGSKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKN--------ISKSGEVSVELNDTDSSAATKNSGTSTLTITVNSKKTDLVFTSSNTITVQQYDSNGTSLEGS. 305
9 -18.3002oy5_O mol:protein length:251 Outer surface protein A  ali model follow..  2..............................SHMKNSVSVDLPGSMKVLVSKSSN--------ADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASLTISDDLGQTTLEVFKSDGSTLVYSKDKSYTYEYFNEKGEVSYKRADGTRLEYTGIKSDGSGKAKEVEKTTLVVKEGTVTLSNISKSGEVSVELNDTDSSAATKKWNSGTSTLTITVNSKDLVFTSSNTITVQQYDSNGTSLEGS. 236
10 -18.0006fay_A mol:protein length:1876 Odz3 protein  ali model follow..  1307.VYLNEKIMWRYNYDLNGNLHLSSARLTPLRYDLRDRIQYRLDEDGFLRQEYSSKGLLTRVYSGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTYNHSSSEITSLYYDLQGHLFMEISSGDEFYIASDNTGTPLVFSSNGLMLQIQYTAYGEIYFDSNVDFQLVITPDIEIWKRIGKDPAPFNLYMFRNNNPASKIHDVKDYVTFGFHLHNAIPFPVPKFDLTEPSYELVKSQQWED. 1612
11 -16.5006cmx_A mol:protein length:1999 Teneurin-2  ali model follow..  11 1331........VDLYRYDEISGKVEHFGKFGVIYYDINQIISKHFDTHGRIKEQYDSMGRVIKRELKLGPKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHNPGNSVRLMPLRYDLRDRITRLGDQRGSDIFEYNSKGLRAYNKASGWSVQYRYDGVGRRAYKTNLGHHLQYFYSDLHNHVYNHSNSEITSLYYDLQGHLFMESSSGEEYYVASDNTGTPLVFSINGLMIQLQYTAYGEIYYDS. 1618
12 -15.2006fb3_A mol:protein length:1859 Teneurin-2  ali model follow..  10 1222.....AVMTLSKHFDTHGRIKEEMFRSLMYWM------TVQYDSMGRVTKRELKLGPYAN-----TTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHNPGNSVRLMPLRYDLRDRITRLGDQRGSDVFEYNSKGLLAYNKANGWNVQYRYDGLGRRACKTNLGHHLQYFYADLHNHVYNHSNSEITSLYYDLQGHLFMESSSGEEYYVASDNTGTPLVFSINGLMIQLQYTAYGEIYYDS. 1477
13 -14.9005kis_B mol:protein length:965 RHS2  ali model follow..  11  1MSTSLFSRTPKVTFDNRGLTARDIRHPDAPEVTNERITPHQYDARGFLTQSADPRLH-----DAGRVNFSYLTDLAGGVLRTQGADNGTSVSLNDVAGRFIVVSHISATDEGTEDRSLAVTFVYAGNTGAEKTLNLAGLCVHYDTAGLVQTDSIALTGVSLSVSGEEYVTLTTADATGTVLTTDAKGNIQRVRYDVAGLLSGSWLTVRDKSLTYSAAGQKQEDHGNGVVITYTYEAETQRLTG.. 313
14 -12.2004ghb_A mol:protein length:272 hypothetical protein  ali model follow..  37................................PVTATHTYLYNSAGRLTGYTGKQSFTAG-DELFEIENTTTVEYKDHQAVITDEAGTVSTYTLNDKGYAT-MAGNTRTYTFSYLINTEDKYYLENITEKLDDGKEYSFITIDYSNFRALRIQQKVDT----FEHNSTATTPSGNEIANISEIPSLFITDMYPLSMHAVAIYGKILGEPANYLITQLIPDSNGESEETTTTYTLDNRGIVT.... 246
15 -11.9004igl_B mol:protein length:690 YenC2  ali model follow..  223.LLATEIYTTVTRTDA-------AGAVLTTIDAVGNQQRVAFDIAGQLSASWLTLKGGQEQV-----IKVLTYSAAGQKLREEGGNGVVTTYTYEAETQRLIGAKVLQDLRYEYDPVGNVL-NQKVVPENAYRYDSLYQLVSASGREVTRTYTYDSAGNLMRATNNNYTLNITVSERSNRGVMSSLTEDVDALFTASGSQK---CLQQGQSLIWTPRGELRTGETADDSESYRYDGSSQRILKI. 517
16 -9.4303msw_A mol:protein length:145 uncharacterized protein  ali model follow..  6......KQFIHNDTMEGGKLVCRE-DAASGILNPVKMYKYSYDTDQQKTVKSTYAWNIFKNTWETESRTVISRYETETSVEYSVWNKEKGSFDLS------------KKYIYITDNNNQLI------AQYAYKMNSRTNQWILE---KDALTPIYENIYATTR.................................................................................. 145
17 -9.1404ld1_A mol:protein length:184 Uncharacterized protein  ali model follow..  19  4..........................................GSDSKIEKMLPD---GRLVVFPNGTRKELSAD--GQTVKVMFFNGDVKHTMPD--QRVIYYYAEAQTTHITYPD-GMEVLQFPNNQTEKHFPD--GRKEITFPDQTVKTLHPD--GREESVLTDGTIIQLNPD--GSKVIQFNTGQREIHTAD---FKRREYPDGTVKTVYSD--GRQETQYPTGRVRLKDPQ--GKVIMD.. 184

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.