current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681449|ref|YP_211593.1| MatE family transmembrane protein (BF1960) [Bacteroides fragilis NCTC 9343] (Range: 1-447), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst MQGIKNLTQGPINKQLFNLAMPIMATSFIQMAYSLTDMAWVGRLGSEAVAAVGSVGILTWMSGSISLLNKVGSEVSVGQSIGAQNHEDARNFASHNITIALIISLCWGGLLFLLARPIIGIYELEAHITENAIAYLRIISTGLPFIFLSAAFTGIYNAAGRSKIPFYISGTGLVLNILLDPLFIFGFGLGTNGAAYATWISQAAVFGIFIYQLRCRDALLGRFSFFTRLKKKYTHRILKLGLPVATLNTLFAFVNMFLCRTASEQGGHIGLMTFTTGGQIEAITWNTSQGFSTALSAFIAQNYAAGRTDRVIKSWHTTLLMTSIFGTLCTLLFVFFGNEIFALFVPEQAAYEAGGVFLRIDGYSQLFMMLEITTQGVFYGIGRTIPPAIISITCNYMRIPLAILFVRMGMGVEGIWWAVCVTTVAKGLILAGWFALIKRKVLSRPILLast
1 -94.9004z3n_A mol:protein length:499 Putative drug/sodium antiporter  ali model follow..  18  17LFTVAGMFDGSLYKLLLRMALPMFVGMLTQVTYAIADIFWLSHINSGIIAGVGLVFPVGMGLFAIANGIQIGMGSLLSRAIGMQRLDRAQRILSVGIIIALFFAIVITVLGYVYAQPLLRSLGATKSIIGYATEFYYYSLLTVFSIMLIGVMMGLFQGAGKIMVIMKASLLGALVNIMLDPIMIFVFDFGVKGVALASFLAQLSMVAYFIYTLMGLHIGLSIRIALRPFSWKIYREFLSVGMAQMLMQLIIAVGIVIYNFFIVR-LDVNAMAAFTLTGRIDYFIITPMLAIATALLTVVGQNWGHGNVTRTLNAYWAAVALAFSIVLVLAVMHIVLAPWMYPLFTRVVAVSDYAVLQTRIMALALPFVAISLLASEYYQAIGKPWYSVLLTLMRHVFISVPVVYLLALEMRITGVYFGAMSGTFVAALLAWRLLRLSPRLLRWNQ.. 465
2 -93.0005c6o_A mol:protein length:464 BH2163 protein  ali model follow..  21  5.QQSERLGTEAIPKLLRSLSIPAMIGMFVMALYNVVDTIFISYVGIEGVAGVTIAFPIMMIMMSMAGALGIGGASVISRRLGERRGEEANQVFGNILTVILVLSVIGFISAFTLLGPALQLFGATSVTQGYATDYLFPILLGSIFFFFAFAANNIIRSEGNATFAMVTMIVPAVLNILLDVLFIFGLNMGVLGASIATVIAQASVTGLVLRYFLTGKSTLSLHWSDLRMKGSVIKEVCLVGLPAFVQQSSASLMMIAINSMLLRFGSDFYVGVFGLVQRIMMFVMMPMMGIMQAMQPIVGYNYGAKQYSRLRETVMLGFKVATIFSIGIFALLMLFPEALLRVFTADREVIQAGVSAMHILFCVTFLIGAQIVAGGLYQSLGKPKQALILSLSRQIIFLIPLVLILPHIFGLSGVWWAFPIADVLSFILTVVLLYRDRNVFFLK... 448
3 -89.0004mlb_A mol:protein length:492 PF0708  ali model follow..  21  13.TKGVQLLRGDPKKAIVRLSIPMMIGMSVQTLYNLADGIWVSGLGPESLAAVGLFFPVFMGIIALAAGLGVGTSSAIARRIGARDKEGADNVAVHSLILSLILGVTITITMLPAIDSLFRSMGAKGEAVELAIEYARVLLAGAFIIVFNNVGNGILRGEGDANRAMLAMVLGSGLNIVLDPIFIYTLGFGVVGAAYATLLSMVVTSLFIAYWLFKRDTYVDITLRDFSPSREILKDILRVGLPSSLSQLSMSIAMFFLNSVAITAGGENGVAVFTSAWRITMLGIVPILGMATATTSVTGAAYGERNVEKLETAYLYAIKIAFMIELAVVAFIMLFAPQVAYLFTYSESIKGDLISALRTLPVFLVLTPFGMMTSAMFQGIGEGEKSLILTIFRTLVMQVGFAYIFVTTLGLRGVWIGIVIGNMVAAIVGFLWGRMRISALKKT... 461
4 -72.6004huk_A mol:protein length:459 Multidrug efflux protein  ali model follow..  16  1LDRFSFSVFLKEIRLLTALALPMLLAQVAQVGIGFVDTVMAGGAGKEDLAAVALGSSAFATVYITFMGIMAALNPMIAQLYGAGKTGEAGETGRQGIWFGLILGIFGMILMWAAITPFRNWLTLSDYVEGTMAQYMLFTSLAMPAAMVHRALHAYASSLNRPRLIMLVSFAAFVLNVPLNYIFVYGKALGGAGCGVATMAVFWFSALALWIYIAKEKFFFGLTAKFGKPDWAVFKQIWKIGAPIGLSYFLEASAFSFIV-FLIAPFGEDYVAAQQVGISLSGILYMIPQSVGSAGTVRIGFSLGRREFSRARYISGVSLVSGWVLAVITVLSLVLFRSPLASMYNDDPAVLSIASTVLLFAGLFQPADFTQCIASYALRGYKVTKVPMFIHAAAFWGCGLLPGYLLAYRMGIYGFWTALIASLTIAAVALVWCLEKYSMELVKSH.. 452
5 -66.5003mkt_A mol:protein length:460 Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux pump  ali model follow..  17  12.............SNLIKLATPVLIASVAQTGMGFVDTIMAGGVSAIDMAAVSIAASIWLPSILFGVGLLMALVPVVAQLNGAGRQHKIPFEVHQGLILALLVSVPIIAV-LFQTQFIIRFMDVEEAMATKTVGYMHAVIFAVPAYLLFQALRSFTDGMSLTKPAMVIGFIGLLLNIPLNWIFVYG-ELGGVGCGVATAIVYWIMLLLLLFYIVTSKRLVKVFETFHKPQPKELIRLFRLGFPVAAA-LFFEVTLFAVVALLVAPLGSTVVAAHQVALNFSSLVFMFPMSIGAAVSIRVGHKLGEQDTKGAAIAANVGLMTGLATACITALLTVLFREQIALLYTENQVVVALAMQLLLFAAIYQCMDAVQVVAAGSLRGYKDMTAIFHRTFISYWVLGLPTGYILGMTLGAKGFWLGFIIGLSAAALMLGQRLYWLQKQSDDVQL. 455
6 -52.7005yck_A mol:protein length:471 multi drug efflux transporter  ali model follow..  17  1MKATQSGQLTAELKRVTRLAAPMATVTIAQYLLPVISVMVAGHNGELQLSGVALATSFTNVTFSIMYGLVGALETLCGQAYGAKQYEKIGTYTYSAIASNIPICFIISII-WFYIENILISLGQDPDISRIAGSYAFWLIPVLFAQAIVIPLTRFLLTQGLVLPLLYTAVTTLLFHVFVCWVFVLVFVLGSNGPAMATSVSFWFYAVILSCYVRFSSSCEKTRGFVSEDFVSCVKQFFQYGVPSAAMICLEWWLFELLILCSGLL-PKLETSVLSICLTTETLHYVISSGVAAAVSTRVSNNLGAGNPQVARVSVLAGLCLWLVESAFFSILLFTFRNIIGYAFSNSKEVVDYVADLSPLLCLSFILDGFTAVLNGVARGSGWQHIGAWNNIFSYYLVGAPVGVYLAFRLNGKGLWCGVVIGSTVQATVLAIVTASMNWKEQAEKA. 449
7 -52.0005y50_A mol:protein length:461 Protein DETOXIFICATION 14  ali model follow..  16  12.............KKLSYIAGAMIAVNSSMYVLQVISIMMVGHLGELFLSSTAIAVSFCSVTFSVVFGLASALETLCGQANGAKQYEKLGVHTYTGIVSLFLVCIPLSLL-WTYIGDILSLIGQDAMVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLVMSSVSSLCIHIVLCWSLVFKFGLGSLGAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRATISMSLFEGMGEFFRFGIPSASMICLEWWSFEFLVLLSGILPNKLEASVLSVCLSTQSSLYQIPESLGAAASTRVANELGAGNPKQARMAVYTAMVITGVESIMVGAIVFGARNVFGYLFSSETEVVDYVKSMAPLLSLSVIFDALHAALSGVARGSGRQDIGAYVNLAAYYLFGIPTAILLAFGMRGRGLWIGITVGSCVQAVLLGLIVILTNWKKQARKA. 447
8 -28.1006cc4_A mol:protein length:614 soluble cytochrome b562, lipid II flippase MurJ chimera  ali model follow..  11  95LKTTRNAYIQKYLKSLAAVSSMTMFSRVLGFA----DAIVARIFGAGMATAFFVAFKLPNLLRRIFAAFSQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVFADTADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNISMIGFALFAAPYFNPPVLALAWAVTVGGVLQLVYQLPHLKKIGMLVLPR---INFHDAGAMRVVKQMGPAILGVSVSQI-SLIINTIFASFLASGSVSWMYYADRLMEFPSVLGVALGTILLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQTAFDALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLILTQLMNLAFIGP-LKHAGLSLSIGLAACLNASLLYWQLRKQKIFTPQPGWM 545
9 -26.1005t77_A mol:protein length:475 Putative lipid II flippase MurJ  ali model follow..  15  2..........SILFSSILFSIATFFSRILGLF----DVLFAKYFGVSYELAYFIAIMFPFFLRKV---FGEGASSAFVPLYSEKSGEEKDKFLSSVINGFSLIILALVILSYFFPELIINLFGSSHETKILAKKLLLITSPSIYFIFLWAISYSILNTNNKFFWP---ALTPSISNITIIIGTFLSTKYGIISPTIGFLIGSILMFFSIIKSIIKHK---------YYFTIKHFPHFLKLFFPTFMTMVVSQI-NTVVDMNVVSFYDKGSISYLQYASRFYLLPYGL---FAVSVSTVVLSKI-SNDRKNFNYHLNDALKTTLFFTIPSMVGLIFLSTPIIRFFYETSKDTLITSKILIAYTLGLPFYGIYSTISRSYHAIKNTKTPFIAATIVSLSNIILDIIFGLK-YGPIGVALATSIAGIIGVLYLLFSVKTFPIKDFLKISL 422
10 -6.1805oql_B mol:protein length:907 Utp2  ali model follow..  492VKGIEVTKLPTVVQRIRALHHPKLDAK-LGNFSQVLIHHIAYLGDRFQPHWFPTLEQLSRHVHSLAKTFPIEVAKAYRMRIQEMEEHRPLAPTVGDLVILTAIGTTFPTS------------DHFHQVCTPAMLAIARYLGQKVPAALSDFAVGIYQDFAKRYVPEMMNFLLNTLCALADCLRKDELSPAETSSLQIAILSTATAILKSAADTWHKLPAFESFQPALSVAQHLLTKPNASHLPSSLTSKLNDLASHLSRLLQLSRLSRRPLELHH--RPLAIKTYIPKFEDDFDPDKHYDPNRERAELAKLKAEHKRE------------------RKGALRELRKDAQFIR............................................................................................... 860

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.