current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682225|ref|YP_212369.1| putative two component system response regulator (BF2753) [Bacteroides fragilis NCTC 9343] (Range: 1-225), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKILIIEDEPSLRELIQRSLEKERYVVEAAADFQSGLRKIEDYDYDCVLLDIMLPDGNGLNLLEQLKKMRKRENVIIISAKDSLDDKVLGLELGADDYLPKPFHLAELNARIKSVIRRQRRDGEMDIRLANIRIVPDTFQVFVDDKEIELNRKEYDILLYFANRPGRLVNKNTLAESVWGDHIDQVDNFDFIYAQIKNLRKKLKDAGALAELKAVYGFGYKMTVELast
1 -95.8001kgs_A mol:protein length:225 DNA BINDING RESPONSE REGULATOR D  ali model follow..  34  3VRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNEPFDVVILDIMLPVHDGWEILKSMRESGVNTPVLMLTALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRRKSESKSTKLVCGDLILDTATKKAYRGSKEIDLTKKEYQILEYLVMNKNRVVTKEELQEHLWSFDDE--VFSDVLRSHIKNLRKKVDKGFKKKIIHTVRGIGYVARDE 225
2 -93.8001ys6_A mol:protein length:233 Transcriptional regulatory protein prrA  ali model follow..  30  9.RVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGTSSSETITVGPLEVDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWG--YDFAADTNVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ 233
3 -92.7005u8k_A mol:protein length:231 Response regulator  ali model follow..  26  5.RILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVLIENLVARISAIFRGRDFIDQHPRTYRNLRIDVEHHTVYRGEEMIALTRREYDLLATLM-GSKKVLTREQLLESVWK--YESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRGVGYTMQE. 230
4 -91.8002gwr_A mol:protein length:238 DNA-binding response regulator mtrA  ali model follow..  30  7.RILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADS-GVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWG--YRHPADTRLVNVHVQRLRAKVEDPENPTVVLTVRGVGYKAGPP 228
5 -90.3003r0j_A mol:protein length:250 POSSIBLE TWO COMPONENT SYSTEM RESPONSE TRANSCRIPTIONAL POSITIVE REGULATOR PHOP  ali model follow..  28  25.RVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRARETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVTKPFSLEEVVARLRVILRRAGEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWR--YDFGGDVNVVESYVSYLRRKIDT-GEKRLLHTLRGVGYVLREP 249
6 -90.1004s04_A mol:protein length:232 DNA-binding transcriptional regulator BasR  ali model follow..  31  1MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNE--PATNTLEVHIHNLREKIGK----SRIRTVRGFGYMLANN 219
7 -88.9004kfc_A mol:protein length:227 KDP operon transcriptional regulatory protein KdpE  ali model follow..  28  5.NVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWS-AVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSTAPDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNA--VEHSHYLRIYMGHLRQKLEDPARPRHFITATGIGYRFML. 227
8 -88.6002oqr_A mol:protein length:230 Sensory transduction protein regX3  ali model follow..  35  6.SVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVCKQLRARS-SVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWG--ADYVGDTKTLDVHVKRLRSKIEDPANPVHLVTVRGLGYKLE.. 229
9 -87.9002hqr_A mol:protein length:223 Putative TRANSCRIPTIONAL REGULATOR  ali model follow..  23  1MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMV----SDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYSIKALVARIEARLRFWG---SNVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRDQIVSKEQLLDAIWEEPEM--VTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYP 217
10 -86.9001p2f_A mol:protein length:220 Response Regulator  ali model follow..  29  4.KIAVVDDDKNILKKVSEKLQQLGR-VKTFLTGEDFLNDEEA--FHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREK---KGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVS----PRVVDTVIKRIRKAIEDPNRPRYIKTIWGVGYMFTGG 218
11 -86.8004b09_A mol:protein length:240 TRANSCRIPTIONAL REGULATORY PROTEIN BAER  ali model follow..  30  12.RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLMLCREIRRF-SDIPIVMVTAKIEEIDRLLGLEIGADDYICKPYSPREVVARVKTILRRCKRELQQQDAESPLIIDEGRFQASWRGKMLDLTPAEFRLLKTLSHEPGKVFSREQLLNHLYD--DYRVVTDRTIDSHIKNLRRKLESDAEQSFIRAVYGVGYRWEAD 235
12 -86.6005dcm_B mol:protein length:243 PhoB family transcriptional regulator  ali model follow..  28  7.KIYIVEDDMTIVSLLKDHLS-ASYHVSSVSNFRDVKQEIIAFQPDLILMDITLPYFNGFYWTAELRKF-LTIPIIFISSSNDEMDMVMALNMGGDDFISKPFSLAVLDAKLTAILRRSQQFIQQELTFGGFTLTREGL-LSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWE--NDSFIDQNTLNVNMTRLRKKIVPIG-FDYIHTVRGVGYLLQND 224
13 -86.5005dcl_A mol:protein length:243 PhoB family transcriptional regulator  ali model follow..  28  7.KIYIVEDDMTIVSLLKDHLS-ASYHVSSVSNFRDVKQEIIAFQPDLILMDITLPYFNGFYWTAELRKF-LTIPIIFISSSNDEMDMVMALNMGGDDFISKPFSLAVLDAKLTAILRRSQQFIQQELTFGGFTLTREGL-LSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWE--NDSFIDQNTLNVNMTRLRKKIVPIG-FDYIHTVRGVGYLLQDP 224
14 -85.7003q9s_A mol:protein length:249 DNA-binding response regulator  ali model follow..  32  32QRILVIEDDHDIANVLRMDLTDAGYVVDHADSAMNGLIKAREDHPDLILLDLGLPDFDGGDVVQRLRKNS-ALPIIVLTARDTVEEKVRLLGLGADDYLIKPFHPDELLARVKVQLRQRT---SESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQ--GRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGV....... 243
15 -62.5002pkx_A mol:protein length:121 Transcriptional regulatory protein phoP  ali model follow..  30  1MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSQ........................................................................................................ 121
16 -62.4003w9s_A mol:protein length:131 OmpR family response regulator in two-component regulatory system with BasS  ali model follow..  37  1MKILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGLE.................................................................................................... 125
17 -61.5005uic_A mol:protein length:144 Two-component response regulator  ali model follow..  39  19MRILLAEDDLHLGEGLLEALQKEGLIVNLVSDGEAAQTFIESGLYDIVVLDIGMPIKTGLEVLRNIRNRGIKVPIILLTARDGLEDRIKGLDLGADDYLTKPFELKELVARIKAISRRIDTRSGKS................................................................................................... 144
18 -61.4001mvo_A mol:protein length:136 PhoP response regulator  ali model follow..  39  5.KILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVCKQLRQQKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRRSEIAPSSEMKNDEM............................................................................................. 136
19 -60.5004q7e_A mol:protein length:129 Response regulator of a two component regulatory system  ali model follow..  35  8.RILLVEDDEGLGETLKERLEQDKYRVEWAKTISEAENLYRPNAFDLVVLDLRLPDGNGFDLAEMIVKKEKDLPFLFLTAQAGAQERLRGFELGAAEFIPKPFHLKEFLIRLERVISLTRP........................................................................................................ 127
20 -60.4004qpj_C mol:protein length:152 Cell cycle response regulator CtrA  ali model follow..  38  29MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRR........................................................................................................... 146
21 -59.3002jba_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB  ali model follow..  36  4.RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRRISPMA...................................................................................................... 127
22 -59.3002jb9_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB  ali model follow..  36  4.RILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFIKHLKRESRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMA...................................................................................................... 127
23 -59.3001b00_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY PROTEIN PHOB  ali model follow..  38  4.RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMRRISPMA...................................................................................................... 127
24 -59.1002qzj_A mol:protein length:136 Two-component response regulator  ali model follow..  26  6.KILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNV-TTCPIVYMTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNSYVNN.................................................................................................... 128
25 -58.8002zwm_A mol:protein length:130 Transcriptional regulatory protein yycF  ali model follow..  41  4.KILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKK-YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTLE...................................................................................................... 124
26 -58.5003t6k_A mol:protein length:136 Response regulator receiver  ali model follow..  28  6.TLLIVDDDDTVAEMLELVLRGAGYEVRRAASGEEALQQIYKNLPDALICDVLLPGIDGYTLCKRVRQHPKTLPILMLTAQGDISAKIAGFEAGANDYLAKPFEPQELVYRVKNILARTTIETPT.................................................................................................... 131
27 -58.4005hm6_A mol:protein length:133 BfmR  ali model follow..  36  12.KILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVMLPGADGLTVCREVRPH-YHQPILMLTARTEDMDQVLGLEMGADDYVAKPVQPRVLLARIRALLRRTDKTVE..................................................................................................... 133
28 -58.4001nxo_A mol:protein length:120 DNA-binding response regulator  ali model follow..  42  3.KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKT-SSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ......................................................................................................... 120
29 -58.3001zh2_A mol:protein length:121 KDP operon transcriptional regulatory protein kdpE  ali model follow..  36  3.NVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQW-SAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSQ........................................................................................................ 121
30 -57.7004nic_A mol:protein length:128 DNA-binding transcriptional regulator RstA  ali model follow..  32  6.KIVFVEDDPEVGTLIAAYLGKHDMDVVVEPRGDRAEEVIAREKPDLVLLDIMLPGKDGMTLCRDLRGQ-WQGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQH.......................................................................................................... 122
31 -57.6001xhe_A mol:protein length:123 Aerobic respiration control protein arcA  ali model follow..  36  5.HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRTMQ........................................................................................................ 123
32 -57.4001zgz_A mol:protein length:122 TorCAD operon transcriptional regulatory protein torR  ali model follow..  35  4.HIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERS-TVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRIDQ........................................................................................................ 122
33 -56.9005xjp_A mol:protein length:145 AdeR  ali model follow..  32  15.VILVVEDDYDIGDIIENYLKREGMSVIRAMNGKQAIELHASQPIDLILLDIKLPELNGWEVLNKIRQKA-QTPVIMLTALDQDIDKVMALRIGADDFVVKPFNPNEVIARVQAVLRRTQFANKA.................................................................................................... 137
34 -56.5004uhj_A mol:protein length:136 TRANSCRIPTIONAL REGULATORY PROTEIN CPXR  ali model follow..  42  3.KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDD-SIDLLLLDVMMPKKNGIDTLKALRQTH-QTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQK.................................................................................................... 124
35 -56.1003rqi_A mol:protein length:184 Response regulator protein  ali model follow..  16  9.NFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEAVVLSVDRLEWEHIQRVLAENNNNISATARALNMHRRTLQR---KLAKKPVRQ................................................. 184
36 -55.8004ja2_A mol:protein length:122 Response regulator  ali model follow..  32  4.KVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE........................................................................................................... 122
37 -55.7003q9v_A mol:protein length:133 DNA-binding response regulator  ali model follow..  20  1..................................................................................................MGSSSSGENLYFEGSHMASMTGGGRSESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQ--GRLPEGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALR.. 126
38 -55.6002hqo_A mol:protein length:123 Putative TRANSCRIPTIONAL REGULATOR  ali model follow..  25  1MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMV----SDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYSIKALVARIEARLRFWGSNLVP.................................................................................................... 122
39 -55.6006azr_B mol:protein length:123 Chemotaxis regulator-transmits chemoreceptor signals to flagelllar motor components CheY  ali model follow..  33  5.KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE........................................................................................................... 123
40 -55.2002pln_A mol:protein length:137 Response regulator  ali model follow..  26  13MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMV----SDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYSIKALVARIEARLRFWGSN....................................................................................................... 131
41 -55.0003lte_A mol:protein length:132 Response regulator  ali model follow..  24  8.RILVVDDDQAMAAAIERVLKRDHWQVEIAHNGFDAGIKLSTFEPAIMTLDLSMPKLDGLDVIRSLRQNKANQPKILVVSGLDKAKLQQAVTEGADDYLEKPFDNDALLDRIHDLVNEG.......................................................................................................... 126
42 -54.6003snk_A mol:protein length:135 Response regulator CheY-like protein  ali model follow..  15  16.QVALFSSDPNFKRDVATRLDAAIYDVRVSETDDFLKGPPADTRPGIVILDLGGGDLLGKPGIVEARALWATVPLIAVSDELTSEQTRVLVRMNASDWLHKPLDGKELLNAVTFHDTGNQ......................................................................................................... 135
43 -53.9002b4a_A mol:protein length:138 BH3024  ali model follow..  22  10FRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQSTCDLLIVSDQLVDLSIFSLLDIVKEQTKQPSVLILTTGRHELIESSE---HNLSYLQKPFAISELRAAIDYHKPSMGVTMN..................................................................................................... 131
44 -53.6005t3y_A mol:protein length:125 Two-component system response regulator  ali model follow..  25  4.TILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSADTPILVLTTEGSDAFKAAARDAGATGWIEKPIDPGVLVELVATLSEPAAN........................................................................................................ 125
45 -53.4003cg4_A mol:protein length:142 Response regulator receiver domain protein (CheY-like)  ali model follow..  21  9.DVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQTG..................................................................................................... 133
46 -53.3003a0r_B mol:protein length:116 Response regulator  ali model follow..  30  3.RILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDMSSW--AADEYVVKSFNFDELKEKVKKLL............................................................................................................. 115
47 -52.2003eod_A mol:protein length:130 Protein hnr  ali model follow..  30  9.QILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKPVKLNRLREMVFACLYPSM......................................................................................................... 128
48 -51.9003cfy_A mol:protein length:137 Putative LuxO repressor protein  ali model follow..  26  6.RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLEDL..................................................................................................... 128
49 -51.0003n53_A mol:protein length:140 Response regulator receiver modulated diguanylate cyclase  ali model follow..  31  5.KILIIDQQDFSRIELKNFLD-SEYLVIESKNEKEALEQIDHHHPDLVILDMDIIGENSPNLCLKLKRSKKNVPLILLFSSEHKEAIVNGLHSGADDYLTKPFNRNDLLSRIEIHLRTQNYYSD..................................................................................................... 128
50 -50.8003f7n_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  25  5LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRADGSALPVLMVTALAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
51 -50.7001p6q_A mol:protein length:129 CheY2  ali model follow..  26  7IKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK......................................................................................................... 129
52 -50.1003ffx_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  25  5LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRADGSALPVLMVTAHAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
53 -50.1003cnb_A mol:protein length:143 DNA-binding response regulator, merR family  ali model follow..  22  10.SILIIEDDKEFADMLTQFLENPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSICHRIKSTPANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQLVEQKKATSEG.................................................................................................... 137
54 -50.1003ffw_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  24  5LKFLVVDDQSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
55 -50.1003c3m_A mol:protein length:138 Response regulator receiver protein  ali model follow..  25  5.TILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDPRDIPVLMLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLARRHSIAA..................................................................................................... 129
56 -50.0002j48_A mol:protein length:119 TWO-COMPONENT SENSOR KINASE  ali model follow..  18  3.HILLLEEEDEAATVVCEMLTAAGFKVIWLVDGSTALDQLDLLQPIVILMAWPPPDQSCLLLLQHLREHQPHPPLVLFLGEPPVDP---LLTAQASAILSKPLDPQLLLTTLQGLCPPN.......................................................................................................... 119
57 -49.8001ab6_A mol:protein length:125 CHEMOTAXIS PROTEIN CHEY  ali model follow..  24  2LKFLVVDDNSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMTTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 124
58 -49.8001hey_A mol:protein length:128 CHEY  ali model follow..  22  5LKFLVVGNGGTGKSTVRNLLKELGFNVEDAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
59 -49.8003fft_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  25  5LKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
60 -49.7001e6m_A mol:protein length:128 CHEMOTAXIS PROTEIN CHEY  ali model follow..  23  5LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
61 -49.6001ab5_A mol:protein length:125 CHEY  ali model follow..  24  2LKFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 124
62 -49.6006chy_A mol:protein length:128 CHEY  ali model follow..  23  5LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
63 -49.5001ymv_A mol:protein length:129 CHEY  ali model follow..  24  6LKFLVVDDGGTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 128
64 -49.4001jbe_A mol:protein length:128 Chemotaxis protein CHEY  ali model follow..  24  5LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRANXSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
65 -49.4001u8t_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  22  5LKFLVVDKFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
66 -49.4002id7_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  23  5LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISCWNMPNMDGLELLKTIRADGSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
67 -49.3002fka_A mol:protein length:129 Chemotaxis protein cheY  ali model follow..  22  6LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 128
68 -49.2003gt7_A mol:protein length:154 Sensor protein  ali model follow..  28  9.EILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALCRWLKGQPRTIPVILLTILSDPRDVVRSLECGADDFITKPCKDVVLASHVKRLLSGVKRTEE..................................................................................................... 133
69 -49.2001djm_A mol:protein length:129 CHEMOTAXIS PROTEIN Y  ali model follow..  24  6LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 128
70 -49.2002zay_A mol:protein length:147 Response regulator receiver protein  ali model follow..  19  10.RIMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLFNSLKKNPASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRLSARIKRVLKLLYEDLS..................................................................................................... 134
71 -49.1001e6k_A mol:protein length:130 CHEMOTAXIS PROTEIN CHEY  ali model follow..  24  7LKFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 129
72 -49.1002gkg_A mol:protein length:127 response regulator homolog  ali model follow..  27  7.KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSGQNGYLICGKLKKDDKNVPIVIIGNPDGF-AQHRKLKAHADEYVAKPVDADQLVERAGALIGFPE......................................................................................................... 127
73 -49.0001ymu_A mol:protein length:130 CHEY  ali model follow..  24  7LKFLVVDDFSTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 129
74 -48.9004h60_A mol:protein length:120 Chemotaxis protein CheY  ali model follow..  26  4.KVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL............................................................................................................. 120
75 -48.8002l69_A mol:protein length:134 Rossmann 2x3 fold protein  ali model follow..  10  3IVIVVFSTDEETLRKFKDIIKKNGFKVRTVRSPQELKDSIEELVKKYNATIVVVVVDDKEWAEKAIRFVKSAQVLIIIYDQDQNRLEEFSREVRRRGFVRTVTSPDDFKKSLERLIREVGSLE...................................................................................................... 128

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.