current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682801|ref|YP_212945.1| nicotinate phosphoribosyltransferase (BF3334) [Bacteroides fragilis NCTC 9343] (Range: 1-388), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MIIRTILDTDLYKFTTSYAYIKLFPYAIGTFSFKDRDGTEYSDEFVERLRTEISQLSHVALTEKELEYMIKNCRFLPRVYWEWLSSFRFQPEKIEIRLDENRQLHIEVNDYLYKATLYEVPLLAIVSEIKNQSSGNVANLEDILYKLSEKTELSNKHQLLFSEFGTRRRFSFDVQNQVIGHLKQTAHYCIGTSNCHFAMKYGMKPMGTHPHEWFMFHGAQFGYKHANYMALENWVNVYDGDLGIALSDTYTSAIFLSNLSRKQAKLFDGVRCDSGDEFRFIDQLTARYKELGIDPTTKTIVFSNALDFDKALDIQEYCQGKIRCSFGIGTNLTNDTGFKPSNIVMKLSQCKMNMNQEWRECVKLSDDIGKHIGSPEEVRACLYDLRLELast
1 -116.0002im5_A mol:protein length:394 Nicotinate phosphoribosyltransferase  ali model follow..  47  3.IIRSILDTDLYKFTTGYAYAKLFPRAYGEFRFIDRNRQGFTEEFAELVRGEIRAMAALSLTRDEKEFLQRELPYLPPIYIDFLDGFRFDPEEVTVSIDAQGHLDIRAQGLLYRVTLWETPILAVISELYYRFIGAEPDWKQVEEVTRSKGELMREHRATFSIFGMRRRFSLEVEDRVTDIKQYAGESLFGTSNVHLAHKHGLRVSGTHPHEWIQFHGAIYGYKMANYVAMEDWINVYDGDLGTVLTDTYTTDVFMRNFSKKHAMLFTSLRHDSGDPEIFIEKAVRRYEELRVDPKIKYIIFSDSLTPQRAIEIQKLCAGRIKASFGIGTNLTNDVGVEPLNIVMKLWKCKMTAKDDWHYCVKLSDVDGKHTGEPEEILLAMNTLGIK 392
2 -109.0004hl7_A mol:protein length:446 Nicotinate phosphoribosyltransferase  ali model follow..  33  12.IIRSLLDLDAYKINMMQAIHHFYPDVSVRYELIVRSEE-DASGLLDAIRQEIAHLGTLRFSDADIHYLTQHAPHLKATFLQSLRYFHFVPQMGIVKQGGKQQLRISIRGSWRDTILYETLVMAIVSEVRSRQRWAEVPADTKLDQLKAEIERRGINNFSLTEMGTRRRFSSQVQRDVLACKQEIPQWVLGTSNYHFAREFDLKPIGTIAHEWFMGHQALVNERDSQQVALERWLTAFDGMLAIAPTDTLTIDAFLNDFNRHLANAYDGVRHDSGCPFRWGDKMIAHYQQLGIDPTTKLFIFSDGLDFDQALELCEYFAGRVKISFGIGTFLTNDLANWRNAAGVELSIVIKLAECQGRPVAKISDQPEKAMCEPIFLANLKRRFNIE 413
3 -106.0001ybe_A mol:protein length:449 Nicotinate phosphoribosyltransferase  ali model follow..  28  27.IVRSLIDTDFYKLLMLQMIWKLYPEVDATFSLINRTVRLAEEIDEMELREQLDHARTLRLSKKENIWLAGNTFYFEPEFLSWLSSYQLPE---YELFKRDGQYELNFHGRWMDTTLWEIPALSIINELRSRSAMRSLGYFTLDVLYARAKAKMWEKGLRISDFGTRRRHSFLWQRWCVEAKEGIGPAFTGTSNVLLAMDSDLEAVGTNAHELPMVVAALAQTNAAPYQVLKDWNRLYGGNLLIVLPDAFGTAAFLRNA-PEWVADWTGFRPDSAPPIEGGEKIIEWWRKMGRDPRTKMLIFSDGLDVDAIVDTYRHFEGRVRMSFGWGTNLTNDFAGCAPKTIASISIVCKVSDANGRPAVKLSDNPQKATGDPAEVERYLKFFGEE 432
4 -99.7001vlp_A mol:protein length:441 nicotinate phosphoribosyltransferase  ali model follow..  30  11.VIKSLLDTDMYKITMHAAVFTNFPDVTVTYKYTNRSQLTFNKEAINWLKEQFSYLGNLRFTEEEIEYLKQEIPYLPSAYIKYISSSNYKLHEEIEGKPTHYKLKILVSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQAEKKAETLFDNGIRFSEFGTRRRRSLKAQDLIMGNPDRNKSLLLGTSNILFAKKYGVKPIGTVAHEWVMGVASISEDYLANKNAMDCWINTFGKNAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDPVEYTKKISHHYHDVLLPKFSKIICYSDSLNVEKAITYSHAAENGMLATFGIGTNFTNDFRKKSEPQVKPLNIVIKLLEVNGNHAIKISDNLGKNMGDPATVKRVKEELGYT 421
5 -99.3001yir_A mol:protein length:408 Nicotinate phosphoribosyltransferase 2  ali model follow..  34  12.IVQNLLDTDFYKLTMMQAVLHNYPNAEVEWEFRCRNQE-DLRLYLPAIREQLEYLAGLAISDEQLAFLERI-PFLAPDFIRFLGLFRFNPR-YVQTGIENDEFFLRLKGPWLHVILFEVPLLAMISEVRNRARYPAATVEQARERLQEKFDWLRRAGFKMADFGTRRRFSYRVHEAVVSGKEDFPGCFVGTSNVHLARKLDLKPLGTMAHEWLMAHQQLGPRIDSQSAALDCWVREYRGLLGIALTDCITTDAFLRDFDLYFAKLFDGLRHDSGDPLLWAEKTIAHYLKLGIDPLTKTLVFSDGLDLPRALKIYRALQGRINVSFGIGTHFTCDLPVEPMNIVVKMSAC------NGHPVAKISDTPGKAQRDPDFIHYLKHVFQVA 400
6 -98.5003os4_A mol:protein length:407 Nicotinate phosphoribosyltransferase  ali model follow..  33  8.ILTSLLDTDAYKLHMQQAVFHHYRHITVAAEFRCR-SDELLGVYADEIRHQVTLMGQLALTSDEFIYLSSL-PFFQDDYLHWLRDFRFKPEQVSVAV-HDGKLDIRIAGLWCEVIMWEVPLLAVISEIVHRRRSTQVTTDQAVQQLRTKLEQFNATHFKLMDFGTRRRFSREIQHTVVSTLKDEFPYLVGTSNYDLARTLALAPVGTQAHEWFQAHQQISTLANSQRVALQVWLDEYPNQLGIALTDCITMDAFLRDFDLAFANRYQGLRHDSGDPIEWGEKAIAHYEKLGIDPMKKVLVFSDNLDLEKALFLYRHFYQRIKLVFGIGTRLTCDIDVKPLNIVIKLVEC------NDKPVAKLSDSPGKTICQPAFVDQLRKAFALP 395
7 -89.5002f7f_A mol:protein length:494 nicotinate phosphoribosyltransferase, putative  ali model follow..  20  7.DDSLTLHTDMYQINMMQTYWELGADLHAVFECYFREPFNHGYAIFAGLERLVNYLENLTFTESDIAYLREV-EEYPEDFLTYLANFEFKCTALEGDLVFNNEPLIQIEGPLAQCQLVETALLNMVNFQTLIATKAAR-------------IKSVIGDDPLLEFGTRRAQELDAAIWG--TRAAYIGGADATSNVRAGKIFGIPVSGTHAHSLVQSYGNDYEAFMAYAKTHRDCV------FLVDTYDTLKASAIRVAREMGDKINFLGVRIDSGDMAYISKRVREQLDEAGFTE--AKIYASNDLDENTILNLKMQKSK--IDVWGVGTKLITAYDQPALGAVFKLVSI-EGEDGQMKDTIKLSSNAEKVTGKKQVWRITRKSDK.. 374
8 -86.1004yub_A mol:protein length:538 Nicotinate phosphoribosyltransferase  ali model follow..  18  11.AAARPLLTDLYQATMALGYWRAGARDAAEFELFFRRPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPTDPAFFEHLRALDCSEALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVA------------TNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTA--STYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPLIVVSNNIDEEALARLAQEGS--EVNVIGIGTSVVTCPQQPSLGGVYKLVAV------GGQPRMKLTEDPEKQTGSKAAFRLLGSD.... 430
9 -60.1002e5b_A mol:protein length:499 Nicotinamide phosphoribosyltransferase  ali model follow..  14  17..FNILLATDSYKVTHYKQYPPNTSKVYSYFENSKLRKVKYEETVFYGLQYILKYLKGKVVTKEKIQEAKDQDDVFNEKGWNYILEKY--KAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTIAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFLLPPYLRVIQGDGVDINTLQEIKQKMWSIENIAFGSGGGLLQKLTRDLLNCSFKCSYV-VTNGLGINVFKDPVADPNKKKGRLSLHR......... 442
10 -58.6002h3b_A mol:protein length:494 Nicotinamide phosphoribosyltransferase  ali model follow..  14  12..FNILMATDSYKVTHYKQYPPNTSKVYSYFENSKVRKVKYEETVFYGLQYILKYLKGKVVTKEKIQEAKEVYRERGWNYILEKYDGHLPIEVPEGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSITVATNSREQKKILAKYLMETSGNLDGLEYKLHDFGYRGVSSQETAGIGASALVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTITAGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTEAPLIIRPDSGNPMDTVLKVLDILGKKKLLPPYLRVIQGDGVDINTLQEIKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYV-VTNGLGVNVFKDPVADPNKRKGRLSMHRTPAGN.... 442
11 -58.1002g95_A mol:protein length:491 Nicotinamide phosphoribosyltransferase  ali model follow..  14  9..FNILLATDSYKVTHYKQYPPNTSKVYSYFENSKVRKVKYEETVFYGLQYILKYLKGKVVTKEKIQEAKEVYRVFNERGWNYILEKY--KAVPEGSVIPRGNVLFTVENTDPECYWLTNWIETILVYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASALVNFKGTDTVAGIALIKKYYGTKDPVPGYSVPAAEHSTIAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTEAPLIIRPDSGNPLDTVLKVLDILGKKKLLPPYLRVIQGDGVDINTLQEIKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYV-VTNGLGVNVFKDPVADPNKRSGRLSLHR......... 434
12 -57.4001ytd_A mol:protein length:398 nicotinate phosphoribosyltransferase from Thermoplasma acidophilum  ali model follow..  17  18..IKKGLASDVYFERTISAIGDKCNDLRVAMEATVSGPLD-TWINFTGLDEVLKLLEGLDVD---------------------LYAIPEGTILFPRDANGLPVPFIRVEGRYCDFGMYETAILGFICQASGIS------------TKASKVRLAAG-DSPFFSFGIRRMHP---AISPMIDRSAYIGGADGVSGILGAKLIDQDPVGTMPHALSIMLGDE-------EAWKLTLENTKNGQKSVLLIDTYMDEKIAEMFDKVDYIRLDTPSSRRGNFEALIREVRWELALRGRS--DIKIMVSGGLDENTVKKLREAGA----EAFGVGTSISS---AKPFDFAMDIVEV------NGKPETKRG----KMSGRKNVLRCTSCH.... 340
13 -57.0006azj_A mol:protein length:495 Nicotinamide phosphoribosyltransferase  ali model follow..  14  13..FNILLATDSYKVTHYKQYPPNTSKVYSYFENSKLRKVKYEETVFYGLQYILNYLKGKVVTKEKIQEAKDVYKVFNEKGWNYILEKY---AVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFLLPPYLRVIQGDGVDINTLQEIVEGMKQKENIAFGSGGGLLQKLTRDLLNCSFKCSYV-VTNGLGINVFKDPVADPNKKKGRLSLHRTPAGNF... 444
14 -55.7004jnm_A mol:protein length:501 Nicotinamide phosphoribosyltransferase  ali model follow..  13  9..FNILLATDSYKVTHYKQYPPNTSKVYSYFENSKLRKVKYEETVFYGLQYILNYLKGKVVTKEKIQEAKDQDDVFNEKGWNYILEKY---AVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASALVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTIAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKKLLPPYLRVIQGDGVDINTLQEIVEGMKSIENIAFGSGGGLLQKLTRDLLNCSFKCSYV-VTNGLGINVFKDPVADPNKKKGRLSLHRTPAGN.... 439
15 -54.8005nsd_A mol:protein length:497 Nicotinamide phosphoribosyltransferase  ali model follow..  13  9..FNILLATDSYKVTHYKQYPPNTSKVYSYFENSKLRKVKYEETVFYGLQYILNYLKGKVVTKEKIQEAKDQDDVFNEKGWNYILEKY---AVPEGFVIPRGNVLFTVENTDPECYWLTNWILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQE---TAGIGASAHLVNFKGTDTVLIKKYYGTKDPVPGYSVPAAEHSTIAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKVIQGDGVDINTLQEIVEGMKSIENIAFGSGGGLLQKLTRDLLNCSFKCSYV-VTNGLGINVFKDPVADPNKKKGRLSLHRTPAGNF... 440
16 -54.4005upe_A mol:protein length:499 Nicotinamide phosphoribosyltransferase  ali model follow..  14  9..FNILLATDSYKVTHYKQYPPNTSKVYSYFENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKD-DVFNEKGWNYILEKY---AVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFLLPPYLRVIQGDGVDINTLQEIVEGMKQIENIAFGSGGGLLQKLTRDLLNCSFKCSYV-VTNGLGINVFKDPVADPNKKKGRLSLHR......... 434
17 -47.6002i14_A mol:protein length:395 Nicotinate-nucleotide pyrophosphorylase  ali model follow..  17  18..IKAGKTTDVYFLRTKKILEVKNIRKKVLADVTTTSPNNWRWGVLVGVEEVAKLLEGIPVNVYAMP---------------------------EGTIFHPYEPVLQIEGDYADFGIYETALLGMLSQASGIA------------TAALRIKIAAK-FKPVYSFGIRHMHP---AIAPMIDRAAFIGGCDGVSGVLGAEMMGEKAVGTMPHALIITVGDQ-------VKAWKYFDEVIEEEVPRIVDTFYDEKVEAVMAAEALGKKLFAVRLDTGNFRKIIEEVRWELKVRGYD--WVKIFVSGGLDEEKIKEIVDV-----VDAFGVGGAIAS---AKPVDFALDIVEV------EGKPIAKRG----KLSGRKQVYRCENGH.... 337
18 -11.2005ayx_A mol:protein length:305 Nicotinate-nucleotide pyrophosphorylase [carboxylating]  ali model follow..  12  18.LVDSWLREDCPGLNYAALV----GAGPSQAALWAKSP-----GVLAGQPFFDAIFTQL--------------------------NCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAA-----------AAAVEAARGAGWTGHVAGTRKT----------------------TPGFRLVEKYGLLVGGAASHRYVMVKDNHVVAAGGVEKAVRAARQAADFTLKVEVE------SSLQEAVQAAEAGADLVLLDNFKP----EELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPH----IDVISMGM-LTQAA--PALDFSLKLFAKEVAPVPK............................... 295
19 -11.2004i9a_A mol:protein length:288 quinolinate phosphoribosyltransferase  ali model follow..  14  18.LADSWLREDCPGLNPVALV----GAAPSQAVLWAKSP-----GILAGRPFFDAIFAQV--------------------------NCQVSWFLPEGSKLVPVAKVAEVRGPAHCLLLGERVALNMLARCSGVASAA-----------ATAVETARGTGWAGHVAGTRKT----------------------TPGFRLVEKYGLLVGGATSHRYVMVKDNHVVAAGGVKQAVQGARRAANFALKVEVE------SSLQEALEAAEAGADLVLLDNFRP----EELHPTAAALKAQFPTVGVEASGGVTLDNLPQFCGPH----IDVISLGM-LTQAA--PALDFSLKLF........................................ 286
20 -11.2004kwv_A mol:protein length:301 Nicotinate-nucleotide pyrophosphorylase [carboxylating]  ali model follow..  12  22.LVDSWLREDCPGLNYAALV----GAGPSQAALWAKSP-----GVLAGQPFFDAIFTQL--------------------------NCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAA-----------AAAVEAARGAGWTGHVAGTRKT----------------------TPGFRLVEKYGLLVGGAASHRYVMVKDNHVVAAGGVEKAVRAARQAADFTLKVEVE------SSLQEAVQAAEAGADLVLLDNFKP----EELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPH----IDVISMGM-LTQAA--PALDFSLKLFAKEVAPVPK............................... 299
21 -10.8003c2r_A mol:protein length:295 Nicotinate-nucleotide pyrophosphorylase  ali model follow..  12  17.DVTNWLSEDVPSFDFGGYVV---GSDLKEANLYCKQD-----GMLCGVPFAQEVFNQCELQVE---------------------LFKEGSFLEPSKNDSGKIVVAKITGPAKNILLAERTALNILSRSSGIATAS-----------HKIISLARSTGYKGTIAGTRKT----------------------TPGLRRLEKYSMLVGGCDTHRYVMLKDNHIWATGSITNAVKNARAVCGFAVKIEVE------LSEDEATEAIEAGADVIMLDNFKGDGL-KMCAQSLKNKWNGKKHFLLECSGGLNLDNLEEYLCDD----IDIYSTSS-IHQGT--PVIDFSLKLAH....................................... 295
22 -9.8102b7n_A mol:protein length:273 Probable nicotinate-nucleotide pyrophosphorylase  ali model follow..  11  6.FLERALKEDLGHGDLFERVLE--KDFKATAFVRAKQE-----GVFSGEKYALELLEMT--------------------------GIECVQTIKDKERFKPKDALMEIRGDFSMLLKVERTLLNLLQHSSGIATLT-----------SRFVEALNSHKVRLLD--TRKT----------------------RPLLRIFEKYSVLNGGASNHRLLMLKDTHLRHVKDLKSFLTHARKNLPFTAKIEIE------ESFEEAKNAMNAGADIVMCDNLSV----LETKEIAAYRDAHYPFVLLEASGNISLESINAYAKSG----VDAISVGA-LIHQA--TFIDMHMKMA........................................ 273
23 -9.6505hup_A mol:protein length:315 Nicotinate-nucleotide pyrophosphorylase (Carboxylating)  ali model follow..  13  35.TLKAALREDV-DYSTNAIF----HHGQAKVSLFAKEA-----GVLAGLTVFQRVFTLFDAE-----------------------TFQNPHQFKDGDRLTSGDLVLEIIGSVRSLLTCERVALNFLQHLSGIASMT-----------AAYVEALGDDRIKVFD--TRKT----------------------TPNLRLFEKYAVRVGGGYNHRFIMLKDNHIAAVGSVQKAIAQARAYAPFVKMVEVE------ESLAAAEEAAAAGVDIIMLDNMSLEQIEQAITLIAGRSRIE-------CSGNIDMTTISRFRGLA----IDYVSSGS-LTHSA--KSLDFSMKGLTYLDV................................... 309
24 -9.5503tqv_A mol:protein length:287 Nicotinate-nucleotide pyrophosphorylase  ali model follow..  10  22.LVRESLAEDIATGDITAQL----EDIDTTAFCITREE-----MILCGQDFANEVINQLD------------------------KNIQITWLYSDAQKVPANARIFELKGNVRSILTAERTILNFIQMLSGTATVT-----------NKLVKLISQYKTKLLD--TRKT----------------------IPGFRLAQKYAVRCGGGFNHRIYLIKENHIRSAGGIAKAVTKAKKLDSNKVVEVEVTN------LDELNQAIAAKADIVMLDNFSGEDIDIAVSIARGKVALE-------VSGNIDRNSIVAIAKTG----VDFISVGA-ITKHIKAIDLSLQVQL......................................... 287
25 -9.3101o4u_A mol:protein length:285 Type II quinolic acid phosphoribosyltransferase  ali model follow..  11  13.LLMSFVKEDEGKLDLASFPL---NTTAGAHLLLKTEN-----VVASGIEVSRMFLEKM--------------------------GLLSKFNVEDGEYLEGTGVIGEIEGNTYKLLVAERTLLNVLSVMFSVATTTRRFAEKLKHAKIA---------------ATRKI----------------------LPGLGVLQKIAVVHGGGDPHRLVMIKDNHLKMYGSAERAVQEVRKIIPFTTKIEVE------ENLEDALRAVEAGADIVMLDNLSP----EEVKDISRRIKDINPNVIVEVSGGITEENVSLYDFET----VDVISSSR-LTLQEVFVDLSLEIQ.......................................... 278
26 -9.2403gnn_A mol:protein length:298 Nicotinate-nucleotide pyrophosphorylase  ali model follow..  13  32.NVADALAEDVGSGDQTGRLVP--DGAPRRARVIVRED-----AVLCGVPWFDAVVRAVD------------------------PSIEVDWRHREGDRMSADSTVCELRGPARALLTAERNALNFLQLLSGVASAT-----------RQYVDRIADTRARILD--TRKT----------------------LPGLRLAQKYAVRVGGGANQRLILIKENHIAAAGGVGEALDAAFALNAEVPVQIEVET------LDQLRTALAHGARSVLLDNFTLDMMRDAVRVTEGRAVLE-------VSGGVNFDTVRAIAETG----VDRISIGA-LTKDV--RATDYSMRIVE....................................... 298
27 -9.2303l0g_A mol:protein length:300 Nicotinate-nucleotide pyrophosphorylase  ali model follow..  11  23.IIHNALKEDL-DITTNSIL----INEKVNFAINTREN-----LVVCGIPILEEVFNMNK------------------------EHVKYEIHKKDGDITGKNSTLVSGEALAIYLLPIERVILNFIQHASGIASIT-----------RQFVDEVSGTKVKIRS--TRKT----------------------TPGLRMLDKYSVCIGGGESYRDVLIKDNHIASCGSITLAIQRLRKNLKNEYIAIECDN------ISQVEESLSNNVDMILLDNMSISEIKKAVDIVNGKSVLE-------VSGCVNIRNVRNIALTG----VDYISIGC-ITNSF--QNKDIGLDIEYNNN.................................... 293
28 -9.2001x1o_A mol:protein length:286 nicotinate-nucleotide pyrophosphorylase  ali model follow..  13  17.ALRAWLREDL-DLTSLLVV----EDLEGEAVILAKEG-----GVLAGLWVAERVFALAD------------------------PRTAFTPLVAEGARVAEGTEVARVRGPLRGILAGERLALNLLQRLSGIATLT-----------RAYVEALAGTKAQILD--TRKT----------------------TPGLRALEKYAVRVGGGRNHRYILLKENHVRAAGGVGEAVRRAKARAPHYLKVEVE------RSLEELEEALEAGADLILLDNFPLEALREAVRRVGGRVPLE-------ASGNMTLERAKAAAEAG----VDYVSVGA-LTHSA--KALDLSLLVVR....................................... 285

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 5 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.