current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683425|ref|YP_213569.1| 30S ribosomal protein S14 (BF3990) [Bacteroides fragilis NCTC 9343] (Range: 1-99), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
2 -62.5005mmj_n mol:protein length:100 30S ribosomal protein S14, chloroplastic  ali model follow..  44  1MARKSLIQREKKRRNLEQKYHLIRRSSKQEIRKVTSLSKWEIHGKLQSPPRNSAPARLHRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW 100
5 -54.0003jd5_N mol:protein length:128 28S ribosomal protein S14, mitochondrial  ali model follow..  32  31...DWRMLRDVKRRKMAYEYADERLRINSLRKNTILPKQEVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAIW 128
6 -43.6005nd8_n mol:protein length:61 30S ribosomal protein S14 type Z  ali model follow..  40  3........................................KTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW 61
7 -40.0005o5j_N mol:protein length:61 30S ribosomal protein S14 type Z  ali model follow..  42  3......................................KKALVHKANKKPKFA--VRAYTRCNKCGRPHSVYRKFGLCRICLREMAHAGELPGVQKSSW 61
8 -39.7005v93_n mol:protein length:61 30S ribosomal protein S14 type Z  ali model follow..  40  3......................................KKALVNKAAGKPRFA--VRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW 61
9 -39.4006ha1_n mol:protein length:61 30S ribosomal protein S14  ali model follow..  47  3......................................KKSMIAKQQRTPKFK--VQEYTRCERCGRPHSVIRKFKLCRICFRELAYKGQIPGVKKASW 61
10 -39.0001fjg_N mol:protein length:61 30S RIBOSOMAL PROTEIN S14  ali model follow..  38  3......................................RKALIEKAKRTP--KFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61
11 -10.9005xyi_d mol:protein length:57 40S ribosomal protein S29, putative  ali model follow..  31  10.................................................PRDNAKGSVERSCRICGKRRGVIRQYRLCRRCFRERAEL----GFKKYD. 57

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.