current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683563|ref|YP_213707.1| putative SufE Fe/S-cluster-related protein (BF4142) [Bacteroides fragilis NCTC 9343] (Range: 1-142), from B.fragilis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MSINELQDEVVAEFSDFDDWMDRYQLLIDLGNEQEPLDEKYKTEQNLIEGCQSRVWLQADEVDGKIIFKAESDALIVKGIIALLIKVVSGHTPDEILNSELYFIDKIGLKDHLSPTRSNGLLSMVKQMRMYALAFKAKEAKGLast
1 -74.9001mzg_A mol:protein length:146 SufE Protein  ali model follow..  32  1MALLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIVMRQNQGIIELQGDSDAAIVKGLIAVVFILYDQMTPQDIVNFDVPWFEKMALTQHLTPSRSQGLEAMIRAIRAKAAALSLE.... 140
2 -73.7003g0m_A mol:protein length:141 Cysteine desulfuration protein sufE  ali model follow..  30  4MAALPDKEKLLRNFTRCANWEEKYLYIIELGQRLAELNPQDRNPQNTIHGCQSQVWIVMRRNNGIIELQGDSDAAIVKGLMAVVFILYHQMTAQDIVHFDVRWFEKMALAQHLTPSRSQGLEAMIRAIRAKAATLS...... 141
3 -73.6004lw4_C mol:protein length:150 Cysteine desulfuration protein CsdE  ali model follow..  29  14FGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVANGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPALFDELGLRAQLSASRSQGLNALSEAIIAAAKQV....... 150
4 -73.6001ni7_A mol:protein length:155 Hypothetical protein ygdK  ali model follow..  28  11FGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVANGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPALFDELGLRAQLSASRSQGLNALSEAIIAATKQVLE..... 149
5 -67.5001wlo_A mol:protein length:136 sufE protein  ali model follow..  20  2..VPPKLKQALELFKSL-PKELRSQVLLEYAAKVPPPPP--GVELERVHECQTPFFVHADVEGGKLYFHVPDEAPTVKAFAGLLREGLEGESPEAVLEVPPGFYRGYGLEEFFTPLRLRGLEAALLRLQAQVRKALTS.... 136
6 -8.6004eb5_C mol:protein length:153 NifU protein (NifU-1)  ali model follow..  10  14...............................RNVGKIEDADGVGTVGNPVCGDLMTIYIKVKDNRIKFQTFG-CAAAIATSSMATEMAKGKTIEEALKITRDAVAEA---GGLPKQKMHCSNLAADALRRAIVDYFRKNGK. 123
7 -8.5505uft_A mol:protein length:150 Nitrogen-fixing NifU-like, N-terminal  ali model follow..  12  12........................KRILEFAGNIGQLAEPDAVATVHSKLCGSTVTVYLKMRDGVVT----KACALGQASSSVMARNVIGATADELRAARDAMYRMLK-PVRDYKARHASTLLTFDAVADCIRQIEEKAKAA 150
8 -7.8105xt5_D mol:protein length:155 Zinc-dependent sulfurtransferase SufU  ali model follow..  16  1MSFNANLDTLYR------------QVIMDHYKNPRNKGVLNDSIVVDMNNCGDRIRLTMKLDGDIVKFEGEG-CSISMASASMMTQAIKGKDIETALSMSKIFSDMM................................... 99
9 -7.1802qq4_A mol:protein length:138 Iron-sulfur cluster biosynthesis protein IscU  ali model follow..  15  1................MSVLDELYREILQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIRFQGQG-CAISTASASLMTEAVKGKKVAEALELSRKFQAMV................................... 97
10 -6.7402z7e_A mol:protein length:157 NifU-like protein  ali model follow..  12  17...............................RNVGVLEDANGVGQCGNPACGAAMLFTIKVNPENVRFKTFG-CGSAIAVSSMLTEMVKGKPIQYALNLTYKDIFEE---GGLPPQKIHCTNLGLETLHVAIKDYLMKQGR. 128

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.