current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681243|ref|YP_211387.1| hypothetical protein (BF1751) [Bacteroides fragilis NCTC 9343] (Range: 1-157), from B.fragilis

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MDKEQFKSIVHPVMKANSFRRKGNSWYKTTAECIVVFNLQHSLYGKMFYINLAALLRKGDDLLFPKEYQCDIRMRFPIMEIEGYSTQMILDLESTIDEQLRSRLIENIINISIPILQKLESIDGIIELYGEKPELNNIYPFSSILYRKEMNNKLKAILast
1 -48.300PF14137.6; A6LYB2_CLOB8/32-184; Domain of unknown function (DUF4304 topsan)  ali follow..  10  1.........IVPGFKEKGFRKNGKTFYRKRDGLTEVCNVKFSRDNSRFWLQVCIAIPSFYDKYDKKWEATIFNIESDSLIGWE-NGLSNFHYPPYM-LDLWNSRLIAVSLTETRKDEKEELLKDKLDSRYNKQTGEGFNEVVASDIENVIIKFFNT. 153
2 -7.870PF03923.13; B7VKC9_VIBTL/28-186; Uncharacterized lipoprotein  ali follow..  49..RISLENAIAQQLESQGFRASVNSENSIVLEIQEAVTVKHTIMENQMDGKVTLEVTAETP-----------EGKLVKTFNGTATRTGALSASNDDIATVLNDVIDLV-------LKEIANDQELQTYMK........................... 159
3 -7.560PF05367.11; A0ZXJ0_9CAUD/1-149; Phage endonuclease I  ali follow..  16..RSGLEEKNMKLLESKGVK-----AEYEMWRVPYVVPASNHHYTPDILLPNGIFVETKGLWESDDRKKHLLIRE---QYPDLDIRLVFSSSRTKIYKGSPTSYAEFCEKHGILFADKLIPVAWLKEASRP.......................... 136
4 -7.260PF07042.11; P71176_KLEAE/126-407; TrfA protein  ali follow..  114..GEPVSFTFYELCQDLDWSINGRYYTRAEECLTRLMQFSSQRIGRLESVSLIRRFRVLDRGKRTSRCQVEIDAEIVVLFAGDHYTKFVWEKYRKLSPNRDGRMFDYFATHKEPYPLKLETFRLMCGS--REQVGEACDELRENGLVESAWVNDDLV 278
5 -7.140PF04376.13; D7DIV2_METV0/20-90; Arginine-tRNA-protein transferase, N terminus  ali follow..  16  17TPQHLIDAHIYSGLIQQGFRRSGKFAYRPH............................................................................................................................... 46
6 -6.920PF16145.5; E8JK07_9ACTO/47-183; Domain of unknown function (DUF4853 topsan)  ali follow..  65LTDEDIEAAASQYLSVLPLYKGTRG--DVQKDGSFVLRSGDAANGGELQVNY......................................................................................................... 114
7 -6.450PF12993.7; R5I232_9FIRM/3-175; Domain of unknown function, E. rectale Gene description (DUF3877 topsan)  ali follow..  5..ENSIIDVIKEEQAKLGYRKEEIRLYYPLSSLDHFFETEADAEEMKKILA---------------GFGAYTKEKLGNVLVSNKGDRFCFHIPEQGAEYVHAHMKPNIRELVELVGKHGCTMQQVKDLFLS.......................... 120
8 -6.240PF14920.6; F7G3Z3_ORNAN/259-510; MDM2-binding  ali follow..  11  189..TRMLKEVVAKTLKKHNMTEDHECFSACSQRLFEISDLKTSRGLLEEMKKTA........................................................................................................ 244
9 -6.180PF06504.11; A1W8X4_ACISJ/2-273; Replication protein C (RepC)  ali follow..  101.DALVVRESMTSLLGEIGLTDGGDNIRAIKASLLRMVVVTKGSRQRSFHL-------SYAFDEEDGRLFVALNPQIEAILGRRPYTRIEMAEVRALQTDPARLIHQRLCGWIDPGKAGRVELDTLSGYVWPDQANAEAMKKRRQKARKALAELATV. 254
10 -5.830PF18762.1; A0A095SVY7_9FLAO/50-209; Serine/Threonine/Tyrosine Kinase found in polyvalent proteins  ali follow..  21  100.NQPTDLSKVKEFMIANGFENTRNHDYYHSELGIILEDLHDENVGILYFIDTVFYIKQ................................................................................................... 160

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.