current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343] (Range: 1-245), from B.fragilis

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 -8.690d3bwta_ a.118.1.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  7VLDQYIGSIHSLCKDQHGCRFGSKAADAIFEETKDYTVELMTDSFGKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQK------ECIKTDEEAQIVVDSLRPYTVQLSKDLNGNHVIQK-SDSCIDIATHRHGCCVLQR-LALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHKFGSNVIEK---KTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQT. 290
2 -6.860d1ib2a_ a.118.1.8 (A:) Pumilio 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  18QLREIAGHIMEFSQDQHGSRFTPAERQLVFNEILQAAYQLMVDVFGKFFEFGSLEQKLALAERIRGHVLSLALQMYGCNEMVRELDGHVLKCVKDQNGNHVVQK-----IECVQPQSLQFIIDAFKGQVFALSTHPYGCRVIQ----RILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQH-RGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSTMMKDQYANYVVQ.. 299
3 -6.300d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  1.........................................FSRIVRDVERLIAVEKYSLQGVVDGDKLLVVGFSEGSVNAYLYDGGETVKLNREPINSVLDPHYGVGRVILVRDVSKGAKVNTSRPGEEQRLEAVKPMRILSVDTGEAVVFTGATEDRVALYALDGGGLRELARLPGFGFVSDIRGDLIAGLGFFGGGRTSNLSSGGLRVFDSGEGSFSSASISPGMKVTAGLETAREARLVTV 215
4 -6.160d2nrha1 c.55.1.13 (A:2-82) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  13  1LLCDIGNSNANF-LDDNKYFTLNIDQFLEFKNEQKIFYINVNEHLKEHLKNQKNFINLEPYFLFDTIYQGLGID........................................................................................................................................................................... 73
5 -5.140d2biba1 b.109.1.1 (A:309-541) Teichoic acid phosphorylcholine esterase Pce (LytD), C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}  ali model 3D-neighbors follow..  11  8..............................KSAYGNWWYQAPDSTGEYAVGWNEIEGEWYYFNQTGILLQNQWKKWNNHWFYLTDSGASAKNWKKIDGIWYYFNKENQMEIGWVQDKEQWYYLDVDGSMKTGWLQYMGQWYYFAPSGEMKMGWVKDKETWYYMDSTGVMKTGEIEVAGQHYYLEDSGAMKQGWHKKANDWYFYKTDGSRAVGWIKDKDKWYFLKENGQLLV------NGKTPEGY 216
6 -5.060d2ymua1 b.69.4.0 (A:5-290) automated matches {Nostoc punctiforme [TaxId: 272131]}  ali model 3D-neighbors follow..  7RLEAHSSSVRGVAFSPDGQTIASASDLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKL--NRNGQQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKL--NRNGQQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKL--NRNGQQTLTGHSSSVNGVAFRPDGQTIAS.. 275
7 -5.060d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  11  37IVADTNNRIQIFDKEPNRVAVVRNSGDIIVTERSPTHQIQIYNQYGQFVRKFG-----------------------------ATILQHPRGVTVDNKGRIIVVECKVMRVII-FDQNGNVLHKFGCSKHLEVVVNDKQEIFISDNRAHCVKV-FNYEGQYLRQIGGEGITNVGINSNGEILIADNHNNFNLTIFTQDGQLISALESKVKHAVALMDDGSVVLASKDYRLYIYRYV.......... 272
8 -5.040d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  4LFFTNRHEVRKMTLDRSEYTIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDR---------------AHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTG...... 239
9 -4.930d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12ALSGHRSPVTRVIFHPVFSVMVSASEERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTITFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKEAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKT.. 284
10 -4.620d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  7VRYGHNKAITALSSSADGKTLFSEGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVGSGVDSSKAVANKLSSQPLGLAVSADGDIAVAACYKHIAIYSH---GKLTEVPISYNSSCVALSNDKQFVAVGGQDSKVHVSGASVSEVKTIVHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANNFELWTFHTAKVACVSWSPDNVRLATGSLDNSVIV............. 250

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.