current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682225|ref|YP_212369.1| putative two component system response regulator (BF2753) [Bacteroides fragilis NCTC 9343] (Range: 1-225), from B.fragilis

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKILIIEDEPSLRELIQRSLEKERYVVEAAADFQSGLRKIEDYDYDCVLLDIMLPDGNGLNLLEQLKKMRKRENVIIISAKDSLDDKVLGLELGADDYLPKPFHLAELNARIKSVIRRQRRDGEMDIRLANIRIVPDTFQVFVDDKEIELNRKEYDILLYFANRPGRLVNKNTLAESVWGDHIDQVDNFDFIYAQIKNLRKKLKDAGALAELKAVYGFGYKMTVELast
1 -62.500d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  38  2VRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNEPFDVVILDIMLPVHDGWEILKSMRESGVNTPVLMLTALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRRKSE........................................................................................................ 122
2 -60.800d4q7ea_ c.23.1.0 (A:) automated matches {Leptospira biflexa [TaxId: 355278]}  ali model 3D-neighbors follow..  35  4.RILLVEDDEGLGETLKERLEQDKYRVEWAKTISEAENLYRPNAFDLVVLDLRLPDGNGFDLAEMIVKKEKDLPFLFLTAQAGAQERLRGFELGAAEFIPKPFHLKEFLIRLERVISLTRP........................................................................................................ 123
3 -60.200d4lzla_ c.23.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 914130]}  ali model 3D-neighbors follow..  26  2KRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKPVLIENLVARISAIFRGRD......................................................................................................... 121
4 -59.900d3w9sa_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]}  ali model 3D-neighbors follow..  37  1.KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLR............................................................................................................ 116
5 -58.900d2qzja_ c.23.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}  ali model 3D-neighbors follow..  27  3.KILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNV-TTCPIVYMTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNS........................................................................................................ 121
6 -58.700d2jbaa_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  36  3.RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRRISP........................................................................................................ 124
7 -58.300d3t6ka_ c.23.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}  ali model 3D-neighbors follow..  29  4.TLLIVDDDDTVAEMLELVLRGAGYEVRRAASGEEALQQIYKNLPDALICDVLLPGIDGYTLCKRVRQHPKTLPILMLTAQGDISAKIAGFEAGANDYLAKPFEPQELVYRVKNILAR........................................................................................................... 122
8 -57.400d4nica_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  32  2.KIVFVEDDPEVGTLIAAYLGKHDMDVVVEPRGDRAEEVIAREKPDLVLLDIMLPGKDGMTLCRDLRGQ-WQGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQ........................................................................................................... 117
9 -57.000d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  35  3.HIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERS-TVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRID......................................................................................................... 120
10 -56.000d1p2fa2 c.23.1.1 (A:3-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  28  1WKIAVVDDDKNILKKVSEKLQQLGR-VKTFLTGEDFLNDEEA--FHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKK........................................................................................................ 118
11 -55.800d3rqia_ c.23.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}  ali model 3D-neighbors follow..  17  3.NFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEAVVLSVDRLEWEHIQRVLAENNNNISATARALNMHRRTLQR............................................................. 169
12 -55.200d3gl9a_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  33  3.KVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN............................................................................................................ 120
13 -54.300d3cg4a_ c.23.1.0 (A:) automated matches {Methanospirillum hungatei [TaxId: 323259]}  ali model 3D-neighbors follow..  21  4.DVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQ....................................................................................................... 126
14 -54.100d3ltea_ c.23.1.0 (A:) automated matches {Bermanella marisrubri [TaxId: 207949]}  ali model 3D-neighbors follow..  25  2.RILVVDDDQAMAAAIERVLKRDHWQVEIAHNGFDAGIKLSTFEPAIMTLDLSMPKLDGLDVIRSLRQNKANQPKILVVSGLDKAKLQQAVTEGADDYLEKPFDNDALLDRIHDLVN............................................................................................................ 118
15 -53.600d5dcla_ c.23.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}  ali model 3D-neighbors follow..  33  4.KIYIVEDDMTIVSLLKDHLS-ASYHVSSVSNFRDVKQEIIAFQPDLILMDITLPYFNGFYWTAELRKF-LTIPIIFISSSNDEMDMVMALNMGGDDFISKPFSLAVLDAKLTAILR............................................................................................................ 117
16 -53.600d5t3ya_ c.23.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 87883]}  ali model 3D-neighbors follow..  25  4.TILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLSADTPILVLTTEGSDAFKAAARDAGATGWIEKPIDPGVLVELVATLSEPAAN........................................................................................................ 125
17 -53.400d2plna1 c.23.1.0 (A:1-114) automated matches {Helicobacter pylori [TaxId: 210]}  ali model 3D-neighbors follow..  27  1MRVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMV----SDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYSIKALVARIEARLR............................................................................................................ 114
18 -53.400d3a0ua_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  30  3.RILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDLSSW--AADEYVVKSFNFDELKEKVKKLL............................................................................................................. 115
19 -53.200d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  24  3FRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRQLSTCDLLIVSDQLVDLSIFSLLDIVKEQTKQPSVLILTTGRHELIESSE---HNLSYLQKPFAISELRAAIDYHKPS........................................................................................................... 118
20 -51.600d3cfya1 c.23.1.0 (A:2-128) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}  ali model 3D-neighbors follow..  26  3.RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLEDL..................................................................................................... 125
21 -50.800d3n53a1 c.23.1.0 (A:2-127) automated matches {Pelobacter carbinolicus [TaxId: 338963]}  ali model 3D-neighbors follow..  31  2.KILIIDQQDFSRIELKNFLD-SEYLVIESKNEKEALEQIDHHHPDLVILDMDIIGENSPNLCLKLKRSKKNVPLILLFSSEHKEAIVNGLHSGADDYLTKPFNRNDLLSRIEIHLRTQNYYSD..................................................................................................... 125
22 -50.700d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}  ali model 3D-neighbors follow..  26  7IKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK......................................................................................................... 129
23 -50.600d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  31  7.QILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKPVKLNRLREMVFACL............................................................................................................. 122
24 -50.500d2v0na1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  32  3.RILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVCRKLKDDPRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTRFKLVIDE..................................................................................................... 127
25 -50.000d2gkga_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 34]}  ali model 3D-neighbors follow..  27  2.KILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLAGQNGYLICGKLKKDDKNVPIVIIGNPDGF-AQHRKLKAHADEYVAKPVDADQLVERAGALIGFPE......................................................................................................... 122
26 -49.800d3c3ma1 c.23.1.0 (A:3-123) automated matches {Methanoculleus marisnigri [TaxId: 368407]}  ali model 3D-neighbors follow..  26  2.TILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDPRDIPVLMLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLARR.......................................................................................................... 121
27 -49.600d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  24  5LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAXXSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG......................................................................................................... 127
28 -49.600d3gt7a_ c.23.1.0 (A:) automated matches {Syntrophus aciditrophicus [TaxId: 56780]}  ali model 3D-neighbors follow..  28  3.EILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALCRWLKGQPRTIPVILLTILSDPRDVVRSLECGADDFITKPCKDVVLASHVKRLLSGVKRTEE..................................................................................................... 127
29 -49.500d2zaya_ c.23.1.0 (A:) automated matches {Desulfuromonas acetoxidans [TaxId: 281689]}  ali model 3D-neighbors follow..  19  2WRIMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLFNSLKKNPASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRLSARIKRVLK............................................................................................................ 120
30 -48.900d2qxya1 c.23.1.0 (A:4-121) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  24  3.TVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDV-FEGEESLNLIRRIREEFPDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVKKIISS........................................................................................................... 118
31 -48.800d4h60a1 c.23.1.0 (A:1-119) automated matches {Vibrio cholerae [TaxId: 345073]}  ali model 3D-neighbors follow..  26  3.KVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL............................................................................................................. 119
32 -48.100d5lwka_ c.23.1.0 (A:) automated matches {Lactobacillus paracasei [TaxId: 1597]}  ali model 3D-neighbors follow..  30  2TNILIVEDDPMVQFIHRNYLEKIGTTIYSSETIADAKKLLASRSIQLVLLDIRLKDGNGIDFLTDLRRTKQTVDVILITAANEVNIVNDALHLGVIDYLIKPFTLERFEKSIQRYRTK........................................................................................................... 121
33 -48.000d3grca_ c.23.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  22  4.RILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRDLAIVVVSANAREGEEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMA......................................................................................................... 125
34 -47.600d2v0na2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  22  15.RVLIVDDNERQAQRVAAELGVEHRPV--IESDPEKAKISAGGPVDLVIVNAAAKNFDGLRFTAALRSEERQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRKRYTDY..................................................................................................... 137
35 -47.300d3crna1 c.23.1.0 (A:2-122) automated matches {Methanospirillum hungatei [TaxId: 323259]}  ali model 3D-neighbors follow..  36  2.RILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFDIKLPDMEGTELLEKAHKLRPGMKKIMVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEK........................................................................................................ 121
36 -46.600d3hzha_ c.23.1.0 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}  ali model 3D-neighbors follow..  26  14FNVLIVDDSVFTVKQLTQIFTSEGFNIDTAADGEEAVIKYKNHYPDIVTLDITMPKMDGITCLSNIMEFDKNARVIMISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK........................................................................................................... 134
37 -46.000d3nhma_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  24  2.KVLIVENSWTMRETLRLLLSG-EFDCTTAADGASGLQQALAHPPDVLISDVNMDGMDGYALCGHFRSEPKHIPVIFVSGYAP-RTEGPADQPVPDAYLVKPVKPPVLIAQLHALLARAE......................................................................................................... 120
38 -45.700d1ys6a1 a.4.6.1 (A:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  21  1.....................................................................................................................STATSSSETITVGPLEVDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWG--YDFAADTNVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ 106
39 -45.300d1gxqa_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  23  2........................................................................................................................MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWG--TNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTR 104
40 -44.500d3luaa1 c.23.1.0 (A:2-125) automated matches {Clostridium thermocellum [TaxId: 203119]}  ali model 3D-neighbors follow..  21  3.TVLLIDYFEYEREKTKIIFDNIGYDFIEVENLKKFYSIFKDLDITLIIMDIAFPEKEGLEVLSAIRNNSANTPVIIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLK............................................................................................................ 123
41 -44.300d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  30  1.........................................................................................................................SKSTKLVCGDLILDTATKKAYRGSKEIDLTKKEYQILEYLVMNKNRVVTKEELQEHLWS--FDDEVFSDVLRSHIKNLRKKVDKGFKKKIIHTVRGIGYVARDE 102
42 -43.800d3eqza1 c.23.1.0 (A:3-125) automated matches {Colwellia psychrerythraea [TaxId: 167879]}  ali model 3D-neighbors follow..  23  2.RVFIVDDDTLTCNLLKTIVEPIFGNVE-AFQHPRAFLTLSLNKQDIIILDLMMPDMDGIEVIRHLAEHKSPASLILISGYDSAETLALSCGLNVINTFTKPINTEVLTCFLTSLSNRQ.......................................................................................................... 123
43 -43.800d2hqra2 a.4.6.0 (A:118-223) automated matches {Helicobacter pylori [TaxId: 85963]}  ali model 3D-neighbors follow..  20  1...........................................................................................................................SNVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRDQIVSKEQLLDAIWE--EPEMVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYP 100
44 -43.800d3hdva_ c.23.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}  ali model 3D-neighbors follow..  18  3.LVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLYQKRIGLMITDLRMQPESGLDLIRTIRAERAALSIIVVSGDTDVEEAVDVMHLGVVDFLLKPVDLGKLLELVNKELK............................................................................................................ 120
45 -43.800d3q9va_ a.4.6.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  24  1............................................................................................................................ESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQGRLP--EGSNVVDVHMANLRAKLRDLDGYGLLRTVRGVGYALR.. 97
46 -43.700d2jzya_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  22  2..........................................................................................................................AATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFD--SDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIR 102
47 -43.600d2qr3a1 c.23.1.0 (A:2-125) automated matches {Bacteroides fragilis [TaxId: 295405]}  ali model 3D-neighbors follow..  22  2.TIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTGNEGLFWLHEIKRQYRDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQA.......................................................................................................... 124
48 -43.500d3q15c_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  32  2.KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL............................................................................................................. 116
49 -43.500d2jrla_ c.23.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}  ali model 3D-neighbors follow..  27  3.RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELFFPVIVLDVWMPDGDGVNFIDFIKENSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEEYS......................................................................................................... 121
50 -43.300d2mska_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  30  5.IVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE........................................................................................................ 124
51 -43.300d1m5ta_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  27  3.KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLERQ.......................................................................................................... 122
52 -43.200d4d6ya_ c.23.1.0 (A:) automated matches {Brucella abortus [TaxId: 235]}  ali model 3D-neighbors follow..  30  1.DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGLDGLALLDEIKKQHPELPVVMISGHGNIETAVSAIRRGAYDFIEKPFKADRLILVAERALETSK......................................................................................................... 121
53 -42.800d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  26  9MMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVRKSRDS.................................................................................................... 133
54 -42.500d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  28  1MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLLPDVNGLEILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRKLRKENELLRREKD............................................................................................ 133
55 -42.400d2pmub_ a.4.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  21  1.......................................................................................................................KEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWR--YDFGGDVNVVESYVSYLRRKIDT-GEKRLLHTLRGVGYVLRE. 102
56 -42.000d2hwva1 a.4.6.0 (A:134-232) automated matches {Enterococcus faecalis [TaxId: 226185]}  ali model 3D-neighbors follow..  24  1..............................................................................................................................MTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWG--YDYFGDVRTVDVTVRRLREKIESPSHPTYLVTRRGVGYYLRNP 98
57 -41.900d4ixaa_ a.4.6.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}  ali model 3D-neighbors follow..  25  2............................................................................................................................EQLEFDGLVLKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLEKVWG--YDYYEDANTVNVHIHRIREKLEHDFLPYTITTVWGLGYKFERS 101
58 -41.300d3jtea1 c.23.1.0 (A:4-128) automated matches {Clostridium thermocellum [TaxId: 203119]}  ali model 3D-neighbors follow..  31  2.KILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENSIDVVITDMKMPKLSGMDILREIKKITPHMAVIILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAINRKK......................................................................................................... 122
59 -41.200d1qkka1 c.23.1.1 (A:5-143) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}  ali model 3D-neighbors follow..  21  2.SVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKRRLVMENRSLRRAAE............................................................................................ 133
60 -41.100d5tqja_ c.23.1.0 (A:) automated matches {Burkholderia phymatum [TaxId: 148447]}  ali model 3D-neighbors follow..  25  4..VVVVDDDASVGRAIRRLLRSVGIAADTYTSGDEFLDVLSAYRPDCVILDVQMPGSNGIEVQRRLA--GGAVPVIFITAHDDAGVRETALAAGARAYLRKPFNDVLFIRTVCAVLGIAAP........................................................................................................ 123
61 -41.100d2k4ja1 a.4.6.0 (A:13-115) automated matches {Helicobacter pylori [TaxId: 85963]}  ali model 3D-neighbors follow..  22  1........................................................................................................................EEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESES--INPESSNKSIDVIIGRLRSKIENPKQPQYIISVRGIGYKLE.. 102
62 -40.900d4euka_ c.23.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  20  3PKILLVEDNKINIMVAKSMMKQLGHTMDIANNGVEAITAINSSSYDLVLMDVCMPVLDGLKATRLIRSYENRLPIIAMTANTLAESSEECYANGMDSFISKPVTLQKLRECLQQYLH............................................................................................................ 147
63 -40.700d4nhja_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  23  2...........................................................................................................................HKTISFGSLTIDPVNRQVMLGGENVALSTADFDMLWELATHAGQIMDRDALLKNLRGVTYD--GMDRSVDVAISRLRKKLLNATEPYRIKTVRNKGYLFAPH 102
64 -40.600d4uhta_ a.4.6.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  24  1...........................................................................................................................SPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLT--PFDHAIDMHISNLRRKLPDKDGHPWFKTLRGRGYLMVSA 101
65 -40.600d3hdga1 c.23.1.0 (A:8-130) automated matches {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  27  2LKILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIRMPKLGGLEMLDRIKAGGAKPYVIVISAFSEMKYFIKAIELGVHLFLPKPIEPGRLMETLEDFRHIKLAK....................................................................................................... 123
66 -40.300d2m87a_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1185418]}  ali model 3D-neighbors follow..  24  1........................................................................................................................NQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYS--WDNEPATNTLEVHIHNLREKIGK----SRIRTVRGFGYMLANN 99
67 -40.200d3zq7a_ a.4.6.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  19  2...........................................................................................................................DPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWG--PNAVEHSHYLRIYMGHLRQKLEDPARPRHFITETGIGYRFM.. 100
68 -40.100d1p2fa1 a.4.6.1 (A:121-217) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  30  1............................................................................................................................GLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVS----PRVVDTVIKRIRKAIEDPNRPRYIKTIWGVGYMFT.. 96
69 -39.800d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}  ali model 3D-neighbors follow..  21  6..VHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH........................................................................................................... 121
70 -39.800d1opca_ a.4.6.1 (A:) OmpR {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  1.............................................................................................................................VIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARG--REYSAMERSIDVQISRLRRMVEDPAHPRYIQTVWGLGYVFVPD 99
71 -39.500d5kbxb_ c.23.1.0 (B:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  24  6INVLIVEDNVINQAILGSFLRKHKISYKLAKNGQEAVNIWKEGGLHLIFMDLQLPVLSGIEAAKQIRDFEKPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHALSKKITEWG............................................................................................................. 149
72 -39.400d3i42a1 c.23.1.0 (A:19-134) automated matches {Methylobacillus flagellatus [TaxId: 265072]}  ali model 3D-neighbors follow..  27  2.QALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHAMSTRGYDAVFIDLNLPDTSGLALVKQLRALPKTSKFVAVSGFAK-NDLGKEACELFDFYLEKPIDIASLEPILQSI.............................................................................................................. 116
73 -38.300d3khta_ c.23.1.0 (A:) automated matches {Hahella chejuensis [TaxId: 349521]}  ali model 3D-neighbors follow..  23  2KRVLVVEDNPDDIALIRRVLDRKDIQLEFVDNGAKALYQVQQAKYDLIILDIGLPIANGFEVMSAVRKPGQHTPIVILTDNVSDDRAKQCMAAGASSVVDKSSNVTDFYGRIYAIFSY........................................................................................................... 124
74 -37.500d3ktoa_ c.23.1.0 (A:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}  ali model 3D-neighbors follow..  20  3..IYLVDHQKDARAALSKLLSPLDVTIQCFASAESFMRQQISDDAIGMIIEAHLEDKSGIELLETLVKRGFHLPTIVMASSSDIPTAVRAMRASAADFIEKPFIEHVLVHDVQQIINGAK......................................................................................................... 122
75 -37.400d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  14  8LKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSH-EHKVVFMDVCMPGVENYQIALRIHEKFTKPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYE...................................................................................................... 134

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.