current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682385|ref|YP_212529.1| putative CTP pyrophosphohydrolase (BF2916) [Bacteroides fragilis NCTC 9343], from B.fragilis

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
1 -83.600d3gwya1 d.113.1.0 (A:2-129) automated matches {Bacteroides fragilis [TaxId: 272559]}  ali model 3D-neighbors follow..  100  1.KSIEVVAAVIRLGEKYLCVQRGQTKFSYTSFRYEFPGGKVEEGESLQEALQREIMEEMDYVIEVGEKLLTVHHTYPDFEITMHAFLCHPVGQRYVLKEHIAAQWLSTREMAILDWAEADKPIVRKISE. 128
2 -80.000d2rrka1 d.113.1.0 (A:6-140) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  34  1MKMIEVVAAIIERDGKILLAQRPAQS--DQAGLWEFAGGKVEPDESQRQALVRELREELGIEATVGEYVASHQREVSGRIIHLHAWHVPDFHGTLQAHEHQALVWCSPEEALQYPLAPADIPLLEAFMA. 127
3 -78.200d3eesa_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}  ali model 3D-neighbors follow..  33  1.HWIPVVAGFLRKDGKILVGQRPENN--SLAGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFYEILYWKGEPRAKHHMMLEWIHPEELKHRNIPEANRKILHKIYKA 127
4 -77.700d3a6sa_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  25  1MKKLQIAVGIIRNNNEIFITRRAADA--HMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKR. 128
6 -62.800d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  16  1VKQVPLAVAVLADEGRVLIRKRDSTG--LLANLWEFPSCETD-GADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGRLVHGGP---VEEPYRLAPEDELKAYAFPVSHQRVWREYKEW 125
7 -53.300d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}  ali model 3D-neighbors follow..  17  6.LTILTNICLIEETQRVVMQYRAPEN--NRWSGYAFPGGHVENDEAFAESVIREIYEETGLTIQNPQLVGIKNWPLDTGRYIVICYKATEFSGTLQSSEEGEVSWVQKDQIPNLNLAYDMLPLMEMMEAP 135
8 -52.800d5ws7a_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1MKASRLTLVLVLQPQRVLLGMKKRGFG---AGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPMDVHVFATDSIQGTPVESDEMRPSWFQLDQIPFKDMWPDDSYWFPLLLQK 130
9 -50.900d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  9PREESSATCVLEQGAQILLVQRPNS--GLLAGLWEFPSVTWEPSEQLQKALLQELQRWAGLPATHLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKVFRVYQGQ 142
10 -46.100d1k2ea1 d.113.1.1 (A:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  21  1...MIVTSGVLVENGKVLLVKHKR------LGVYIYPGGHVEHNETPIEAVKREFEEETGIVVEPIGFTYGIIDENAVERPMPLVILEEVVKYKRVGGDLKNGEWIDVREIDRIETFPNVRKVVSLALST 135
11 -41.000d2azwa1 d.113.1.1 (A:2-143) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  19  20.....AYIIVSKPENNTMVLVQAPN------GAYFLPGGEIEGTETKEEAIHREVLEELGISVEIGCYLGEADERQTAYYNPGYFYVANTWRQLSELERTNTLHWVAPEEAVRLLKRGSHRWAVEK.... 141
12 -40.400d3fk9a1 d.113.1.0 (A:2-153) automated matches {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  21  3.....VTNCIVVDHDQVLLLQKPR------RGWWVAPGGKMEAGESILETVKREYWEETGITVKNPELKGIFSMVIFDSEWMLFTFKATEHEGEMLKSPEGKLEWKKKDEVLELPMAAGDKWIFKHVLHS 127
13 -40.300d4dywa_ d.113.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}  ali model 3D-neighbors follow..  21  7......CGAAIVRDGRILLIKR---KRAPEAGCWGLPGGKVDWLEPVERAVCREIEEELGIALERATLLCVVDHAANGEHWVAPVYLAHAFSGEPRVVEPDRLGWFALDDLPQ-PLTHATRIALEQVT.. 129
14 -38.500d4hvya_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  5..CYMVLAVFLSEQDEVLLIQEAKRECR---GSWYLPAGRMEPGETIVEALQRVVKEEAGLHCEPETLLSVEERGPSWVRF---VFLARPTGGILKTSESLQAAWYPRTSLPTPLRAHDILHLVELAAQY 131
15 -38.500d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}  ali model 3D-neighbors follow..  23  1.KPNVTVAAVIEQDDKYLLVEEIPRGT---AIKLNQPAGHLEPGESIIQACSREVLEETGHSFLPEVLTGIYHWTCASTTYLRFTFSGQVVSFDPDRKLDTGIAWFSIDEIRAKQAMHRTPLVMQCIED. 130
16 -36.800d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  21  15.....AGVVLLNERGDILLVQEKGIPHPEKAGLWHIPSGAVEDGENPQDAAVREACEETGLRVRPVKFLGAYLGRFPDGVLILRHWLAEPEPGQTLAPEIAEASFVSREDFAQLYAAGQIRMYQTKLF.. 143
17 -36.600d1vcda_ d.113.1.1 (A:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  26  5......AGGVVFNAKREVLLLRDRM------GFWVFPKGHPEPGESLEEAAVREVWEETGVRAEVLLPLYPTRYVNPKGVERVHWFLMRGEGAPRLEEGMTGAGWFSPEEARALLAFPEDLGLLEVALE. 122
18 -35.500d3shda_ d.113.1.0 (A:) automated matches {Escherichia coli [TaxId: 405955]}  ali model 3D-neighbors follow..  19  2FKPHVTVACVVHAEGKFLVVEETINGK----ALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAQICPTQPHDSDIDCCRWVSAEEILQASNLRSP.......... 121
19 -33.800d2i8ta_ d.113.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  18..LVSLDFIVENSRGEFLLGKRTNRPAQ---GYWFVPGGRVQKDETLEAAFERLTMAELGLRLPITAGQFYGVWQHFTTHYVVLGFRFRVAEEELLLPQHDDYRWLTPDALLASENVHANSR........ 146
20 -33.500d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  17  1...VVKAAGLVIGKIEFLLLQASYPP-----HHWTPPKGHVDPGEDEWQAAIRETKEEANITKEQLTIHEDCHETLFPKSVKYWLAKLNNPDDVQLSHEHQNWKWCELEDAIKIADYAEMGSLLRKFSA. 132
21 -33.300d5cfja_ d.113.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}  ali model 3D-neighbors follow..  17  18.....PVTTGDINKFEFLFLKASYAD-----KHWTPPKGLHENNESGLETAVRETLEETGINKDKYKLLNTLKYNVKDKPKETTYYLAMLLNNEENVIEHTDYKWIGSHESDTYNLPESLADLLKEAEE. 142
22 -32.600d5mp0d_ d.113.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1..GVPTYGAIILTLENVLLVQGYLAK-----SGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINARLYIIPGIPKDTKFNPKTREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNK 129
23 -32.100d4mpoa_ d.113.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 471472]}  ali model 3D-neighbors follow..  23  1TKHEYSFGVIPIRFFKACFICHTDG------KHWGFPKGHAEEKEGPQEAAERELVEETGLGVNFFPKIFVENYSFNDKE-EVTYFLAEVKGEVADPDEICDVQWLSFQEGLRLLNFPEIRNIVTEADK. 138
24 -31.300d4kg3a_ d.113.1.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  19  1..SIPVRGAAIFNESKILLVQGTESDS------WSFPRGKISKDENDIDCCIREVKEQIGFDLTDYIDDNQFIERNIQGK-NYKIFLISGVSEVFNFKEIDKIEWFDFKKISKTMYKSNIKYYLIN.... 124
25 -30.700d1jkna1 d.113.1.1 (A:6-165) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}  ali model 3D-neighbors follow..  17  12.....VGICLMNNDKKIFAASRLDIP-----DAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYD-FKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSV. 155
26 -28.300d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  12....KRAACLCFRSESLLVSSSRH------PDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLED-SVNIGRKREWFKIEDAIKV................ 121
27 -27.800d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  33.....TYIVVHDGMGKILVQRRTETKD-FLPGMLDATGGVVQADEQLLESARREAEEELGIAGVPFAEHGQFYFEDKNCRVWGALFSCVSHGPALQEDEVSEVCWLTPEEITAREFTPDSLKALALWMKR 160
28 -27.400d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  17  38...LTVDMVLLCDQLKVLLIQRKGHPFR---NSWALPGGFVNRNESTEDSVLRETKEETGVVISQENIEQLHSFSRPDRDVVTVSYLAFIGEEPLIADDAKEVHWFNLERHGQHITLSHEDVEITLDLKT 171
29 -26.600d5deqa1 d.113.1.6 (A:1-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}  ali model 3D-neighbors follow..  12  18.....IIFGFNEGEISLLLLKRNFEP---AMGEWSLMGGFVQKDESVDDAAKRVLAELTGLEMEQVGAFGAIDRDPGERVVSIAYYALININEYDREVQKHNAYWVNINELPALIFDHPEMKAREMMKQK 145
30 -26.300d3kvha_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  31.....QLFGRIPMRFSVLMQMR-------FDGLLGFPGGFVDRRFWSEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVH.......................... 123
31 -25.900d2o5fa_ d.113.1.2 (A:) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]}  ali model 3D-neighbors follow..  16  31.....VNAFLRNSQGQLWIPRRSPSKS-LFPNALDVSGGAVQSGETYEEAFRREAREELNVEIDALSWRPLASFSPFQTTLSSFMCVYELRSDIFNPNDISGGEWLTPEHLLA................. 141
32 -24.400d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  1.QIAPCIIVAIRRDDSILLAQHTRHR----NGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLL---PPPGTVARRLIED 122
33 -23.700d1hzta1 d.113.1.2 (A:31-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  5.....FSSWLFNAKGQLLVTRRALSKK-AWPGVWT--CGHPQLGESNEDAVIRRCRYELGVEITPPESIATDPSGIVENEVCPVFAARTTSALQINDDEVMDYQWCDLADVLH................. 119
34 -23.300d1vhza1 d.113.1.1 (A:2-185) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  49......VMIVPIVDDHLILIRE---AVGTESYELGFSKGLIDPGESVYEAANRELKEEVGFGANDLTFLKKLSMAPSYFSSKMNIVVAQDLYPESLEGDEPEPLPQVRWPLAHMMDLLEDPDFNEA.... 166
35 -23.300d5c7qa_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 264462]}  ali model 3D-neighbors follow..  14  46.....AMMIPLLPNGNVVMIHQ---RHAVKKVFLEFPAGKRDHNEETLLTAKRELLEETGYEAKDWKFLTTIHPVIGYSNEHIDLYLARDLTHLEQRLDQGEFIEVVEVKPADLMQLVLEGKVSDV.... 164
36 -21.600d3x0ia_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  18  22VEHKPAVAVIALREGRMLFVRQ---RPAVGLAPLEIPAGLIEPGEDPLEAARRELAEETGLSGDL-TYLFSYFVSPGFTDEKTHVFLAENLKEVEAHPDEDEAIEVVWMRPEEA................ 132
37 -21.200d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  14  41.....VAIVAMDDNGNIPMVYQ---RHTYGRRLWELPAGLLDAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDESVRVYLATGLREVGRPEAHHEEADMTMGWYP.................. 146
38 -21.200d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  18  30YRRAAVLVALTREADPRVLLTVRSSELPTHKGQIAFPGGSLDAGETPTQAALREAQEEVALDPAAVTLLGELDDVFTPVGFHVTPVL........................................... 116
39 -19.400d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  59......AAVLL-VRDEVVLIEQAAYDTSETPWLLEMVAGMIEEGESVEDVARREAIEEAGLIVKRTKPVLSFLASPGGTSERSSIMVGEVDAGLADENEDIRVHVVSREQAYQW................ 179
40 -15.100d3o69a_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  48.....TILLYNTKKKTVVLIRQTWVNGNESGQLIESCAGLLDNDE-PEVCIRKAAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAE......................................... 134
41 -12.900d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  150...............................GEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAYVDDPRNTDNAWMETEAVNYHDETGEEAGDDAGKVKWVDINDKLKL--YASHSQFIKLVAEK 276

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 8 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.