current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683425|ref|YP_213569.1| 30S ribosomal protein S14 (BF3990) [Bacteroides fragilis NCTC 9343] (Range: 1-99), from B.fragilis

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MAKESMKAREIKRAKLVAKYAEKRAALKQIVRTGDPAEAFEAAQKLQELPKNSNPIRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASWLast
1 -62.200d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  55  1.AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW 100
2 -39.600d1fjgn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  40  2......................................RKALIEKAKRTPKF--KVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 60
3 -8.400d4jp6a_ b.52.1.2 (A:) automated matches {Papaya (Carica papaya) [TaxId: 3649]}  ali model 3D-neighbors follow..  14  74...................................................AETTVRIVDQCSNGG--------LDLDWSVFKKLDTSGYLRGHLIVNY 115
4 -6.980d1y55x1 b.61.1.1 (X:3-121) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  26  1............................................................KCSLTGKWTNNLG----SIMTIRAVNSRGEFTGTYLTA. 34
5 -6.060d3brgc1 b.42.7.0 (C:205-359) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  2.............................................................CIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQW 39
6 -5.760d2hj2a3 d.130.1.1 (A:252-395) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}  ali model 3D-neighbors follow..  14  34........KDYTKVDRSAAYAARWVAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERPGVIVRDLDLKKPIYQRTAAYGHF-GRDSFPW 136
7 -5.550d1fp0a1 g.50.1.2 (A:19-79) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  7..........................................................ATICRVCQKP-GDLVMCNQCEFCFHLDCHLPALQDVPGEEW 46
8 -5.540d3awua1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}  ali model 3D-neighbors follow..  14  1......TVRKNQATLTADEKRRFVAAVLELKRSGRYDEFVRTHNEFIMSDTDSGERTGHRSPSFLPWHRRFLLDF---EQALQSVDSSVTLP------W 85
9 -5.410d2pg0a2 a.29.3.0 (A:236-385) automated matches {Geobacillus kaustophilus [TaxId: 235909]}  ali model 3D-neighbors follow..  10  53.........QFRLAEMATEIALGRTFVDRVIEEHMAGKQIVTEVSMAKWWITEMAKRVAAEAMQLHGGYGYMEEYEIARR-YRDIPVSAIYAGTNE... 138
10 -5.310d1qnxa1 d.111.1.1 (A:1-204) Insect allergen 5 (AG5) {Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId: 7454]}  ali model 3D-neighbors follow..  10  36.......LTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVANQCQYGHDTCRDVAKYQVGQNVALTGSTAAKYDDPVKLMW 133

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.