current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682225|ref|YP_212369.1| putative two component system response regulator (BF2753) [Bacteroides fragilis NCTC 9343] (Range: 1-225), from B.fragilis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKILIIEDEPSLRELIQRSLEKERYVVEAAADFQSGLRKIEDYDYDCVLLDIMLPDGNGLNLLEQLKKMRKRENVIIISAKDSLDDKVLGLELGADDYLPKPFHLAELNARIKSVIRRQRRDGEMDIRLANIRIVPDTFQVFVDDKEIELNRKEYDILLYFANRPGRLVNKNTLAESVWGDHIDQVDNFDFIYAQIKNLRKKLKDAGALAELKAVYGFGYKMTVELast
1 -85.700[TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain  ali follow..  25  4.HVLVVEDDLVTRSKLSGYFQNEGYQVTEAESGAQMREALELNDIDLVLLDINLPGEDGLLLTRELRSQS-EIGIILVTGRTDSIDKIVGLEMGADDYVTKPVDLRELQVRVKNLLWRTDKHDDKLVHFGEWTFDVQRRALSRNGEPVKLTKAEYELLVALSSYPNQVLSRERILNMISH--RVDAPNDRTIDVLIRRMRAKMEDPKNPQIFVTVHGEGYMFAGD 234
2 -41.000[TK] COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain  ali follow..  19  17.TLLLVDDDKPFLQRLARAMESRGFQVTTAESVEEGIAAVKTSAPAYAVVDMRLGDGNGLNIIEAIRSRRADTRAIVLTGYGNIATAVNAVKLGAIDYLSKPADADEVFAALTRRPGEKVAPPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQR............................................................. 179
3 -37.900[T] COG4566 Response regulator  ali follow..  17  26..VVVVDDDAAVREGLSELILSAGFQPVSFASTQELLNAVDILDPGCLILDVHMPGESGLDLQHHLAERGIGKPIIFLTGRGDIPMTVQAMKDGAVDFLTKPVSDRTLLDAVIAAIALDQTQRAEAIVVKRNV-----------ERLKTLTRREREVLREVVTR----RLNKQIAFDL---------SEVTVKLHRANVMRKMEVRSIGELIRVWETLP...... 222
4 -35.600[TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain  ali follow..  21  2YKILIADDHPLFREAIHNVIADG--EVMETADLDSALGLTQEHDDDLILLDLNMPGMHGLNGLMNLRNEAPTIPVVIVSAEQDKQVVLQAITYGAVGFITKSSPRAQMTEAIEQILNGNVYLPSDVIRKSSPRRSGHEEHGISPELLQALTRKQLLVLERMTKG----ESNKQIAYNL---------AETTVKAHVSAILRKLKVHNRVQAILSAGDIDF..... 215
5 -35.000[KT] COG4565 Response regulator of citrate/malate metabolism  ali follow..  22  5IDVLIVEDETSIADVHSFYLKQTA-PVGVAQSINEARNMVRILKPKLIFLDNYLPDGRGIEFLKELTHQPQAPDVIFITAASDMETVREAVRCGVFDYLLKPIAYDRVQNSLERYLKYISSLRAN.................................................................................................... 131
6 -33.700[T] COG3707 Response regulator with putative antiterminator output domain  ali follow..  17  15LTILVIDENAIRASIIEEGLREAGYQRTVIHEVNGVARTIETLQPDVIFIDLENPNRDMMEHLFQLTRT-VGRPIAMFVDRSDTASIEAAVEAGVSAYVVDGLKKERVKPILDMAVSRFNAFSRLQRELADAKSALEERKVIERAKGIGLSEEEFALLRQTAMNEKKKIS--EIAQSV............................................... 196
7 -31.100[KT] COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain  ali follow..  22  72.TILIVDDSPDNIAFMSQGLA-QYYRIKAARSGKVALEILAQYPIDLVLLDIVMPEMSGYEVINQIKHNPEHIPVIFLTGKSNPEDEQLGFELGAVDYVFKPVSIPLLKSRVHTHLQNKRSKDI-------LLNQNDYLETEVLRRSGELDRMQDAVVFALASHLLRTQHYVKVLAQRLATTDKYRDVLSPTVIDTYFKAAPLHDIGKVGIPDNILLKPGKLTPD 300
8 -30.900[T] COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases  ali follow..  11  12KRLAYVEPNSAAAQCTLDILSETPLEVVYS----PTFSALPPAHYDMMLLGIAVTFREPLTMQHERLAKATDFLMLALPC-HAQVNAEKLKQDGIGACLLKPLTPTRLLPALTEFCHHKQNTLLPV................................................................................................... 135
9 -30.700[T] COG3947 Response regulator containing CheY-like receiver and SARP domains  ali follow..  22  1.......................................MIQHKPDLIFLDINLPDINGIDFAEQVQSILPEVHIVFITAYDEYA--VKAFELNAIDYVMKPVQRDRLNRTINRITDRKTVEPLRSQTHFQKGSEIGKAEPIDVN-----TAKARELFAYLVQHRKQPVRKDVLLEFFWP-ESDVKKGYAQLYSAIYQIRKMLDSLQMNSTVVSFDK-SYKLHLN 190
10 -30.200[T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains  ali follow..  22  8.HLLLVDDDPGLLKLLGMRLTSEGYSVVTAESGQEGLRVLHREKVDLVISDLRMDEMDGMQLFTEIQKVQPGMPVIILTAHGSIPDAVAATQKGVFSFLTKPIDRDALYKAIDEALEQSAPATDDSWRNAIVTRSPLMLRLLEQARMV--AQSDVSVLINGQSGTGKEIFAQAI................................................... 178
11 -29.200[T] COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain  ali follow..  19  139FSVLVVDDARTARSGLVEILERQNFKVSEAHSGNRALEILSQDSIQLVITDYHMPDMDGYELTRRIRDSREDLRVIGISSSTDRLLSASFLKAGASDFVYRPFVPEELQCRIDNNIETLKQLKRELAERDHLTTRALMDVINDNDESGAVAILDIDALKKLAELLQGMCDERHIPARLGGEEFAVFLDARAAYAFCEELREQVEKNGSGSSLALTISLG...... 396
12 -29.000[T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain  ali follow..  19  2INVLIVDDEQIEREGLKLFLKDR--IVGEASNGRQAIEKALETQPDLMMMDIKMPGVDGVQAVKEIKQQLPETEFIMVSAFDTFEYAREVMRYGVKEYLLKPTTKEDVLTALDRIVGEIEQAREEKNDQYKLQQRLEQISSFVQTESI............................................................................. 151
13 -28.900[KT] COG3279 Response regulator of the LytR/AlgR family  ali follow..  20  2LRVIIVDDEQPAREDLRERLNEEH-IVAECSNALEAIPAIQRLQPDVVFLDIQMPRINGLELASMLNPESMPH-IVFVTAYDEYA--IRAFEEHAFDYLLKPLDHQRLAKTLTRLSRDLIVKNNLHKVIKPIPCSGHNRIFLLKIEEVEYLSSELSGVHVVGTVQSGYTQLS..................................................... 176
14 -23.200[T] COG0784 FOG: CheY-like receiver  ali follow..  20  6LRVLVVEDESMIAMLIEDTLCELGHEVATASRMQEALDIARKGQFDIAIIDVNLDGEPSYPVADILAERN--VPFIFATGYGSKG------RYSNIPLLTKPFLDSELEAVLVQISKEV.......................................................................................................... 120
15 -23.100[NT] COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain  ali follow..  23  4IRVLSVDDSALMRQIMTEIINSHS-MVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFLEKLMRLRP-MPVVMVSSGKGSEVTLRALELGAIDFVTKPQLSEMIAEKVRTAAR............................................................................................................ 132
16 -23.000[K] COG3710 DNA-binding winged-HTH domains  ali follow..  24  14.......................................................................................................................SHIGTKFILAEKFTFDPLSNTLIDSEEIIRLGSNESRILWLLAQRPNEVISRNDLHDFVWREQ-GFEVDDSSLTQAISTLRKMLKDSTSPQYVKTVPKRGYQLIAR 122
17 -15.000[KT] COG4650 Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain  ali follow..  11  44LELLHDARSRSLFETLKRDIASVSPETEVVSVEIELHNPWEVYACLHDFARGYEFQPEKEDYLIHITTGTHVAQICWFLLAEARYLPARLIQSSPPRKKEQPRGPGEVLSRYNAIASRFAEERQQTLDFLKSGIATRNPHFNRMIEQIEKVAIKSRAPILLNGPTGA--GKSFLARRILELK-RHQFSGAFVEVNCATLRGDTAMS................... 257
18 -14.400[T] COG2198 FOG: HPt domain  ali follow..  12  2........SNEVRAIVLRQLENWGATCITPDE------RQISQEYDLFLTD-NPSNLTA--------------SGLLLSDDESGVRKIGPGQLRVNFNMSNAMQEAVLQLIEEQLAQEEIPASPLGGDENAELHASGYYALFVDTVPDDVKRLYTEATAHRLKGVFAMLNLVPGKQLC--EHLIREKDAPGIEKYISDIDAYVKS.................... 188
19 -9.890[T] COG3629 DNA-binding transcriptional activator of the SARP family  ali follow..  18  10...........................................................................................................................................ELNLRGTKLPLTPKQRAVLAMLLLSRNQVVAADALVQAIWEKS-PPARARRTVHTYICNLRRTLSDAGDSRNILVSEPPGYRLLI. 95

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.