current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682385|ref|YP_212529.1| putative CTP pyrophosphohydrolase (BF2916) [Bacteroides fragilis NCTC 9343] (Range: 1-130), from B.fragilis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MKSIEVVAAVIRLGEKYLCVQRGQTKFSYTSFRYEFPGGKVEEGESLQEALQREIMEEMDYVIEVGEKLLTVHHTYPDFEITMHAFLCHPVGQRYVLKEHIAAQWLSTREMAILDWAEADKPIVRKISEQLast
1 -38.900[F] COG1051 ADP-ribose pyrophosphatase  ali follow..  19  19......VGLVILREGRLLLCRR---MKAPEAGYWSIPGGKVDHLETCLAAARREAEEETGLQIGAVEFLCHSEDPQDRHHWVSLIFVTRDTQGEPALTEPDKIGWFDPDKLPE-PLSAFAKDALAALNQG 143
2 -33.600[T] KOG0648 Predicted NUDIX hydrolase FGF-2 and related proteins  ali follow..  18  102.HVVGAGALVINKNTKEVLVVQERSGFFKDKNVWKLPTGVINEGEDIWTGVAREVEEETGIIADFVEVLAFRQSHKAILKKKTDMFFLCVLS-TEQKSEILQAKWMPIQEYVDQPWNKKNEMFKFMAN.. 233
3 -30.500[LR] COG4119 Predicted NTP pyrophosphohydrolase  ali follow..  13  1MPKLSAGVLLYRARAGLLAHPGGPFWAGKDDGAWSIPKGEYTGGEDPWLAARREFSEEIGLCVPDGPRIDFGSLKQSGGKARSSTFELDWPKGSGKMREVDRVSWFPVARARTK-LLKGQRGFLDRLMA. 150
4 -28.700[T] KOG2839 Diadenosine and diphosphoinositol polyphosphate phosphohydrolase  ali follow..  15  24.....LCFRSEQEDEVLLVSSSRY------PDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILED-SVNIGRKREWFKVEDAIKV--LQCHKPVHAEYLEK 142
5 -28.100[R] COG4112 Predicted phosphoesterase (MutT family)  ali follow..  19  63.....IPYVVIKREDEVFLYERLAGGESRLHNKLSLGGGHMNAAEVLKLNTDRELEEELQINEEDKQAIVTLGLINDDENILSALQLKPGAQVEVKEKEQIAGKWMKVSELKQDDIYNRLETWSQFVVDI 204
6 -27.600[J] KOG4548 Mitochondrial ribosomal protein L17  ali follow..  11  163............SRTLYLLVKDKSGT-------WKFPNFDLDESKPLHVHAENELKLLSGDQIYT-SATPIGVLQDERNRTAEFIVKSHILAGKFDLVAFEDFAWLTKGEISEYVPKDYFNKTEFLLADN 281
7 -23.500[LR] COG0494 NTP pyrophosphohydrolases including oxidative damage repair enzymes  ali follow..  19  54.....ALVVPITSEGQLVLVRQ---RFALAGRLLEFPAGTVEVGENPAETVKRELEEEAGYRGHTWQTIGQFPLAPGYSDEIIYAYLATDLEKLPNPPAQDEDEDIEVALMT.................. 158
8 -21.400[I] COG1443 Isopentenyldiphosphate isomerase  ali follow..  15  35.....FSSWLFNAKGQLLVTRRALSKK-AWPGVWT--CGHPQLGESNEDAVIRRCRYELGVEITPPESIATDPSGIVENEVCPVFAARTTSALQINDDEVMDYQWCDLADVLH................. 149
9 -21.100[L] KOG3041 Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family  ali follow..  14  80IGILTILKYKDGKPDEILLQKQ---RPPVEGVCIEMPAGLIDAGEDIDTAALRELKEETGYSGKIISKSPTVFNDPGFTNTNLCLVTVEVDMSLPENQKPVT-------QLEDNEFIECFSVELHKFPDE 200
10 -20.500[L] COG2816 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding  ali follow..  22  138.RIFPCIIVAVRKQQQILLAQHPRHR----NGMYTVIAGFVEVGETLEQCVAREVLEETGIVVTNIRYFGSQPWAFPSS--MMMAFLADYDTGELKPSELSDANWFGIENLPPV---APRGTIARALIEQ 259
11 -18.000[L] KOG3084 NADH pyrophosphatase I of the Nudix family of hydrolases  ali follow..  16  225TDPCVIMVILSHDMQHILLGRALR------KGLYACLAGFLEPGESLEEAVVRETYEESGVDVEKVLYYASQPWPFPQ-SLMLACFGIARKNAKIQRLELEDVRFFSREEVLRS-LFPPKLSIARNLIQA 363
12 -17.100[Q] KOG0142 Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase  ali follow..  15  54.....FSVVLFNTKNRILIQQRSDTKVTF-PGYFT--SSHPLYNPAERRAAQRRLQAELGIPGEQISP-AKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWE................. 181
13 -17.000[P] KOG4195 Transient receptor potential-related channel 7  ali follow..  17  120.....IVSRTNDNGDLEFVAVQRHDN-----GEWAIPGGMVDAGEHVSQTLRREFAEEAMHGIVDSENLDELWRNTDNAWMETVVFNFHDSKGLLAGDDAKALRWIAVNSNEPL--YASHSHFIDLLKES 257
14 -16.800[L] KOG3069 Peroxisomal NUDIX hydrolase  ali follow..  16  31AKSSAVLVCLYQEQRRVILTKRSTTLSSH-PGEVALPGGKRDQEDDDIATALREAREEIGLDPSLVTIISVLEPFVNKKGMSVAPVI........................................... 123
15 -16.100[F] KOG4313 Thiamine pyrophosphokinase  ali follow..  17  197.YAIHVNGYVERDGQKFLWIGKRSLAKSTYPGKLD--AGGLPHGISVCENLVKECEEEAGISKVLADRAIAVGVVSRDVLFCYDLELPQDFVPTNQDGEVDSFRLIPVAQVANV--DSCSLVIIDFLFRH 342
16 -15.300[S] KOG3904 Predicted hydrolase RP2 (NUDIX/MutT superfamily)  ali follow..  18  5LPKIRSSSSLILCDYNALLLTRTQ-KSTFMPESSVFPGGVCDASDSSPATAIRETFEELGILLCRDSKSLTRTPSTFKKRFETAFFMTALEQEPRVHIEPNEVAWRSPLDYKELWLPPPQFYELSRCLN. 248
17 -14.800[A] KOG2937 Decapping enzyme complex, predicted pyrophosphatase DCP2  ali follow..  14  94.TRIPVRGAIMLDMQQCVLVKGWKASSG-----WGFPKGKIDKDESDVDCAIREVYEETGFDCSRINPNEFIDMTIRGQNVRL--YIIPGISLDTRFEEISKIEWHNLMDLPTFK............... 208
18 -13.500[L] KOG2457 A/G-specific adenine DNA glycosylase  ali follow..  14  374.....HNLERNQSGGRFVLVKRP--EQGLLAGLWEFPSVILNEEADSKEAFRFHVELKKACTIVSREELGEFVHIFTHIRRKVYVELLVVQLTKGQAKDTLTWKCVSSDVLSTLGLTSAVRKVPPFRLQH 514
19 -12.700[R] COG4111 Uncharacterized conserved protein  ali follow..  18  21ADLIAVVVAVNDAGPCVLTIEQG----------AALPSGPFELAHSLQSGLRAWVELQTGQPIEQLYTFADRDRVGANQRVISISYLALTREEDAGASGRRS............................ 116
20 -12.000[L] COG1194 A/G-specific DNA glycosylase  ali follow..  239.....YWLIVRNRDGAILLEKRP--AKGIWGGLYCVPCFESLNGL-------SDFAAKFSLTMADMDEQTALTHRLTHRLLLITPFEAQMPSESP-----SDGIWIKPAHLKDYGLPKPLEIYLNGNRLE 349
21 -11.900[R] KOG4432 Uncharacterized NUDIX family hydrolase  ali follow..  22  28......GVVVIKAREKLIFVRQ-EQFPPEVGVTLELCGGAVDKDKSLAEIAKEEVLEECGYEVPTESHVYDYRSGIGTSSSAMSLFYCEVCDGGGIGEERIQVLEMSLEESRQL................ 169
22 -9.010[A] KOG1689 mRNA cleavage factor I subunit  ali follow..  29  80.....VEGVLIVHEHRVLLLQLGTT-------FFKLPGGELNPGEDEVEGLKRLMTEILG...................................................................... 130

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.