current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60683563|ref|YP_213707.1| putative SufE Fe/S-cluster-related protein (BF4142) [Bacteroides fragilis NCTC 9343] (Range: 1-142), from B.fragilis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MSINELQDEVVAEFSDFDDWMDRYQLLIDLGNEQEPLDEKYKTEQNLIEGCQSRVWLQADEVDGKIIFKAESDALIVKGIIALLIKVVSGHTPDEILNSELYFIDKIGLKDHLSPTRSNGLLSMVKQMRMYALAFKAKEAKGLast
1 -75.100[R] COG2166 SufE protein probably involved in Fe-S center assembly  ali follow..  34  1MAGLPDRDKLIRNFSRCLNWEEKYLYIIELGGQLAPLTEQQRHPENLISGCQSQVWIAMTLSEGHVIFAGDSDAAIVKGLVAVVFILYHDLTPQQIISLDVPFFADLALSQHLTPSRSQGLEAMIRAIRTKVANLSAH.... 140
2 -6.910[C] COG0822 NifU homolog involved in Fe-S cluster formation  ali follow..  16  37..................................................CGDVMRLQIKVNDEGIIEDAKFKTGSAIASSSLITEWVKGKSLDDALAIKNSEIAEE----ELPPVKIHCSILAEDAVKAAVADYRKRQEN. 127
3 -6.660[S] COG4891 Uncharacterized conserved protein  ali follow..  12  15...AEVIWEVVSDFEGWTHWNPLYRRAMKVGSTL-----VLEQHLPGQAPMVIQPVVQDWVPYEQLHWRSNRLGGFVTAIRYLEIEAMGPANATFSNGELFMGMLLRFVSRDERRRLKAAFTQMGEAVRDRAEAVWSERSSN 151
4 -5.390[C] KOG3361 Iron binding protein involved in Fe-S cluster formation  ali follow..  15  43................................SMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSVKFKTFG-CGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKE----SLPPVKLHCSMLAEDAIKAAIKDYKTKRNPS 153
5 -4.920[S] COG1627 Uncharacterized protein conserved in archaea  ali follow..  17  9.............SAVAEDIEEKIRRLRELGREQPPTPGPPKPPRRRVSRIGT---FRERERRKRIIIGALVLTIIIVGAVISIYTYMESKAARELENAKRAKIAEVN.................................. 106
6 -4.910[S] COG5658 Predicted integral membrane protein  ali follow..  119.........................FMFVVAAYIQ------YSKKLFKFLTMIG-FKKIDAWSRNLLRKITTVTLNIAGTICFILALFMRNDPSYLM............................................. 183
7 -4.870[R] KOG2981 Protein involved in autophagocytosis during starvation  ali follow..  15  1MVLSQKLHEAFKGTVERITGPRTISAFKEKGVLSV--SEFVLAGDNLVSKCPTWSWESGDASKRKPYLPSDKQFLITRNV.............................................................. 78
8 -4.360[C] COG1062 Zn-dependent alcohol dehydrogenases, class III  ali follow..  16  143........................EYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQ---PGDSVAVFGLGAIGLAVVQGARAGRIIAIDTDLARRFGATDCINPNDYDKPIKDVLLD.............. 251
9 -4.270[S] COG2975 Uncharacterized protein conserved in bacteria  ali follow..  17  7.DSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWL..................................................................................... 62
10 -4.180[L] COG3298 Predicted 3`-5` exonuclease related to the exonuclease domain of PolB  ali follow..  11  158..........LDLMDSLSHYGSVRGLNLNGVCSMTNIPGKFDVSGDLVHAIYYNPHLSQKEKKGIIDGYCQSDVLNTYWLFLKYEVLKGALNKEQYLGLLNDFLAKFP-------KEKSYSSVFINALEKEIREFA...... 276

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.