current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680681|ref|YP_210825.1| hypothetical protein (BF1156) [Bacteroides fragilis NCTC 9343] (Range: 1-221), from B.fragilis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# E-value Template Links and tools%idFirst MKPTIKKVQPVKVVAPFLNSQSESPVPLDALTDQEKVSDLYFLKGTVHQIAKPYLSINNCTFKQQIFSECQFKSAQLTDVRFENCDLSNVSFAGTTFYRVEFISCKLLGTGFLEATLNHVLMDHCYGQYINLSMVKMRTARFSHCNFRNGSLNDSKLMPAAFDTCELLEADFSHTSLKGIDLRNSRIAGIQLNIADLKGAIVSSLQAIDLLPLLGVKIEDDLast
1 5.000e-66UniRef50_B0PEW2 Pentapeptide repeat protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=B0PEW2_9FIRM  ali  13  36..SKANLSGANLFGANLSKANLSGANLFGANLSGANLFGANLSKANLSGANLSGADLSRTHLPGADLSKANLSGANLSGADLSRTHLPGADLSKANLSKANLSGANLFGANLSKANLSGANLFGANLSGANLFGANLSKANLSGANLSGADLSRTHLPGADLSKANLSKANLSGANLSG.......................................... 212
2 9.000e-66UniRef50_A0A1W9WT90 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium 4572_88 TaxID=1972444 RepID=A0A1W9WT90_9DELT  ali  13  205..SGANLSGAYLTEADLWGTDLSGANLSGANLSGANLTEADLSGANLSGAKLSGADLSGADLSGNDLTKADLWGADLSGADLSEANLSGANLTEANLTEAVLSGANLTEANLSGANLSRADLSRADLSRADLWGTDLSGANLIRANLSGADLIRANLSGANLSGAKLSEADLSRANLSGADLSGADLYAI............................... 392
3 9.000e-66UniRef50_A0A1P8JV54 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1P8JV54_9BURK  ali  19  38.....................LEQATAARRDLSGAYLSGANLSGANLSDANLSDAYLSGANLSGAYLSGANLSGANLSDANLSDAYLSGANLRGANLSGANLSGANLSDANLSDANLSDAYLSGANLSGANLSGANLRGAYLSGANLSGANLSDANLSDAYLSGANLRGANLSGANLSGANLSDANLSDAYLSGANLSGANLSGANLRGAANLSGANLSD. 240
4 3.000e-65UniRef50_A0A1L3I4V0 Putative low-complexity protein n=2 Tax=Phaeobacter porticola TaxID=1844006 RepID=A0A1L3I4V0_9RHOB  ali  16  777..PRNRLAGRLLSRLRLENVDLGAADLDGADLKEANLSGAVLAWARLSAADLRRADLSSADLSEAGLSAADLRGAKLSETELSGADLIGADLSGADLSRADLIGADLSKANLSKANLSKANLSGANLSKANLIGANLSGADLRGTKLSETELSRADLSGADLRRADLRRADLSGADLSGADLSEVDLSEAILKFTDLTGCTFTPVRSVDFTSSTGLNLD.. 995
5 4.000e-65UniRef50_A0A2S6G150 Uncharacterized protein YjbI with pentapeptide repeats n=3 Tax=Clostridium TaxID=1485 RepID=A0A2S6G150_9CLOT  ali  32  1MKSKKSEFSVEKPRLPLL---LEDMDLSYEDLDESYISSASITDFHLEGESIKRVNLKETIFKGSTFIGCSFSRSELVDVRFENCDLSNVNLENAIIHRVEFINCKLIGINLSEANLKNITFSECNLRYTLFSFSKFNEIKFNECDLALSDFQEATFSKVGFYDSKLSECQMSGTKLKDIDLTSCDIEGIAIRIEDLKGVIVSPIQAVSLSKLMDIIIK.. 217
6 1.000e-64UniRef50_A0A2X4W5W0 Quinolone resistance protein n=86 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2X4W5W0_BACLE  ali  29  1..........MKIEKPKIPEDLASANFQEIYYQEEYLMNCIIANCTIDREKMDKIEFSKVIFKNVTFNEVSFRNIELTDVIFDNCDLSNVDFMGGSIHKVEFKSSKILGINLSEASLVNVSFNQCNLNLSSFGFASLKQVMFADCSLQNADFYQCKFKKVQYQRSDLNDVNFSQTSLKGIDISSTSFQSLSVSLEDLNGCEVSTEQAIGFARMLGLKIKE. 211
7 2.000e-63UniRef50_UPI0009E93F36 pentapeptide repeat-containing protein n=1 Tax=Bacillus shacheensis TaxID=1649580 RepID=UPI0009E93F36  ali  27  11....IEKKKPKEPLSPKLPKELKEIEPA-PLEHEQVIKRGSIENVSFASEEAEHVIFNQLHFKNVQFEAVILPYSEWTDVVFEKCDLSNATFPHGIFHRVTFKECKLVGVDFHEAALRNVRFFGCQAPLASFSLTNCKHLRFEKCQLRGADFFESDFDNVQLPNSNIDQVQFSGTKLKDVDLSTCEFERLLVSIEDLQGCIISPEQAIPFVQALGLQVKN. 225
8 5.000e-63UniRef50_A0A1E3L116 Adenylate cyclase n=54 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1E3L116_9BACL  ali  30  2.........SIPIEAPKIPQQLEQLEPLYSLQAKDEFSRVQIQQLTIDRQEAQRVSFEKTIFEKVDIIESHLAEIELTDVIFDQCDLSNIPFPHSFVHRTEFRQCKLIGTDFAQSRLQNVRFIDCVADYSVFRFSNFKNVSFEHCSLIGADYCSSTFKSVMFDHCQLDTAMMSGTSLQEVDLSTCDFTSLQIEIEDLRGCIISPYQASSFVGLMGLVIK.. 212
9 1.000e-62UniRef50_UPI000B379B99 hypothetical protein n=1 Tax=Anaerotruncus colihominis TaxID=169435 RepID=UPI000B379B99  ali  18  40............VKADLTGANLTGADLTGAHLSKANLSKANLSGANLSAANLSGANLSGANLFAANLSGANLFGANLTGADLTGADLTGADLSWANLFEANLSEANLTGADLSKADLSE----------ANLSKANLYEADLSEADLSGADLSGAHLSWAKLPGAKLPGADLSGANLTGAHLSWANLSGAHLSWAKLPGADLSGANLTGAANLSGANLS.. 245
10 3.000e-62UniRef50_A0A1B2HV84 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1B2HV84_9PSEU  ali  14  18.PAGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGARLTGTRLTGTRLAGVRLAGARLVGTRL........................ 213
11 7.000e-62UniRef50_UPI000C074BB8 pentapeptide repeat-containing protein n=1 Tax=Butyricimonas sp. Marseille-P3923 TaxID=1987504 RepID=UPI000C074BB8  ali  48  6..KNGKEKGEVKIAPPMVQSARESGEMLGELLAEEEVCDRIFRKEIVEGANAGDLEINHCVFNGVTFSGCQFRGAQVSDVRFENCDLSNVSFFESSFYRVEFVACKLLGTNFGECSLNHVLLHHCNARYVNFSMGKMKQVLFAHSDMQSGSFERCSFSPANFDTCNLTEAEFSRATLRGMDFRSSQLAGIRLNPEDLRGVVVTSLQALDLSRLLGLVVKDE 224
12 7.000e-62UniRef50_UPI000D557D71 hypothetical protein n=1 Tax=Rhodobacteraceae bacterium Alg231-30 TaxID=1922229 RepID=UPI000D557D71  ali  13  289LLSGADLQGANLKGADLQGADLRGADLQGANLIGADLQGADLEDAKLQGADLKGADLQGADLEDAKLQGADLKGADVQGVDLRGADLQGANLVGADLQGVDLEDAKLQGANLWDAKLKGANLVDADLQGADLRGADLQGADLIGADLQGADLLYAELKRADLEDAKLQGANLMHAKFDDADLTEALFTAASVRVVDFTNV..................... 489
13 2.000e-61UniRef50_UPI0009E27FA4 pentapeptide repeat-containing protein n=1 Tax=Domibacillus robiginosus TaxID=1071054 RepID=UPI0009E27FA4  ali  26  11.......MKKVKIEQPKFSREMTEGSFEEIYGEEPELTGCMVANAQAEEAAIERAVFSKVIFQNGQFMNSLFERIDMVDVLFENCDLSNVRFPNGVIHRAVFKECKLVGTDFSETHMSHVTFQECAVRLSDFTDARLKHVSFKDASLKGANFYGTDFKHVLFEQCDLDDVQFKHMSLKGTDISTCRFDQLHVNLESLSGCIVSEEQAIGFAKLLGLTIK.. 222
14 6.000e-61UniRef50_UPI000DA621C6 pentapeptide repeat-containing protein n=1 Tax=Salipaludibacillus neizhouensis TaxID=885475 RepID=UPI000DA621C6  ali  27  1....MTQQKPVKIQKPKLPKVLENISLNEEMDSEQFFQGASVSDCTIDTEPTEKKFFEKMIFKNVTFEGMNLSSAEFTDIIFENCDLSNIDVSDAVFHRVEFKNSKLLGANLSGTSLRHMSFTECLINFATLNFASLKDVIFSESSLLQTDFFDSSLKNVEYNQCNIDEANFTETELKGVDMSTCTFDNVGVSLDKLAGCTVSSEQAVGFARALGLVIKE. 216
15 1.000e-60UniRef50_G0L5C7 Protein mcbG n=27 Tax=Bacteria TaxID=2 RepID=G0L5C7_ZOBGA  ali  26  1...............................MDKPFIADQTFKGSDLTKNKLPKGDYENCTFEGCDFSDAYLDNQNFMECEFIDCNLSNANIRHTTFKEVSFSHCKMMGLKFEDCNLIGFGFNDCTLNYSSFYGLTLTKQQFVDCKMIQTDFTEALLKNAIFDSCDLENAIFERTDLEKADFRTAINFNIDPEKNNIKKARFSKEGLIGLLNKYDLSIE.. 190
16 1.000e-60UniRef50_A0A1G5CBV2 Uncharacterized protein YjbI, contains pentapeptide repeats n=1 Tax=Paenibacillus polysaccharolyticus TaxID=582692 RepID=A0A1G5CB  ali  28  1..........MKIEKPKLTLQLLESEPTYTLDSKTEYKDKLFEHMTLDMLEVSKASFENVVFRHVTILESSLEHCEFTDVRFEHCDFSNVNLQNTFMYRTEWANCKLVGTDFSGSRWQNVSILQSICDYSNFRFTHLKQVEYLECSMIGADFAYLKLQKIAFGACRLDQVTFTGTPMKGLDLSDSEFDALFLTLEDLAGCAIAPHQAATFAGLMGLIIK.. 209
17 2.000e-60UniRef50_A0A1X0CVK8 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1X0CVK8_9MYCO  ali  12  27..SEADLRGANLSEADLYGADLRGADLREANLRGADLRGANLSEADLREANLREANLYGADLRGADLRGANLSEADLREANLRGADLRGANLSEADLREANLREANLYGADLRGADLRGANLSEADLREANLRGADLRGANLSEADLREANLREANLYGADLRGADL...................................................... 191
18 3.000e-60UniRef50_UPI0004B1BB05 pentapeptide repeat-containing protein n=4 Tax=Bacillaceae TaxID=186817 RepID=UPI0004B1BB05  ali  28  24...............................MERGYYDNCTFKDCVITREDMDRMVFDQVVFNRVTFEGTDFTDIQLTDCIFNHCDLSNADLSKGSIHRVEFKQSRMIGLTIAESTLENVLFDNCQMNLSAFGYSKLKQVRFSECQLKNSDFYECKIQKLDLQNCVIDEANFTNSKLTGVDLTTCRFDRLQVSLESLQGCIVSAEQALGFARILGLEIKE. 212
19 3.000e-60UniRef50_A0A2K2XK41 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=A0A2K2XK41_9FLAO  ali  25  1...............................MKEVYIVDSNFENTDFSQRGLEKGEYENCTFRHCNFEYINLSGFNFTDCEFIGCNLSMVKLMNTAFREVSFKECKMFGLQFHDCNRFGFRFEECLLNNSVFYQASIKKTVFKNSRLIEVDFTESDLSNAVMSGCDLSGAVFDNTSLEKTDLRTSFNYSIDPALNRLKKAKFSLSEVHGLLYKLDIEID.. 190
20 3.000e-60UniRef50_R8VXY7 Uncharacterized protein n=3 Tax=Butyricicoccus pullicaecorum TaxID=501571 RepID=R8VXY7_9CLOT  ali  24  1..........MRLAAPKLPRVLDEAVDWQACQRDGRVRGAYLKGLDLSDADLEEMTFDRCVLEQCRLTGANLERCSFTDVKLTGCELSGANCANSIWTRCTFADCRMLGANFYGAGLHDVCFGDCRMEDSDFCASRWKKTSLQGCRLMRARLSEAALQDFTAQDCDFDGVNFFRTPLSGIDFSRCTLEGIQAAGQELRGMIVSERQTAGLARLLGIVIRED 211
21 7.000e-60UniRef50_S2XIG0 Uncharacterized protein n=8 Tax=Bacillales TaxID=1385 RepID=S2XIG0_9BACL  ali  26  1..........MKIDKPKIPEQLEQATLIEV-EEERFISRGMVSSWNVAELPESKVSFDQVHFKDVSFEGVCFDQVEFIDCKFERCDLSNVDFGDSVFHRVEFHHSKLVGVQCTESRFGHTVINNCVANYTVFSFSKMKRVKFQQTALNKADFFNCTFDKVLFNDCQLDGANFTDTSLADVDLSTCTYEQVTVSVDKLSGCTVSTEQALGFAKSLGLIVK.. 212
22 8.000e-60UniRef50_A0A268SLK4 BTB/POZ domain-containing protein KCTD9 n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A268SLK4_9BACL  ali  26  1..........MKIDSPKIQEQSMTIETIQVLESKTEYRNQLIEHISLDYQEALKVSFENVIFRNVMISDSSLEQFEFTDVVFENCDFSNVNFSGAIMHRTAWTNCKFVGTDFSTSRMQNVQFAQSVGDYSNFRFANLKQVAFAECSLISADFAYLALQKMLLDHCNIDQAFMTGTKLKGLDLSNCEFDSLVVNMEDLNGCVISPYQAATFVGLMGIVIK.. 209
23 1.000e-59UniRef50_A0A0F9BHC6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9BHC6_9ZZZZ  ali  17  190...GANLEGADLRGADLALAKFHEANLQKTNLQNADLRGVYFHEADLRGAILQGANLEGVDLRGADLHEADLWGATLQGANLEGADLRGTDLRGANLKKANLKGVNLQKVNLQEANLSGAYFLNTNLQGADLKGADLHATDLQGVNLRRADLRGADLHEANLQNADLLGADFFRANLKGANLKGADLAVAKFQKADLQKADLQTADLLGAANLKEANLKD. 415
24 2.000e-59UniRef50_H3R8A6 Pentapeptide repeat protein n=6 Tax=Pantoea TaxID=53335 RepID=H3R8A6_PANSE  ali  23  5...............................ESNTEYYDACFTTCDLSERVLTQAHFEDCEFTHVNFTSARFSACKFINCVFTHCNLSLVDPSGTRFFGVHFNDCKLTGMDWTKAWWPDFHFSTCILTSGSFFGLRLHGVKMEGCKLIEVDFRECDLTGATLTECDMTGSLFHHTVLRGADLTESWHYAINIFNNTVEKARFSRLEAVCLLESLGIELVD. 199
25 2.000e-59UniRef50_D6U5G7 Pentapeptide repeat protein n=1 Tax=Ktedonobacter racemifer DSM 44963 TaxID=485913 RepID=D6U5G7_9CHLR  ali  28  24............IKAPLLPRRMEHALPTPYVEDHGHYSTFVLAREELSGQVASHVHFEQVLLKRVKLNESQFDLARLEDCRLEACEMASARWSQVSMDRVEFRSCLLTGFQANESRFQDVVFQGCTLNLAQFRFSKFRSVRFEECDLSDVDFQASDLAGAIFERCRLKHVQFSGTRLKGANLAGCEIEGVHIGPTELQGLVIDPVQAVALIQALGVVIE.. 231
26 3.000e-59UniRef50_W5X1X8 Uncharacterized protein n=1 Tax=Corynebacterium falsenii DSM 44353 TaxID=1451189 RepID=W5X1X8_9CORY  ali  18  63..SDANLRGANLHGADLRGASLHDANLRCASLSDADLSDANLRGANLHGANLSDASLRGANLRGANLHDANLRCASLSDADLSDADLRGANLHGANLSDASLHDADLRGASLSDADLSDANLRGANLHGANLSDADLRGANLHGANLSDASLHDADLRGASLSDADLSDANLRGANLHGANLSDARWGG--LEINRL........................ 260
27 3.000e-59UniRef50_A0A136Q042 Pentapeptide repeat protein n=1 Tax=Christensenella minuta TaxID=626937 RepID=A0A136Q042_9FIRM  ali  29  4....MKRLKPRTAGSPEARTDFEPLV-REAQEEETAVENKTFHGFAFEEKDFSQTVFKGCIFERCRFTRCNLKKTEFMDVIFRTCDFSGSLLEGGYLSRCEFHACKNVGGSLYRAFLQDVLFSGCNFGYANCNCSKWKNVSIADSSFSNADFGECSLKNLELSNVELVRVNFSHTPLAGIDFTASEIADILASAWELRGAVVSPAQAAELAKLLGVVV... 216
28 4.000e-59UniRef50_W4QLM0 Quinolone resistance protein n=3 Tax=Bacillaceae TaxID=186817 RepID=W4QLM0_9BACI  ali  24  3........KKVKIDQPKLHMSLRETTIHELDDDEHELIQAQIEGETIEDFSLSKAIMSKVFFKNITIHKANLPAVDLTDVVFENCNLANASLREGLIHRVVFKDCKLTGIDFSGAHIGHVTFEECIIDLSQFTEATLKQVHFEKSSLKGANFYGCQFKNINYAKSDLTDVDFIETSLKSVNLSTSTFEQLHVSFDALRGCTVSKEQAVGFAKLLGLEIVD. 215
29 6.000e-59UniRef50_G4HB13 Pentapeptide repeat protein n=7 Tax=Bacillales TaxID=1385 RepID=G4HB13_9BACL  ali  29  10...........KIIKPKLPRQLEPIRLSDAIDDEASFQQFSCKDETLSDITAHKVLFDRMTFDSVAFERASLRHAELTDIVFRQCDLSNVDFSEAILHRVEFHHCKLIGIDLAAATIRNVRFEQCAGDYATFRFANMKGVSFQSTTLIQSDFYHSELSKVEFAECQIDKTQFSGTKLAGIDLSRTDFHNLGVTLEDLQGCIISPAQAILFTRIFGLVVKE. 219
30 8.000e-59UniRef50_A0A1M6N653 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Dethiosulfatibacter TaxID=448125 RepID=A0A1M6N653_9FIRM  ali  30  26...........................NNDIEDEEQICGVLITDCIIENQCSEKVEFKQVRFRNVIFRDVIFQRSDFEDVIFENCDLSNIDLSDSILSKVEFINCKMVGINLAESSFIDISIKGCTGNYSNLRYSQWKRAHLEESQFRCSDFQNMKLKDINLVEVNFDESQMSGATLKGIDMSDCQIHGIGIRAEDLEGLIVSPLQAVDLSKFLGLVIK.. 217
31 1.000e-58UniRef50_A0A174N7Z3 Type III effector pipB2 n=5 Tax=Clostridiales TaxID=186802 RepID=A0A174N7Z3_9FIRM  ali  26  54............PDCECTGCALEGVSLDALELPEARFADTALRRCGLTGAHLEKGAFTRVRFEGVRFSGASLAKSFFTDVSFVRCDLSNADLHGCSMTRVLFEDCRLTGADFGEAALSDALFTGCACGYAQFSRAQLRDTRFERCDCAGAAFHELRWRALTFEVCSLMAAELFKTPLEGMDLTTCQIDGLIVDPPSLRGAVVTAVQACGLAKLLGLIIR.. 260
32 1.000e-58UniRef50_D3FSK0 Putative quinolone resistance protein n=3 Tax=Bacillus TaxID=55087 RepID=D3FSK0_BACPE  ali  26  1MSKQVK--KAPKIKKPDLPPRLEELKWDASLLEEERIENGLIKDQVIEGIKEERLSFKKLRFEGVTFESCSFRQIELVDVEFYKCDLSNIDLSDSIIHHVEWKDCKLLGMNVSGSTIRHTTFKGCQADYSAFGFANCKWVAFEHTLLNRADFYEAVFKHTSFAHCKMDQANLSGPSLQGVDLSTCSFDNLTVSIDQLEGCIISPEQAIGFAKILGLVIKE. 219
33 2.000e-58UniRef50_A0A024QG89 Serine/threonine-protein kinase B n=74 Tax=Terrabacteria group TaxID=1783272 RepID=A0A024QG89_9BACI  ali  28  1..........MKIDTPKIPEDVTERRFTDIYEEDPEFEMCMVTDSEFADETLERVRLYKTVIRNCNFTNTDFNRIDLTNVRFENCDLSNANLGNASMNRVEFLNCKLLGSNLTESYIGNTTFEGSILNMVMFGNSKLEKVIFDDAALESADLFDCNLKKVEFLSCSLNGASFEETPLKGIDISSSNFDSLTVSIENLKGCIVSTSQAIQFASLLGLKIR.. 210
34 2.000e-58UniRef50_UPI000994F31B pentapeptide repeat-containing protein n=1 Tax=Bacillus halmapalus TaxID=79882 RepID=UPI000994F31B  ali  29  2.......KSKVKILKPKLPRYLPSLEIINELEEEQYISNGLVSECTIDGEWEGKVYIEQVHFENVSMEGISFNQVELTDVVFENCNLSNVDFSEAVFHRVEMKNCKIIGGNFSGATLRNILFDSCMANYLALGLSNCKEVRFQKCSMLHADLYESTLKKVELQECDINEVNLTGVELQGMDLSSCAFEKLVISFDKLEGCIVSSEQAIGFARALGLVVNE. 214
35 2.000e-58UniRef50_R6C688 Pentapeptide repeat protein n=1 Tax=Clostridium sp. CAG:169 TaxID=1262778 RepID=R6C688_9CLOT  ali  28  4......KIQPTNLTEPLTAGNLLYDLVQMQQQDEEELHGGIYRNQLLEGFDGSGIEFKNCVFHGCQFSQCCLDNLSLTDVLLENCSFSACRLQDLAACRVTLRGCKLMGVGMAHSLLRDVSFLGCNLRYAAMGGSRLKAVLFDGCSLQESDCSEWRWKETAFSDCDLRKSQLLHTSLNGMDLRSCELDGFRLAPQDLKGAIVTPEQAMMLAGFLGVVIR.. 216
36 3.000e-58UniRef50_UPI000C9BC04C pentapeptide repeat-containing protein n=1 Tax=Paenibacillus castaneae TaxID=474957 RepID=UPI000C9BC04C  ali  26  15..KRMS-SKKIKIEAPKIPNHLEALDVPDYEWSDEYISDSIIKDCNIHNQSAYKPCFDRVFFQNVVFRGTSLRKAEFTDVRFENCDLSNIDLSEVILHRVAFVNCKLLGMDITGSTLRNVLFEQSYADYAVLRFSNVKAVAFVNSSLAKADMSNMTLSSFYLKETNIDQAQLSQTKLGGIDISSCEFNSLGVTLEDLRRCIISPAQAITMATIFGLVVNDE 233
37 3.000e-58UniRef50_K9WU06 Putative low-complexity protein n=7 Tax=Cyanobacteria TaxID=1117 RepID=K9WU06_9NOST  ali  15  824..SGADLTLANLSGADLSLANLSGANLSLTNLSGADLSLTNFSGADLSLTNLRGAYLSGADLRGANLRGANLRGANLSGVNLSDADLNSANLNSANFSGADLNSANLSGANLSRADLSGVNLSGADLNSANLSGADLSLADLRDANLSLANLSLANLSGADLSRADLSRAYFE................................................ 994
38 3.000e-58UniRef50_A0A2L2NI00 Pentapeptide repeat-containing protein n=1 Tax=Nostoc sp. `Peltigera membranacea cyanobiont` N6 TaxID=1261031 RepID=A0A2L2NI00_9N  ali  15  140ILKGAILKGAILRELDLSGVDLSEVDLRGVSLSGVDLSRVDLSRVNLIGLDLSRVNLSGLDLSMADLSGLDLSGLDLSKSILRGLDLSKSNLRGAILSGANLSKANLSKADLSKADLSRVDLRAANLSQAILSGADLRGANLSGAILSRADLGEADLSGA-----DLSGAILSGANLSRFDFSGINLSGLDLSGADLNEANLSRTQVLGTAKFTGACLED. 358
39 3.000e-58UniRef50_A0A0R1F9K5 Pentapeptide repeat-containing protein n=3 Tax=Lactobacillus coryniformis TaxID=1610 RepID=A0A0R1F9K5_9LACO  ali  26  4..........PKITAPRLAADLPLGTLDLSN--EAFIQNVRLENQHVSEQVFTGVYFKGVQFDHVTFDQINFERFELQDVIFTHCTFLNSEMIEASFKRVVFDDCKLTGSNFAGAVFNELSFTNCKADYLSLAGARLRHVQFTQTDLSELDFSEVNWQSLSFTDCQLTHANFLHTRLKALDFSHNETSGISYSLDLLRGMIISPQQALDLALALGVTINDE 212
40 4.000e-58UniRef50_A0A1C6J2P8 E3 ubiquitin-protein ligase SopA n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C6J2P8_9FIRM  ali  22  1.......MTTIRIKRMNLPTELETVDFKNSREEETDLTDLKVDGQEMEAGDLGQLTFENVFFNHCTFTGVSLYNCTFKNVYFEGCAFPSCNFSHSWLDQCKFSNCQMKGADFSESSISNTEFAECSLKYVNFTSSKLSKCEIRESDLSEAFFASCSLKQVILEKSQFINTEFFKTPLKGLDFSTCILEGISISGNELKGAIVNVYQAADLAKLLGVVIKD. 220
41 4.000e-58UniRef50_A0A061NWU4 Pentapeptide repeat family protein n=2 Tax=Geomicrobium TaxID=767528 RepID=A0A061NWU4_9BACL  ali  24  1.......MKKRTLQSPKIKEPLEETI---HLEREERYERIVVRKQTFEQQDLRDCRFEAAVFEQCFFLGASLQQTEWVDCEFYKCDLSNVDLTQVTMHRVKFFECKLSGAVCFDSFYQDVSFEDTQLPYSNFSHSSLKHVRFQSSLLNHADFVEVNFANVTFDDVSLNDVQFTNTSLKEIDLSTSRFDQLTVSAEELIGCTISEDQATAFVRAFGMKVK.. 209
42 5.000e-58UniRef50_D3E5E8 Pentapeptide repeat protein n=17 Tax=Bacillales TaxID=1385 RepID=D3E5E8_GEOS4  ali  30  10.......SAPIKIVKPKLPKQLEPVILSDAIDDESSFVQSACQDETLVYVTANKVQFDQMIFDNVTFQHVTLHHAELTDLVFNHCDLSNVDLSEAIMYRVQFNHCKILGLDLTAATIRNVVFDHCTGDYATFRFANMKQVSFQSTSLVKSDFYHSELSKVEFMDCQIDQSQFSGTKLAGIDLSRTDFHHIGATLEDLQGCIISPHQAIPLTKIFGLVVKE. 223
43 8.000e-58UniRef50_A0A2V2EYC4 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2V2EYC4_9FIRM  ali  31  1....MKTIQKPRISADIQPVQ----TIEKAMTEDDLIENVLIENEFISEVKPERIHINGSIFRSCDFMDCRFDHCDFCDCIFDNCDLSNLSFEKGAFHRCEFHKCRCTGSEFTSMLIQNTVFDHCKCTYANFSSSTLKNNLFINCDCGQASFVATQFKEVLFSDSKLDEAEFFNSSLAGIDVSTCSIQGIAVSMDTLKGLIVSEYQAIELAKLLGLIIKD. 212
44 8.000e-58UniRef50_A0A1Y0XHJ3 Uncharacterized protein n=14 Tax=Bacillus TaxID=55087 RepID=A0A1Y0XHJ3_BACAM  ali  25  4............IQKPKIPKELPVLSFTKA-LQDEQIKDVIIENEIISG-KLHSLRAEKVIFRNMVFTDVSFRHMECTDVLFEKCDLSNADFSGSIIHRTVFQHSKLLGLNLADSAMRNVRFEDCLANYSSFSYSNMKHVRFDTCALLESEWNDAALEHTELNACDLNGANFIGTSLFNMDISTCTFDHLHVSLDKLKGCRISPAQAVTFAEALGAIV... 207
45 1.000e-57UniRef50_UPI00087F46DA pentapeptide repeat-containing protein n=1 Tax=Pelagirhabdus alkalitolerans TaxID=1612202 RepID=UPI00087F46DA  ali  26  2.........SARIMKPNVSDESKSVKFSEIYDPEDYIEGVVIEDCTISKLEAKGIEFINVIFRNVRFEDVVLNLTYLRDVLFEKCDLSNAQFERLTMKRVLFDHCQMTGVMMADSRLSDVTFSNCNLQLAGFGYSKQKFVCYESCIVREAEFFENDWKKVYFEKCEMTGANLANTPLKGIDISRSTFNAMTVRIEDLKGCIVNEEQARAFSQLLGLVVKD. 213
46 1.000e-57UniRef50_W7DI04 Uncharacterized protein n=5 Tax=Listeriaceae TaxID=186820 RepID=W7DI04_9LIST  ali  26  2.........SKKIQTPKIPVHLETLD-SNWLSEEVYLREVLIEDREFNFDPMERIVLDQVILRNVNFVTLEFPNIELTDVIFEKCNLSNVIFNSAIIHRCQFIDCKLTGADFSDSLIHNTLFQDCVMTMSSLGFSKFKHVEWRDCSLLNTDFYESELKHSEIINCKLNEANFSNVLMESIDLSVNHFDGITVSLDKLRGCRVTSEQALSFARALGVVITED 212
47 3.000e-57UniRef50_A0A143WYW8 Pentapeptide repeats (8 copies) n=1 Tax=Clostridiales bacterium CHKCI006 TaxID=1780379 RepID=A0A143WYW8_9FIRM  ali  30  1..........MPITSPKLPKQLINRDFLTCLEEDESLEAIHYSNQALEYQNYRQLEIRAAIFDHIYFDHFELNNGYFLDVVLDSCNLSNAHLNNSLLRRVVFKDCKLVGVDFNECSFDQVRFENCLMTMASFAQFATKGLLFESCDLGNASFLEASLKKVSFQTCKLIQAEFLHASLMNVDLSNSEIDGITLTLDDLKGAIVRPSQALSLSRLLGLQIKDE 216
48 3.000e-57UniRef50_UPI0009F1A941 pentapeptide repeat-containing protein n=1 Tax=Romboutsia timonensis TaxID=1776391 RepID=UPI0009F1A941  ali  32  7.......IRKIKIQKPKMPISLNNCDDINEILDYEKLEEALIENTTIDGIENLSVSLNSCIFKNVVFEYCDFRRIDMTDIIFENCDLSNINFPYSSLYRVEFINCKLTGCNFNDSTLKSVVFKNCLGRYSNFAFSKFSGVSIENSDFSFAVFQEIKNETLLLDSNNLTKSVFTGTSLNNVDFTNSDIDGIEVRLKDVYGGTFSANQALDLSKLMGISIK.. 219
49 4.000e-57UniRef50_Q111D5 Pentapeptide repeat n=1 Tax=Trichodesmium erythraeum (strain IMS101) TaxID=203124 RepID=Q111D5_TRIEI  ali  15  53..TNSNLSKAKLNITKLNGAHLSGTNLNGADLNVANLVLVNLKRAQLIGAKLIRAELIRAQLSGANFSLADLSGASLVEATLRKTNLSGANLKGANLREANLEGADLSGADLSGSDLSGANLTGANLNGANLSGANLRWAVLTGAQMNCVNLSDAKLSGADLSRANLFQANLLNASLVHVNLSSACLIEVDWIGADLTGANLTGAKIFGTSRL-GIK.... 281
50 4.000e-57UniRef50_UPI00056897BD NACHT domain-containing protein n=1 Tax=[Leptolyngbya] sp. JSC-1 TaxID=1487953 RepID=UPI00056897BD  ali  10  837..SRTHLRGANLSRANLVGASLDGANLSSADLRGANLIGANLRGADLSSASLSGADLSSANLVGASLSRADLRDADLSGAYLRGASLQSADLSRAYLIGASLSGASLNAADLGHVDLSDANLHGADLSDVNLRHADLSGADLIGAYLNGASLCGASLCNASLNSADLIGADLCGADLSSANLIGAELSDLT.............................. 1025
51 4.000e-57UniRef50_D4W498 Uncharacterized protein n=4 Tax=Turicibacter TaxID=191303 RepID=D4W498_9FIRM  ali  33  3...........KIEKPKRTGKLNNLTFTECLAEDYYIHGMQFENEEISYLSIERLSLNQCHFKNVVFLECEFDHIDLTDTIFENCDLSNIKMPDGIIHRCIFQNCRLTGSDFSNCGIQQTLFKENSGRYINFSFSTFKKVNLLSNQFSHGSFNECQFNKVAFEENQLEIAEFIHTSLNGLDFSNCKIDGIVIPMENLKGLSVSPEQALQLATLLGLKIK.. 211
52 4.000e-57UniRef50_A0A174MZP2 Pentapeptide repeat-containing protein n=6 Tax=Clostridiaceae TaxID=31979 RepID=A0A174MZP2_9CLOT  ali  26  1.......MAGIKLAEPWLPEVYELVTLHQCREEDERIQNAYLKNMEAQEEDFSGLCFSRVKFENCSFEGCNFEKAEFSDVMFVSCNFSNCLFRDSFLRRVSFQRSKGTGARMTESSLKDVSIMECSMQYLNLDDSKLESFRVEDSDLENGNFAQCRCKGVTFSQVSLQNASFFKTPLKGMDFTTCDIKGLVLSDEEVRGAVMDLYQAAELAKRLGIVIK.. 219
53 5.000e-57UniRef50_UPI000997AE2E pentapeptide repeat-containing protein n=2 Tax=Bacillus TaxID=55087 RepID=UPI000997AE2E  ali  25  6...........KIEQPRIPMELEPIDIEGMYEEDPYLSNGMITNTKLDYEEVEKVVLSKLVFKNVSFTNATFKRIDATDIIFVNCDLSNANFSEGIIHKVQFKECKLTGIDFSETSFGNVTFEHCLANMSDFREARLKQVKFSNTTLHSANFADCLLTKIQLDQCDINDIDFTLTKLKGLDISTCTFDKINVALENLEGLQISPEQAIGFATMLGLEIKE. 215
54 5.000e-57UniRef50_A0A170ZKV3 Uncharacterized protein n=1 Tax=Paludibacter jiangxiensis TaxID=681398 RepID=A0A170ZKV3_9BACT  ali  32  4....................................YDDKEFTNKAFTQEELRNCEFDNCTFTNCDFSEAEYMAGTYIDCRFVGCNLSMVKMNNCQLNNVSFKGCKLMGTSFIDCTLLNVRFDDCMMDYSLLSGKKLVKTPFVNCSLRNSDFSECDLSKARFAECNLENAVFLHTNLKEADFQTAFNYIIDPDANILRKAKFSLQGVPGLLAKYGIIIE.. 188
55 5.000e-57UniRef50_W6S1S6 Pentapeptide repeat protein n=16 Tax=Clostridium TaxID=1485 RepID=W6S1S6_9CLOT  ali  33  3........KEVKIQKPKYINELESEDYYEDIFLSYKIKDKIVDNIEIGEKEDKGILIDSCIFRNTRFVNCNLKNIDLTDTRFENCDLSNIDFSNSSIQRVEFINCKLVGAKFDDSHLKDVVFDECIGKYSNFSFGELKKVEFNLCNFQEAVFQQVYIKNVYFIKTNLSNTYFNKTSLYNVDLTTCNIDGIDSEINDVAGVKVTALQALELSKLLRITI... 213
56 6.000e-57UniRef50_UPI0009BA0B5E pentapeptide repeat-containing protein n=2 Tax=Bacillus gottheilii TaxID=859144 RepID=UPI0009BA0B5E  ali  25  1....MKKIAS--IQPPKMPARLTE--FKKLEDDDDFFIHAIFSHTDFPFFNTDRLTFEQVIFQNVRFTDEELPQLNLTDAIFESCDLSNADLSNAVIHRAIFKDCKLTGVNFSDATLRNVVFENCHCNYISFGFADLKQTKFLHTDLRQGDFFEMKQSQLQFQQCDIEAVNFTGTELDGIDLTTSTFDELVITPELLKGCIITSTQAAAFVSAFGMLVK.. 212
57 7.000e-57UniRef50_F3MC98 Pentapeptide repeat protein n=11 Tax=Firmicutes TaxID=1239 RepID=F3MC98_9BACL  ali  30  12.........PIKIVKPKLPKQLEPVILSDAIDDESSFVQSACQDETLVYVTANKVQFDQMIFDNVTFQHVTLHHAELTDLVFNHCDLSNVDLSEAIMYRVQFNHCKILGLDLTAATIRNVVFDHCTGDYATFRFANMKQVSFQSTSLVKSDFYHSELSKVELLDCQIDQSQFSGTKLAGIDLSRTDFHHIGATLEDLQGCIISPHQAIPLTKIFGLVVKE. 223
58 7.000e-57UniRef50_UPI000C07A3AE hypothetical protein n=1 Tax=Bacillus sp. Marseille-P3800 TaxID=2014782 RepID=UPI000C07A3AE  ali  24  1..........MRIEAPKIPESLTERKLIEEHENEAVY--ISINEEDARDVIVERFVLSNARVSRTTFTGAQMPRADFTDVQFINCDFSNVDFSESIFHRVEFIDCKLIGSHFSNAHLTQTTFSNSMLNLSNFIDVRIKQVQFTKSSMKQMNVANGKIKGLYLNECDIDNISFFETPLMGVDISTCTYNRIEASQQVIAGLIVSRDQAVGFARLLGLRIKEE 212
59 7.000e-57UniRef50_A0A0B8R5G7 Uncharacterized protein n=3 Tax=Listeria monocytogenes TaxID=1639 RepID=A0A0B8R5G7_LISMN  ali  28  194...........KITAPRIPDEDLTVYPNDTYFIEDEVSEQIFRKTTLTGEIFEHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGVNFSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKAQFLNCALNGVDLSSCIFESITAMPQDLKGVSIDFSHAPALMPLFGIRVK.. 403
60 7.000e-57UniRef50_UPI000346F93C pentapeptide repeat-containing protein n=3 Tax=Nocardiopsis TaxID=2013 RepID=UPI000346F93C  ali  18  4.PSTDRSARPARPKAPTLPAELTEADLPEHDLDEGFYSALAFGGLDLTDRTADDAEFEGCTFTHTRLTGSALRRVLMQEADLKNADLAGVKVRDGSLMRATIRGSRLTGAVWSACVIRDVVFEGCRVDMASFGYSTLKDVVFRDCNLAEADFQEADIRGVRFEGCTLERARFHRTNAAKARFSDCDLTDIS-GVESLRGVSVKSTDAQGLANAMEIDIED. 226
61 8.000e-57UniRef50_F4BRV0 Uncharacterized protein n=10 Tax=Carnobacterium TaxID=2747 RepID=F4BRV0_CARS1  ali  24  4.........SIKIAQPRIPANLSASHFDEID-HESYYTNCQFKDCTLSSKQLENVCFQHVSFINVTFEHCQFTRFECLDVTFEGCNISNNEWIGAIFHRTTFKDTKFLGTNFAESSIVDAQFDHCIGNYSSFNYASMKQVRFQDCSLLESEFFEVTWKKLDFVRCQLNQLSIMQTNLNGLNFSDSEFENLSVSIDLVKGCKLNAGQALVIANMLGIQI... 211
62 9.000e-57UniRef50_UPI000852324F uncharacterized protein slr1819-like n=2 Tax=cellular organisms TaxID=131567 RepID=UPI000852324F  ali  13  25...GADLHGADLRYASLGRANLQKANLHGAELRYANLQDAELYGADLQDAGLYSANLHGANLHGANLQDADLRFADLQGADLHGANLHGANLCGADLQGANLHGANLHGADLYSANLQDADLQDANLRGANLCGANLQDANLHGANLHGADLCGADLQKANLQDADLQYANLQDAELYCADLQGADLHGANLHGAELR....................... 219
63 1.000e-56UniRef50_Q11S05 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=Q11S05_CYTH3  ali  21  11.....................................QQKTFTNVNYSGKVLRDREFISCTFIGCDFSKSDLRDNDFEGCHFNQCNFSMSIIEGTGFRDAAFTGCKIQGVDFTRCNMFSFTFKDSHIDYCTFFGTKLRKTNFLNCTLKETDFSEADLTSAVFENCDLSETRFLNTILEKTDFRTAQHFSIDPDSNKMKKAKFHAMNLAGLLSKHQLDIE.. 194
64 1.000e-56UniRef50_A0A1V5UG07 Pentapeptide repeats (8 copies) n=1 Tax=bacterium ADurb.Bin243 TaxID=1866936 RepID=A0A1V5UG07_9BACT  ali  30  20........SAVKIMQPDLSDGLNKLNITDIEFEGADIEGVEVTEGRPEPIDIKSCSLKKSVFKNILFIESDIKKLEVNNVRFEHCDFSNAVFTGAVIHRAEFVNCKMLGTNLVEAVLRNVTFKDCKCDYAFFSFANFKQVSFEGCDLSQSDFQRAVLAKFAFSKCNLSMAQCSGVSFRGLDIADCEIEGIIAGPDDLKGASVSAHQAVLLAQTFGLNVK.. 231
65 1.000e-56UniRef50_A0A1Y5KMR5 BTB/POZ domain-containing protein KCTD9 n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A1Y5KMR5_9BACL  ali  25  2.........KFKIEQPKILVELLETKSIRSLESKDEISNGVIENTTIESQDAIRVSMDKMIFRNVTITESSLEQIELTDIVFENCDFSNVNFSSSFMHRIEFRNCKLIGTSFSQSRFQNVRFLDCLGDFANFRFATFKQAGFEDCSLISADYYHSTFQKICFTRCNIDQAYMIGSKLMGVDLSDCTFDELSVELQDLDGCMISSHQASTFVGLMGMIIR.. 211
66 1.000e-56UniRef50_UPI000470EEE2 pentapeptide repeat-containing protein n=3 Tax=Sporosarcina TaxID=1569 RepID=UPI000470EEE2  ali  22  1.......MRKMVIQKPKLSAQREQLLAVQIPSDPGTLRGVEVENGDLRFTSGMQLATDDAVFTDCTFAEMDLSGASFVDTVFERCDFSNVEAGHADLLRCEFRNCKLTGANFDHSGVKHVRFEECDARYSSFSFSKLQAVQLEDSQFSESDFFECVLKDMKLFRSQLENANFRETDLAGVNLAGCTFERLEVTPSKIAACTVSKEQAIGFARMFGLLIHEE 214
67 1.000e-56UniRef50_A0A255IBR6 Uncharacterized protein n=3 Tax=Lachnospiraceae TaxID=186803 RepID=A0A255IBR6_9FIRM  ali  30  1..........MKVQKPKLLQELPEVLLQDARQNETEIEEMHIKGEYLVGEDITGVRFSNILFENVRLTDCIFQKCTFIDVLFKNCDLSNCDMSQSYFNRCEFVTDKALGAKFSKSIMKDVSIAESNFEYVNMTDVSIQVAELANSNFNNASLAECKLKNLMCDKVDFVNANFFHTPLKGLDFTKSTITGIVVSDTELKGVIIDLYQAAELARMLGVVIK.. 216
68 2.000e-56UniRef50_A0A1Y0HRN0 Pentapeptide repeat protein MfpA n=3 Tax=Sulfurospirillum TaxID=57665 RepID=A0A1Y0HRN0_9PROT  ali  26  8................................DKMDVFAENFTGVNLCKQKITKAEFDDCTFVSCDFSETFFSSCRFIGCRFENCNLSLMKLTDTKLNAVNFSSCKMIGIDWTMANWESLQFRDCLLGDSNFFGLTLNKVVMSECRITEADFRNAKLEKSDFRGSDLKGTLFGNTHLEYANFTDASNTTIDLRTNHLKGAIFSRFEALSLLELMGIVL... 199
69 2.000e-56UniRef50_UPI000B9B81B5 hypothetical protein n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9B81B5  ali  12  464..KEAQLQGANLIKAKLEDANLSRASLEGANLTHSNFQNATLERASLGGASLRRAVLESANLRQANLSGANLTHANLRAANLHGANLNDANLTRANLKGANLKNANLSGAKMHRASLRGLDLRGATLIDASLRRVDLVGANLAGVKLMDADLEGANLKGANLKNANLLGANLEKVNLEGAN........................................ 642
70 2.000e-56UniRef50_UPI0009E06639 hypothetical protein n=1 Tax=Desulfovibrio magneticus TaxID=184917 RepID=UPI0009E06639  ali  17  924..........................FTGVDFEGHDLRGRDFNKADLREANLRGANLEGVHLEGANLVQAILAQAKLCEAKLSGAHLSWTDLNDANFSQADLSDADLNDADLSDADLSDADLSGANLSGADLSSADLSNADLKGANLNNADLNGANLSNADLSGANLSNADLSYAELTGVDFSGVDLSGKNLSDSDLRDADLSGADLRS-ANLRGADLR.. 1144
71 2.000e-56UniRef50_G9RVG5 Uncharacterized protein n=4 Tax=Ruminococcaceae TaxID=541000 RepID=G9RVG5_9FIRM  ali  30  1..........MRIMEPVLPREMETAIPLEEALAMAAVYGYAFAGGSAAGHQLEKTEYKACIFTNCRFTGAALSGAWFQNAVFENCDLSGAKLLEATLQKVRLRGCKLSGANFAAAVLSDVTLEECVAEGAVFSEAVFKNVIFRKDNLRSAVFWDVKRRSVRFQDCCLVQAEFLHTSLNGQDLTTCDIEGAGFSGEELRGAKVTPVQACELAKLLGVIIE.. 216
72 2.000e-56UniRef50_K0J5X5 Uncharacterized protein n=1 Tax=Amphibacillus xylanus (strain ATCC 51415 / DSM 6626 / JCM 7361 / LMG 17667 / NBRC 15112 / Ep01) TaxID  ali  28  3...........EITKPSIDIDIEIENF-NQNFDPAYIRATHIKNCEIKNLDIDGIEFENTIFSHVTFKDVSFEKIFLRDVQFNSCDLSLANFNQTTMQRVEFNNCQLTGITMADGRLQNVLFNQCNLRLAGLGYTMKKYVHFIECLLNEVDFYHSKWSNIFFEKCELTGANLSNTKLKGINLSDSSFDYLTVRTADLYGCIVNPIQAQQLSALLGLIIK.. 211
73 2.000e-56UniRef50_UPI0002E13D1C pentapeptide repeat-containing protein n=1 Tax=Amphibacillus jilinensis TaxID=1216008 RepID=UPI0002E13D1C  ali  28  2....VKPLNKPNVTAEKVTNDFNTIYDRH----DPYIEAMIIENCTISVQDAEAIEFVNVRFRNVHFKEAKITKMYLRDVVFEKCDLSNAHFEEVTMHRVAFYHCQMTGVIMADGRFNHVALENCNLQFVGMGFCNQKYTSYNECILKQADLYENSLKYMTFDKCELTGVNFTNTSLAGIDLSRSYFDQITVGIANLKGCIVNEEQAKILSTLLGLIVK.. 212
74 2.000e-56UniRef50_Q92FN5 Lin0069 protein n=70 Tax=Listeriaceae TaxID=186820 RepID=Q92FN5_LISIN  ali  29  3...........KITAPRIPDGDLTVYPNDTYFIEDEVSEQIFRKTTLTGEIFEHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGVNFSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKAQFLNCALNGIDLSSCIFESITAMPQDLKGVSIDFSHAPALMPLFGIRVK.. 212
75 3.000e-56UniRef50_A0A088F288 Pentapeptide repeat-containing protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A088F288_9SPHI  ali  25  4..................................EYYEGEKLTSIDFKKNLFEQAEYDNCRFENCDFSASKLNNSIFTDCIFVDCNFSLAELSGTTFQQAIFRDCKLLGLQFQQCNTFGLSFENCNIDHASFYQLKIKKTTFKDCQMREVDFSESDLTGSSFYNCDLNQSIFDQTNLEQVDFRNAINITLSPNKNRLRKAKFSLLTLPGLLMEYDIKIE.. 190
76 3.000e-56UniRef50_G7W701 Putative low-complexity protein n=6 Tax=Desulfosporosinus TaxID=79206 RepID=G7W701_DESOD  ali  30  4......RKSSLEIISPNLPKELDMSIFDKCILSEDSFTRGIISNGLCKDQNADHVSFNKVLFKNVKFDNVSFKCLDLVDVRFENCDLSNVNFSESVIHKAEMINCKMVGMNMSDSALRNVLFDECDGSYALFRFLDCKQVNFNNCSLCSADFYKAKFSKVAFHNSNLQQTGMSGACLKGIDLSSCKIDGLGVAIDDLDGCIVSPEQVISFSKLLGLIIK.. 217
77 3.000e-56UniRef50_G9EN24 Uncharacterized protein n=24 Tax=Legionellaceae TaxID=444 RepID=G9EN24_9GAMM  ali  26  4...............................FAENNYINKTFSHLSFEDGRIEHLVFENCRFKQCTFTGVTFSKVRFTDCDFESCNLSLVQFPGCKFSEVVFKNTRLAGINWTEISWPQVSFYSCNISHSSFYSVDLADVIVEECKAHDVDFRESNLSHASFNGTDLLNSLFLHTNLKAADFTQAINYSLDPNTNTITHARFSFPEVMALLNYFNIKIE.. 197
78 3.000e-56UniRef50_A0A0A3IIF9 Uncharacterized protein n=1 Tax=Lysinibacillus odysseyi 34hs-1 = NBRC 100172 TaxID=1220589 RepID=A0A0A3IIF9_9BACI  ali  28  6....................EYEEVAFSDA-LKNEEIMDCIIRHEVVDEENLEKYSLSNVVFEHCVFQACDFAKFDLSDVVFKHCDLSNSRWEGGYFYRTNFVNCKLVGTSFAEGRFHDTSFTQCFANYAVFAEATFTQSKFSHCTMQGTDFYHMRHNGLPWESCDLNEASFEETALKGLDFSQSMFEVLHIDLKQVQGCKIAPAQAVLFAMMLGIEIRD. 204
79 4.000e-56UniRef50_A0A2A4SUD2 Uncharacterized protein n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4SUD2_9BACT  ali  23  12....................................YSEQNFQNLSYPQADMSNKEFTDCQFIQCDLSGGNFTGTTFIDCQFQDCNVSNIKVNDVSFQGVEFTGCKMMGIGFHSTFLTDWAFHDCRLELCNFSELKIKNTKFIDCSLKESNFIQSDLRESDFSGSDLQACQFQNTNCEKVNFVGATNYYIDHTQNNIKKAKFSQPEVLGLLAGFGIEI... 195
80 4.000e-56UniRef50_A0A177RDB2 Uncharacterized protein n=1 Tax=Acidobacteria bacterium SCGC AG-212-P17 TaxID=1803033 RepID=A0A177RDB2_9BACT  ali  27  5.PPRKKTKEPAARTAPDIPADIRQVVLTAEIIADPEIRECLIENAGFKDRSLNSAVFEACVLKQVSFTRCNLTGLRLKDVRLIECDFANANAIGMKAQRVEFVNCRLTGLRAVESECQDLLISTGDAGFIQFRFGTFKTSEFNGCNFAEADFHGCDLRGAVLKGCEFKNADMTGAKLEGTDFRGSRVEGLVVTATDVKGAIVDPAQAMIFAELLGLKIR.. 224
81 4.000e-56UniRef50_A0A0J5TQ00 Uncharacterized protein n=2 Tax=Bacillus TaxID=55087 RepID=A0A0J5TQ00_9BACI  ali  26  4.........SFKRQLPKIKQHLEVKSWSDCYEQDKYMDSCVIENEMIQVEEYDKVFFDQMIFKNVTFIGSFFQLLECVDVIFDHCDFSNARLNQAVFHRVEFRQCKMAGTQLAEAHFQHVLFVDTLAPYLECQFTSFKHVMLEKSVLKHANFFEAKLMKVEFQECQLDEASFYEVDLAGIDLSASYFERIAVTSGKLKGCIISPEQAIGFVKAFGMVVNE. 214
82 6.000e-56UniRef50_F4QJK8 Pentapeptide repeat 8 copies family protein n=5 Tax=Asticcacaulis TaxID=76890 RepID=F4QJK8_9CAUL  ali  23  10.......RGAVLLLANTQPQTLIGCELEELDLSDMILNGWVFDQCILKKSKFTSAKLEKAQFTACKGAQAVFTGAALSEAKFTGCDFNNVQFRGATLSQAKFQRCKLTGADFTQARTFDLTFEECKLNDARLRGISFARQTLKQLDLHNADLHQCDFRDAVFEDCSLRDSILDHARFEGADLRGTDIGGVRLDDARFKGATISRAQAAELLSELGLKVR.. 223
83 6.000e-56UniRef50_B4W5E6 Pentapeptide repeat protein n=6 Tax=Oscillatoriales TaxID=1150 RepID=B4W5E6_9CYAN  ali  18  194..................................EDIVRQEVKNRKLSDADLSDADLSGANLGGADLSDANLSDADLSGADLSGADLIFANLSGADLIRANLIRANLSGADLISANLSGADLISANLSGADLSGADLRDANLSSADLILANLSDANLSSADLSGADLILANLSDANLSSANWSGANLISADLSDADLREANLSGADLRE-ANLSGADLRE. 378
84 6.000e-56UniRef50_UPI00085BDC75 pentapeptide repeat-containing protein n=1 Tax=Massilioclostridium coli TaxID=1870991 RepID=UPI00085BDC75  ali  25  1..........MKWANPKLKQKLEHCLLEKQAEQEEKTMYQQFVLLEWAGKSLENADVTGCKFSNCRFTGANCAHSSFVDTVFINCDFSNVDFQDCYFQRCSFLQCRMVGADFSQSMIKMVLFQENNMDFVNFDHLQATGMRIEQTSMKSSHIIQNKWKQVELKQVDFTQANFLHTMLNGMDFRKCRIDGILVSGKELKGVIVDRFQASELARLLGIIILEE 215
85 7.000e-56UniRef50_A0A1D2P8T8 Uncharacterized protein n=11 Tax=Nostocales TaxID=1161 RepID=A0A1D2P8T8_9CYAN  ali  19  122....ANLSNAQLPGVDLDCVYLSGSNLSSANLSRASMCNGNLSGARLVDINLSNANLKNANLSSTNLINANLSNADLKDANLSNANLSNADLRDANLEKANLSNADLKDANLESANLSSVNLNNAKLLGANLSSAKLRHANLTSANFKDANLTDAKLQEANLSGTNLCGANLCSTNLRNANLSDANLENANLEGANLEGADLSRANLSG-ANLRSVKI... 344
86 8.000e-56UniRef50_H7FTV8 Uncharacterized protein n=116 Tax=Bacteroidetes TaxID=976 RepID=H7FTV8_FLAFP  ali  27  1...............................MEDLIHIQKTFEKIVFIDKRVNNREFEDCIFKNCDFSNSDFSNNTFMDCEFIDCNLSMTQLLGTSLKTVNFTNCKLMGIQFHSCTLFGVNFQDCVLDYSSFSNKKMPKTKFNNCSMKEVSFIGTILTQSVFDNCNLEGAIFNDTQLKEVNFLTAYNYKIDPEYNPMKKARFSSQGIPGLLDKYDIKI... 189
87 8.000e-56UniRef50_K9WNI0 Putative low-complexity protein n=1 Tax=Microcoleus sp. PCC 7113 TaxID=1173027 RepID=K9WNI0_9CYAN  ali  21  72.........................NFSQIDLAQENLVWMDLSGVNLSQANLQQAKLSAATLKGAKLREANLQGANLRAVDLKNADLCGANLQGADLKRADLINTNLSGADLSGANLTDVIFEKVNLREANLRGANLQGLDLSEADLTGADLSEANLNGARLQEAQLSQANLSGLNLSGANLRQANLSEAQLSQAQLYGTDLRGANLLDQAKLAGAKL... 273
88 8.000e-56UniRef50_UPI000DCE8A5F pentapeptide repeat-containing protein n=1 Tax=Paenibacillus sp. YN15 TaxID=1742774 RepID=UPI000DCE8A5F  ali  26  1....MAIKKKISPSAPALPSALDKADASPQPEDGQLVETTEFADMELGHWQTRKVRFDGVLFRNVSLSGAVLPNAEFLDVIFENCDLSNMDFQEGALHRVSFRHCKLLGTNFTDSVWRDVTVEECNLGYAALRFNDWRHVQIRQSSMAHADCYHSSWQHTQLETVKLEQAILSGTALLGIDLSSCDFLSLSAEPEDLKGCVIDASQAGLLAPLFGLVIKE. 218
89 8.000e-56UniRef50_A0A2N1ZZ12 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-9 TaxID=2013790 RepID=A0A2N1ZZ12_9FIRM  ali  32  9...............NLTNCDDIEALFSHACDEQEDIEFTLFENLTLEGGSYPGLTFRNCRFVGCKLSGCSLERAAFINCLLELSDLSNMQMQKGTLQRSRVADCKLLGIALSESFLLDAVFDRCVARYANLSGSKLRHTRFSDCDFTSGSISGCALSTTTFSRCLLTRAELFKTACSGMDFSDSELSGISISGTELRGAKVNLEQAAMLGQLLGVIVQDD 215
90 9.000e-56UniRef50_A0A259CQF7 Uncharacterized protein n=3 Tax=Campylobacterales TaxID=213849 RepID=A0A259CQF7_9HELI  ali  25  9................................DNMDVFAENFEGIDLHGQKISKSEFEDCTFISCDFSETFFFACKFVECRFVNCNMSVMKLTNTKMSDVDFLSCKMIGIDWTMGDWKSLRFTQCILNDSNFLGLTLERIVVTECRAKEVDFSNAILINGNFTGTDFKGALFANTHLEGADFTNAQNTSIDIRSNHLKGAIFSRYEALFLLETMGIVLVD. 202
91 1.000e-55UniRef50_A0A0Q9HK96 Uncharacterized protein n=1 Tax=Bosea sp. Root381 TaxID=1736524 RepID=A0A0Q9HK96_9BRAD  ali  20  9.SSPAEVSGEVLGRADLTRASLLECDLGQADLSGLDLSLWTFHRCNLAKVQLNGATLEETRWTSCSAPGADFRGADLREAAFSACDLNNANLSGARLGSASFSDCRMTGADLCQAQVLDASFKDSLLVCAKLAGLSFRDMRMEGLDLSEADLTGCDFRNAVMDRVRLRDAILKDARFKGADLRGAELGGIGLAHAELKGATISHEQASQILRQFGLCVR.. 234
92 1.000e-55UniRef50_K9WFG3 Putative low-complexity protein n=1 Tax=Microcoleus sp. PCC 7113 TaxID=1173027 RepID=K9WFG3_9CYAN  ali  14  38..SDANLSDTDLSDADLRDADLIGANLRGADLIVASLSAADLRDANLHDANLIGAKLGVANLRDADLSGANLSGAELSCTDLTCSNLNGAYISGANLIKAKLSRANLQGANLSVTNMIGADLSGANLQGANLGGANLIEADLGGANLQGAKLSRSNLAYVNLANSDLSNADLSDSNLAGTNLTNADLDNTNLEGTILS....................... 233
93 1.000e-55UniRef50_A0A251WA45 Uncharacterized protein n=1 Tax=Alkalinema sp. CACIAM 70d TaxID=1934309 RepID=A0A251WA45_9CYAN  ali  14  241..SAANLFRADLFRANFSAAFLNGVNLNEVDFRGANLSGADLSRADLSGADLSRADLSGAHLNGSRLRGADLSGADLSEARLNGAHLNGADLSGAHLNGADLNGAHLNGADLSGAHLRKTNLRGADLRKADLRKANLSGANLRGANLRGVNLRGADLSEANLCGADVSNALFINT--TGL----SSNDRADLER---RGAIF................... 431
94 1.000e-55UniRef50_A0A1F3C891 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3C891_9BACT  ali  26  5...................................YIEDKEFSGKTFAKNELIKGEYENCIFKNCYLSNSDLSEITFADCAFENCDLSLAKISQTAFKNVKFKSCKLLGLRFEDCNLFLLSFEKCFLNLSSFHKLNLKATKFIECSIKEVDFVQSDLTNSIFENCDLEGSVFENTILENSDFRTSYNFIIDPENNKIKKAKFSTSGLRGLLFKYNIQVE.. 190
95 1.000e-55UniRef50_A0A1I5IGB6 Uncharacterized protein YjbI, contains pentapeptide repeats n=1 Tax=Anaerocolumna aminovalerica TaxID=1527 RepID=A0A1I5IGB6_9FIRM  ali  24  1..........MKIKKPNISYELNIVEIYQAKMEEIDIVKKRIKDVFLTDEDLSHISFNEVIFENCKFINCSLEKSSFIDVIFKSCDLSNSNFKDGYFNRCEFISCKCIGVNLSNSSLQQSYIMDSNFHYANFDNLSLNYIFINESDMTSVNMTECKVKNFQTNATKFINTNFFNTKLKGIDFTQSDLEGIIVSSNELEGAIINHFQAAGLIVLLGVVVK.. 216
96 2.000e-55UniRef50_H6LB42 Uncharacterized protein n=5 Tax=Acetobacterium TaxID=33951 RepID=H6LB42_ACEWD  ali  31  28.......................NVLLDWARAEELDIEGKHFKDLNLTEIDFSQLSFRNSIFENCSFIHCNFEKIDFRDLRLQSCNLSNSDFTDGFFNRCEFVLGKLIGVDFHQALLQNILFTDTNLQYGNFSKATIKEIKIDECDLSHTTISECKLSKIVFDRVNLKTASFFKTPLKGLDFTTSQIDGISVSLEALNGAIVSSFQAAELAKLLGLIVR.. 223
97 2.000e-55UniRef50_E6XE70 Pentapeptide repeat protein n=6 Tax=Bacteroidetes TaxID=976 RepID=E6XE70_CELAD  ali  25  7......................................DTTFKGENYAITRLRKAEYENCIFENCNFSKANLSNSTFSECEFIDCDISNANLAETTLKETLFKDCKLLGVNFQYCNLLSFTFENCNLNFASFYQLKIKNTPFLRCKMHQVEFTKTDLSSAIFQECDLNAAIFSATILQKTDFTTAINFSIDPEANAIKNAKFSKDNLSGLLTKYSISI... 188
98 2.000e-55UniRef50_A0A2T5C0T1 Uncharacterized protein YjbI with pentapeptide repeats n=1 Tax=Mangrovibacterium marinum TaxID=1639118 RepID=A0A2T5C0T1_9BACT  ali  23  4.....................................YDEDFSNLTLTTAQLTDQTFDGCHFQSCTFENSRLDYTEFIDCRFSGCNFTMSKINQVSLKQVYFENCKLVGFDFSACVLFKVDFENCLLDYAIFSRKNMKQTSFKQCSIREADFFEVNLQKANFEASDLAGSQFENCNLQQADFRSAGNFIIDPERNKLKGARFATAGLSGLLQKYKLIIE.. 187
99 2.000e-55UniRef50_A0A0C2W4S4 Uncharacterized protein n=1 Tax=Jeotgalibacillus campisalis TaxID=220754 RepID=A0A0C2W4S4_9BACL  ali  26  2.......KKKSKIERPVVSAKIGQGRFNDIYEEELYLADVMIENEVIGPETLTNLELTRVVFKHVVFEEVVFDKADWTDVSFEHCDLSNSKITNASLHRVSFQECKLIGIEISESNWIHVSMNECIGNFSNIVESRLKLVKFSETLMNNASFYDNELLHVEMERCELEDASFIEMPMSGLDISTCSFEKINVAKEQLAGCTVAPHQAIEFSKLMGLIVTNE 216
100 2.000e-55UniRef50_A0A1Y4THM0 Uncharacterized protein n=1 Tax=Gemmiger sp. An120 TaxID=1965549 RepID=A0A1Y4THM0_9FIRM  ali  24  1.......MSGVRILAPVLPAALTDA----AAWPGGELAGARLHGASLAGEDLRECRLEGCRVESCRLLGCDLRGAVFRDCVFVNCDFSGSNLRDIWFLRCTLTGVRAEGADVSGARLEHVLLKDSRLEGVNLDGASLAGCVFADCRMAGAWLTGLRARDWKLERCDLTRASVVGTLLRDQDLSEGSIEGLVLSEAELRGAVVSPLQAVELARLLGVRVR.. 210
101 2.000e-55UniRef50_A0A0G9HCR2 Uncharacterized protein n=4 Tax=Xanthomonadales TaxID=135614 RepID=A0A0G9HCR2_9GAMM  ali  22  4................................EENEFYLKTFQGLDLAEGTIAGKTFEECTFTQCSFSDAEFDHCKFIECTFRSCDLSNVKLNASKFQSVAFDECKVIGVDWTRADWPRLAFRKSIVNYTSFFGLNLQELVLEECKARNVDFRQGDFSRSNFTYSDFAESLFGGTRLQGADFSEATHYVMDIRENQVKGARFTRTEAAGLLYGLGIELVD. 197
102 2.000e-55UniRef50_A0A143ZV62 Pentapeptide repeats (8 copies) n=2 Tax=Clostridiales TaxID=186802 RepID=A0A143ZV62_9FIRM  ali  31  4...............PKIPKQLQPMTMDEAVDEGESPKARIFEGETWCEEGPSFLEWDGCCFTGCRLAGSRVRQGRFFDVVFENCDLSNVDWREVDLLRVRFQNCKMVGGNLAELTAHHVEFIQCNLQYANLNDGAFQEVLFAESNLKQTGFCSCRLKKVRLTDCSLTESELLGTSLEGIDLRSCDIQGIRLAGPELKGAIVDMFQAAELARFLGLTV... 210
103 2.000e-55UniRef50_A0A2G2IKP0 Uncharacterized protein n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2IKP0_9PLAN  ali  22  17LRASITMNTHRRSLSEILANAQLTPLVASSITSDQTYESFVIQDADLKESRNPGICFEYGLFEKANLTACKWMSLEVIKVAFTSCTLSNANWGGAEIEDSEFHRSQLTGFNLAGARIVNTHFSRCKVDLSLFHDAQLKNCRFENCDLREADFQAAKLKQVTFRNCDLRGARFAAATLEDLDFRGSQIAGIHIEPTELSGTKVDAGQVVDFAELLGLVVE.. 235
104 2.000e-55UniRef50_E2YXX9 Pentapeptide repeat protein n=83 Tax=Bacteria TaxID=2 RepID=E2YXX9_ENTFL  ali  25  1..........MKITYPLPPNLPEQPLLTNCLEDEAILENHLYQQIDLSNQEVRNLVFRDAVFDHLSLANGQFASFDCSNVRFEGCDFSNVEWLSGSFHRVTFLRCNLTGTNFADSYLKDCLFEDCKADYASFRFANFNLVHFNQTRLVESEFFEVTWKKLLLEACDLTESNWLNTSLKGLDFSQNTFERLTFSPNYLSGLKVTPEQAIYLASALGLVI... 210
105 3.000e-55UniRef50_UPI000C84A8C9 pentapeptide repeat-containing protein n=2 Tax=Clostridiaceae TaxID=31979 RepID=UPI000C84A8C9  ali  26  22.........KMKIIKPRIAEGLENTDISQSKIDESDITYKHIKGVSFSGVDFSDICFKQVIFENCRLIQCSFDKSTFMDTVFKCCDLSNSNFSNGYFNRCEFIDIKGMGTNFIESSIFNVSIIDSNLKYSNFDSVNFDKIAISQSDLTESLITQCKLKSSSFNKVQFIGTNFFKTSLKGIDFTSSQLEGIVISSEELKGAVVNMYQAADLAKMLGVVVK.. 238
106 3.000e-55UniRef50_A0A1F4T859 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4T859_9BACT  ali  23  5............................GLLLTQIAFNNQTFEEVSLQETDLSHKEFSECAFNKCDFSGSNFSGTIFSDCTFTGCNLANIKVEGCGFRGVNFTGCKLIGVVFIKINLLDWGFQKCKIALCNFSGLSIKHSRFTDCVIQGTDFVNVDLSGATFSGCDLENSTFRNANLEKASFVGSWNYYVDPTQNKVKQAKFAYPEVLALLAPFGIKIE.. 197
107 3.000e-55UniRef50_E3PVD1 Uncharacterized protein n=12 Tax=Clostridiales TaxID=186802 RepID=E3PVD1_ACESD  ali  34  1....MNTKKDIKVAKPKL-MRFMEEINSEAIDIEDEYENISFSDCEIRTKTADKLKVDGVIFSKMDFKDIFLKSLELTDVRFENCDLSNADFSGAVIHRAEFINCKLMGLNLNEASLNHLTINQCNCKFILMNYVKMKNIIISDCIFESSYIQESKLDKVEFRNCNFKQSQLSGTSLSGVDLSDSEFEGAGFRAEDLKGAIVSATQAVDFSKIFGLKVK.. 217
108 3.000e-55UniRef50_A0A2G1WED3 Uncharacterized protein n=1 Tax=Rhodopirellula bahusiensis TaxID=2014065 RepID=A0A2G1WED3_9PLAN  ali  24  1....MNAKRRSLVDK-FSRARLVP-TLGDELQPDQSYHSVVLQDAELSQSRISDLVVEHSLFEKVNLSGGMWTAADFTEVLFNQCALSNLDCSAARLTNAEFLRARATGLNFSDARLRNVCFSACKIDLSIFQDAQLTHCRFEDCDLREADFQRATLKQVVFRDCDLRGIRLGGATLTDLDLRGAQIAGIQVDANELRGTKVDAHQIVDFAPLLGVVIE.. 213
109 3.000e-55UniRef50_H6RLV9 Uncharacterized protein n=9 Tax=Geodermatophilaceae TaxID=85030 RepID=H6RLV9_BLASD  ali  20  1....MRGARP-HVGAPEAGAVVEGEDLARVDWWGAELDGVTFTRCRFDDAGLEELVTRRCVFDRCVLTGIRMAGARHHGSAFLSC-----RFDRARLTDVTWDGCKLTGSQFPGAQLRPMTATECDWSYAALRGADLSGLDLSGQRFRDADLTDADLRECDLTGADLDRARLQGVKLRGTDLRGASTDEVNWHAFELTGVRLDLAQAVQFARAHGALVAD. 210
110 4.000e-55UniRef50_A0A0Q4R931 Uncharacterized protein n=11 Tax=Firmicutes TaxID=1239 RepID=A0A0Q4R931_9BACL  ali  25  2....SKKKKTMAIEAPILPIELP--VLEQTELSHAFFEMGIIQDCVWDGQQARKVIFDKIIFKNVTFTETALNEVELTDVIFDKCDLSNADFSDAIIHRTVFKNCKMIGMNLTGATLRNMIWKDNLADYSNFRMSDMKQVSFQDNSMGKSDFSFAKLQKLELFQCQIDQAQFSNTKLAGLDLSTCEFNGIAVAPEDLKDCVISREQAYVFVALFGLILKE. 216
111 4.000e-55UniRef50_A0A1I3MQY2 Uncharacterized protein YjbI, contains pentapeptide repeats n=5 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A1I3MQY2_9FIRM  ali  29  1....MEMSRLKKIQKPKINVNLEVINLLELIEEDEKICDKLIENIDIPTMDESRLSFDSCVFKNVNFDNCIFRYIDLLDVIFDKCDLSNIDFSEGSIFRTEFVNCKMLGCKIEDAHLKDCLFKNILGDYSSFAFSKLNKVSLEGSSFASSVFMEVKNKCLNFDDCDFKKTVFTRTYLEGVNLSNCEIDGIEIGIPELYKAKVNASQGLELVRLIGLIIE.. 219
112 4.000e-55UniRef50_A0A1B6BF35 Quinolone resistance protein n=1 Tax=Fusibacter sp. 3D3 TaxID=1048380 RepID=A0A1B6BF35_9FIRM  ali  26  2....TKKAKEIKINVPQIPKSLHAVSVDEIGFESEELIESIFEG-RLENQEKDCVYIRKSIFKDISFKGTRFHRLDLQDVIFENCDFSNVDFTDSIIHKTVFKGCKITGANFSNTTLMNVKLENCNGKYANFRFAQIKKSAFENSNLDLSDYQNAVFDEVWLEKTSFRESQCSGAKLNGLDFRTCDIEGLGARIEDLKGIVITAVQAVSIARILGVVIKD. 218
113 4.000e-55UniRef50_U2QL76 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=U2QL76_9FIRM  ali  25  9....IPEMNKMKIQLPKISNILDPYQNDPTIFYDHYIQDIKFEQTVIQNIENQNITIDACRFDHVSFQNIQFEQAELLDIVFDHCEFENTHFLKCSLYRVQFINCRCMGIEISDSLLDNTLFDSCNNAYSNYGMSTFKKVRYENTNLENSGFIQCTFKDIEFKNVQLDDSDFFNTNLNKVDFSTCQINNIGVSENMLKGIIINTQQAMTFLKLLGIVVK.. 223
114 5.000e-55UniRef50_A0A1C0UTP5 Uncharacterized protein n=1 Tax=Nostoc sp. MBR 210 TaxID=1881015 RepID=A0A1C0UTP5_9NOSO  ali  16  258.......................NLNLSNINLIQADLCGALLKEINLSRANFLGANLSNADLSGANCLGVNFSKADLSNANLSVANLFGATFEEARFSGANLTRADLCGANFTKAYLRGANLTEAKLTMAKLAEAFLTEVNFTKANLTLANISRADLIDANFSEADLTKAVLIGSLLWGANLTEANLTEANLTEANLTEANLSGANLTRT-NLTGANLEE. 453
115 5.000e-55UniRef50_A0A1I3JPW9 Pentapeptide repeat-containing protein n=1 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3JPW9_9FIRM  ali  27  23...........................RRCIEEERPVEEILLRDCAAEGESMPKLEIRRCILEGCTFSGCDLSGAGFADVAFTDCNFSNCRLPDAYFSRCRFFGCKWLGAELDGAVLRQITMENSNLRYASFDRAKLQELLLHNCDFTEASFSEVRWKNLSADGCRFLRTNFFKTPLSGMDFTQNELLAPILSPSELRGAKISLLQAADLIELFGVKVD.. 216
116 5.000e-55UniRef50_A0A291G908 Uncharacterized protein n=4 Tax=Rhodobacterales TaxID=204455 RepID=A0A291G908_9RHOB  ali  23  1.......MQVIDDIAALNGTDVLSCRFEGLNFDGMDMSDYRFELCEFQSCSFTGATLEEACFVKCKALQADFSYARLSEARFEGCNLSLSRWVGSDISDAIFRDCKLTGAEFRDARALGVDFNGSVLAGAYLRQMNFRKCQLEQIDLSEADLAGCDFREATFERCRMQAAHLATARFEGADLRQADLGPLSFSAACFKGAIISKAQATELLRGLGVTV... 212
117 5.000e-55UniRef50_A0A174N4D7 Type III effector pipB2 n=3 Tax=Bacteria TaxID=2 RepID=A0A174N4D7_9FIRM  ali  23  19....................................YLQKTFSKEEFPFENLSGAEFERCSFTECDFSYVNLSGALFTGCAFRLCRFVVPDLKRVHLQSAVFEECQLSGVDFGQCEAFSVDFRHSKLDNCSFRKRKMSGTPFSKSVLNDCFFTESDLTGASFDDCSLPGTVFDRCTLKGADFRSASEFAIDPAQNNLRKAKFSTYNLAGLLSGYGIVIE.. 203
118 5.000e-55UniRef50_A0A1Y3VJD4 Uncharacterized protein n=1 Tax=Alistipes sp. An66 TaxID=1965650 RepID=A0A1Y3VJD4_9BACT  ali  33  1..........MEIAAPQLPPEPVQPSDPALLFRSGEVDDAAFRAADFSGLCCEHLSIRSSRFSGCSLAGAQLSHVQCSDVLFRNCDLSNADFSGCSLHRVRFVDCRLSGANFAETTARHLTVERCKGEYLNLSFSRFRAARFAASRLNGASFSDCRFEQTEFTSCDLSQSEFFGTRLCGLSLADSEIHGLRVREIELKGLKISALQVVELARLLGVEIE.. 212
119 5.000e-55UniRef50_A0A209DJ98 Uncharacterized protein n=1 Tax=Saccharibacillus sp. O16 TaxID=1978120 RepID=A0A209DJ98_9BACL  ali  28  4...........KITPPKLREEQLMPEPELYLESRIEIQNAAVGPTELLELDYDKVSFDRVWFKQVTVLDSALRGAEFTDVVFEDCDLSNMNLTDAFLNRVAFKRCKLIGTDFGSSRMQHVRMSDCIGDYANFRLGKMKSVIFEDCSLLGSDLYAAEVQQFALDRCKIDGINLSEVKLKDVDLSRCEFDSLIVNPEDLAGCRIAPHQAAVFVGLLGLIME.. 211
120 6.000e-55UniRef50_UPI000B9B2F7D hypothetical protein n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9B2F7D  ali  16  184..SGANLSGANLSEANLSEANLSGVNLGEANLSEANLSGVNLSRVNLSGADLSRVNFSRVNFSQADLSQADLSQANLSGANLSEANLSEANLSEANLSGYNLRGANLRGANLSGASLFKADLSGANLRRVNLSGANLSRADLSGVDLRRANLSGANLSGVNLFEADLFEADLSGANLIGVDFEKSIVTNAKFSSNSL........................ 407
121 6.000e-55UniRef50_A0A100HJJ7 Uncharacterized protein n=7 Tax=Deinococcus TaxID=1298 RepID=A0A100HJJ7_9DEIO  ali  25  3........RPAAPTPPKFPRGGVRAPSSDQIEDEATLRGALFEGGDWPAAALHSVTFAGCVFRRVNLTGSTWERVRLLDVRFEDCDLSGARWTDVSLDRAEVTGSRLLGLQAAGVRLRHVRLTRVHAPLSVWQRADALHLHLSGCDLSEASFMEAKLPGTVLRDCRLHRTDLRGAQLDGADLRGSALGGVRAGAADLQGVTVEAAQVLDLAHLLGVTVAE. 215
122 7.000e-55UniRef50_H7F4K0 Quinolone resistance protein (Fragment) n=10 Tax=Listeria TaxID=1637 RepID=H7F4K0_9LIST  ali  30  8..........PKIIAPKIPSSLTPA--LEADFTDNYTKRTKFTG-TFPLRETEQLVIDQSYFENVFFEGNHYPKMDLTDVRFEKSNLSNLSLYSSTLHRVSFHDCKLTGVDLSDSLLHNVHFENCVLDLAGFSFTKFKAATFTNCELTGAEFESADFKQFSFQECQLTDCLFANTSLNGLDFTNCHFDKLTASIDSLKGLKVTEEQALKLATLLGIVIE.. 213
123 7.000e-55UniRef50_B1YIX6 Pentapeptide repeat protein n=18 Tax=Bacillales Family XII. Incertae Sedis TaxID=539742 RepID=B1YIX6_EXIS2  ali  28  1.......MKKQIIQLPELPQQLTSETFADVEIDDPYLYQTLYEKETLPVELTERLDVNQVCFRNVSFAGLVFERASFENVRFEQCDLTGCQFQDSRFHRVVFEDCRLTGIHFESNTIDHVTIKDCQANYAQVIRTALRHVTLEQTSMRESHFFEMKPIDFRLHEVDLSESQWVETALKGLDLRQADLSGITIDPRFLPGAIVTESQAITFARLLGLVI... 211
124 8.000e-55UniRef50_UPI000831C362 pentapeptide repeat-containing protein n=1 Tax=Christensenella timonensis TaxID=1816678 RepID=UPI000831C362  ali  27  1..........MKILKPLRGGELSESCLEEARLEERDIENKQISGVTFQEVDLSRLCFRNMVFENCKFIDCDFGKTELIDVRFSLCDFSNSNLENVYFNRCEMLSSKGVGMNCFRAFFKNFSAADCNFAYTNFSSAKLQSCCFSKSDFSNAEFGECVFKGLGFDACVFLRATFFKTPLKKIDMTTCDISGITVTADDLFGMVVTVAQAAELAKLMGLVV... 213
125 1.000e-54UniRef50_A0A0Q9LBH1 Uncharacterized protein n=7 Tax=Bacillales TaxID=1385 RepID=A0A0Q9LBH1_9BACL  ali  28  3.......SKIEKLEAPKIPEGLTALVVSDYEWADEEISDSIIQDGSIHNQSAYKACFDRVVFANVVFRGTSLRKAEFTDVRFENCDLSNIDLSESILHRVSFHNCKLLGMDITGSTLRNVLFEQCYADYVVLRFTNAKGVKFEKSSLAKADMSNMSLSNFYLNEVNIDQAQLSQTKLGGIDLSSCEFGSLGVALDDLRRCIISPAQAITFATIFGLVVND. 216
126 1.000e-54UniRef50_F9DTD0 Quinolone resistance protein n=26 Tax=Bacillales TaxID=1385 RepID=F9DTD0_9BACL  ali  29  25..........MKLNQPKVTEQLTPATFQDVWLEEDYLQNCVVLDSRFDGEMVERAQLTNMLVKNSSFQHASLPDLFITDVRFENCDFSNADLRGVSIHRASFHNCKMLGVNFADARFTDVLFEQCIGNLSAFVHAKWERVLFEQCQLKDADFFDCKLKQTKFSMCNLDSASFDETSLKGVELRSSEFESMTVSMKDLEGCIVSVRQAVQFAAMMGLDIRDE 236
127 1.000e-54UniRef50_A0A2T5V8D9 Uncharacterized protein YjbI with pentapeptide repeats (Fragment) n=3 Tax=Mycobacterium sp. YR782 TaxID=2135747 RepID=A0A2T5V8D9_  ali  12  49..TGANLTGANLTGQNLQGYNLTGTNLSDAILTGVNLTNANLTNANLSGQNLQALALAGATLVGANLTGANLTGQDLQGLNLTGVNFTNANLTGVNLTGATLTNATLTGANLANANLTGQNLQGYNLTGVNLTGANLTGVTLTGANLTGANLTGANLQGYNLTGVNLTGATLTGVTLTRANLTNANLHGFNLTQTNLTGANLSGANLSGVAYLQNANLTN. 275
128 1.000e-54UniRef50_A0A1Z4JWA8 Pentapeptide repeat-containing protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4JWA8_9CYAN  ali  14  89...RADLNQAQLREASLIRAELIRANLSGADLSAANLTSADLREATLRQANFRKANLSGAILRGSSLIAANLEMANLHSADLVHTDLSGANLRDAELRKANLSRANLSGADLSGANLRWADLSGANLRWADLSGAKLSGAKLISTDLSNANLTNASLVHADLTQAKLIKAEWNGADLTSAILTGAKLY................................. 273
129 1.000e-54UniRef50_UPI000D6C46E2 pentapeptide repeat-containing protein n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6C46E2  ali  25  4....................................FDEETFKGKKFSSEELRGAEFEYCTFINCDFSDQFATSAKFVECTFEQCNLSNLNVSEATLNDVSFLESKLVGVKFSECNFLSLSFTSSNLDYCVFSHLKLQKTYFQNCHIHQASFMDCELMESDFSKTELDGTLFENCNLSKANFRTASNFTIDPDINNLKKTKFSSAGLVGLLSKYDLDIR.. 188
130 1.000e-54UniRef50_UPI0006D09F1D pentapeptide repeat-containing protein n=1 Tax=Bacillus sp. JCM 19041 TaxID=1460637 RepID=UPI0006D09F1D  ali  24  22..............................NLEDPVIVAALLENGTYEEVAIKNLEVNNSRVNKVIMPQAKLKKAEFIDVTFNYCDFSNADLSGAYMNRVIFKDCKMMGAKLTDMNIKDVVFENCQLAMGLFGESKFSHCAFRNSKLTSSDFYQVQFKNIELTECDIDGANFEGTSLKQIDLSTCLFSSINVDLHRLKGCTINEYQAAYFTRLLGLNVK.. 210
131 1.000e-54UniRef50_UPI000A1A09C0 pentapeptide repeat-containing protein n=2 Tax=Burkholderia pseudomallei TaxID=28450 RepID=UPI000A1A09C0  ali  20  10..................................ADYYQKEFSGLKFPNVFLSSKVFEECEFSGCSFSGARFHGCKFVECTFRCSDLSNINVERSRFREVIFEECKIIGVDWSKAEWSRIIFKKSVVNDSSFFGLRLPELTMEECKVHAVDFRGGDFSESNFSYSDFAESMFGKTNLSGADFREAVNYGIDIRDNMLKGAKFTRYEAVRLLEGFGFELFD. 201
132 1.000e-54UniRef50_A0A1H1L4Q1 Uncharacterized protein YjbI, contains pentapeptide repeats n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1H1L4Q1_9ACTN  ali  23  20.................LPKNLTPAVLPDHDLDEGHLRRLVYTDLDLAERDVTSCDVEECLFEGVELRGGVLTKSTFADCRFERCDLANLVTTNSSLIRCELRGLRTTGLHWTDGTIRDVVFDQCRLDLSAFRFCTLTAVRFVGCRLTQVDFTNADLRNARFDDCDLSGAQFAQADLTGARLRNCVLAGVR-GVANLRGAVIDPDDLVALAGALGIVI... 224
133 1.000e-54UniRef50_F0R9L8 Pentapeptide repeat protein n=27 Tax=root TaxID=1 RepID=F0R9L8_CELLC  ali  25  2.................................NALILDKTFTKENFTINRLPTAEYDNCIFKECMFTEAFLSDVNFVECTFIGCDFTNAKTKNTSFNNTTFNNCKLLGVLFNSCNLLSFTFTDCNLQLASFYTLAIKKTMFKNCNLEQVDFSMANLTQSSFDRCNLKNAIFDDSNLEKADFRTAYNYTIDPDNNNLKGAKFSKNGLAGLLTKYKISI... 188
134 2.000e-54UniRef50_UPI000376481D pentapeptide repeat-containing protein n=1 Tax=Echinicola pacifica TaxID=346377 RepID=UPI000376481D  ali  23  1...............................MNSTYFEDQSF-DQNLCAIPFPIGDYDGCTFTKCNLSNEDLRNCKFIDCSFTDCDLSNAQIQYASFQGVTFKNCKLFGMHFHKCDLITLSFEDCQLDYSSFFKLKMQKTPFLNCRLRQVDFSNANLMGSDFSKSDCTDTVFDQTNLIQCNFQSAENFSISPDKNQIKKAKFSQHNLVGLLHGFGIVIR.. 189
135 2.000e-54UniRef50_UPI000C79DE4C pentapeptide repeat-containing protein n=1 Tax=Marasmitruncus massiliensis TaxID=1944642 RepID=UPI000C79DE4C  ali  27  23VKSMASQENKMKILKPNIVKELEPVEIRASQMDETDIAAKLIKDVSFENADLSKLCFKEVAFENCRFITCSFSKTDFIDVTMRSCDFSNSDMDEGYFNRCELVSCKGVGVNLQYASLQNLTVSDCNFQYANTDSAKIKNVSVVNSDISHASVTECKLSNLELDGVKLISTNFFKTLLKDIDFTKSRIEGILVSGEELKGAIVNSVQASELAKLLGLIIK.. 246
136 2.000e-54UniRef50_E2SGJ5 Pentapeptide repeat protein n=12 Tax=Firmicutes TaxID=1239 RepID=E2SGJ5_9FIRM  ali  28  4............VQPRLRPSYDTAQSLQECIDMDHYVEGMEFDGISIQNEEHTALHLDGCIFRNVFFEDCEFDAIDMIDTIFENCDLSNLHFTKGAIHRCVFRNCRCMGIDFSDCVIHNTLFTNLKAAYANMSGSRFRQVIFDNSNFSNASFIQCEYQKTVYDHCDLKESEFHNTNLKGMDLSSSDIEGISLTMDHIRGVIVNEQQALRLVQLLGIIVKE. 211
137 2.000e-54UniRef50_A0A2G5WLQ7 Quinolone resistance protein n=1 Tax=Sporosarcina sp. P13 TaxID=2048263 RepID=A0A2G5WLQ7_9BACL  ali  27  1..........MKLNQPKVSEQLTLATLQELNQEDPILQNCKIVDSRIDGETVERVHLTNTFIKNSSFQHASLPGLFITDVRFENCDFSNSDLTGVSIHRASFHNCKMLGVNFTDARFTDVLFDQCIGNLSAFVHNKWERLQFHGCQLKDADFYDCKMKQTRFVECTLDQASFDETPLKNVEIKTSEFDSLTVSIKDLDGCIVSTRQAIQFASMIGLDIRDE 212
138 2.000e-54UniRef50_UPI000C83CC62 pentapeptide repeat-containing protein n=2 Tax=Raoultibacter TaxID=1926677 RepID=UPI000C83CC62  ali  26  61............PDAPRISANLSSVDLIEATIDERPVYSLVVEGQTCEGVDLSRLELFSSHLLRCAFLASDLSNATFEDVAFEQCDFSNADISSAYFLRCSFSSCRFVGADFSETVFKHATVTDSTFQYASFTRGGFDACSFEGCDFSQASIAEAELKRVEFSQSRLTNVDFFKTSLRGVDLSDNDIAGFLVSDTELSGCIMDPYQAASVARKLGIVVKE. 275
139 2.000e-54UniRef50_A0A285E9F3 Uncharacterized protein YjbI, contains pentapeptide repeats n=3 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A285E9F3_9ACTN  ali  18  28.........RPHVRPPEAGAEVEGQDLARVDWWGAELDGVTFTRCRFDDAGLEELVTRRCVFESCVLTGVRMGGSRHLGSAFLSC-----RFDRARLFDVTWDGCKLTGSQFPGAQVRPMTSTESDWSWTNLRGADLSGLDLSGHRFREADLTDADLRECDLTGADLDRARLQGVKLRGTDLRGASTDGVNWLAFELTGVRLDLVQAVQFARAHGALVSD. 233
140 2.000e-54UniRef50_A0A2A5AL41 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AL41_9BACT  ali  21  7....................................IEDQDFNHVDFTINLLNGREYENCTFNHCNFSELNLSNIDFIDCNFDNCNLSNIKINDIVFREILFTECKMIGVDFSNIKVLSIEFNNCCLNFCTFEGLSLKSTNFKSCSLNETDFTNCDLSSSDFEKSDLYRAIFYNTILIQADFSSATNYIIDPEFNRLKKAKFSLDGLVGLLDKYEIEV... 190
141 2.000e-54UniRef50_A0A1M3E0D4 Uncharacterized protein n=1 Tax=Chryseobacterium sp. 39-10 TaxID=1895745 RepID=A0A1M3E0D4_9FLAO  ali  23  5....................................FQDEVFDGVSF----LAQAEYENCSFRNLRFSEFDFTEYQFYNCTFLNCDFSLSKWNNTALRKVLFSDCKLIGSNFENLNPFGLDFVSSLLDHAVFYKLDIPKTVFRNCRLVEVDFTEANLHHSDFEDSDLSGAIFDNTNLEKADFVTARHFHVNPHRNKIKGAKFSADGLIGLLQSYGIVV... 184
142 2.000e-54UniRef50_E4MBM9 Pentapeptide repeat protein n=16 Tax=Alistipes TaxID=239759 RepID=E4MBM9_9BACT  ali  33  1..........MEITRPVPSPNPVEQTDAALLQTAEEVSDAVFRSVPLPPLMREHFWVQSSVFAGCIFPAPVLQGSHFTDVTFRNCDLSNADLSGCSFQRVEFVECKLVGANLSEGTWQHVVFERCKMEFANFTLGKFRGVRFAGGTMRSVGFDECRFERVEFSLCDLTMAEFSRTRLKGLSFVDSDIRGIRVGDTELKGLKVSALQASELARLLGLEIE.. 212
143 2.000e-54UniRef50_UPI000685F833 pentapeptide repeat-containing protein n=1 Tax=Actinopolymorpha alba TaxID=533267 RepID=UPI000685F833  ali  22  3...SVQQRTPRPPVKPRIRGTLAPAVLPEHDEDEAQLQRLTFTRVDMSERDATSVDVEECEFTGTDLNGSTLAKAIFADCRFESSDLANVSASTSSLLRCSLRGLRATGLRWIDGTLRDVVFGECRMDLAQFRFTTFKNVHFVDCHLRQGDFTNADLRGVVFSGCDLTGAQFAQAKLAGARFHHCVLDGIR-SVTSLQGAIIDPTDLVSLADALGILIE.. 222
144 2.000e-54UniRef50_A0A0M1USH9 Putative pentapeptide repeat-containing protein n=14 Tax=Clostridiales TaxID=186802 RepID=A0A0M1USH9_PAESO  ali  31  2.........KIKIQEPKISNNLESYDVIDEIFEEERLEEKIIENTTISGVYEVRLTLNSCVFKNVVFENCDFRKLDVTDVIFENCNMSNINFADSGMYRVKFVNCKLTGTRFEDSILKDVIFYECLGRYSNFSFAKFKGVTIENSDFQSAVFQEVENYRLNLDFSELSKCTFSGTSLKGVDFTTCNIENCEYKVLDVAGGTFSIAQALELSKLLRITIK.. 212
145 3.000e-54UniRef50_A0A0J7K1I2 Pentapeptide repeat-containing protein (Fragment) n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7K1I2_LASNI  ali  14  314..SGAKLSGAKLRDADLRRAALYRADLSGAKLSGAALYRADLRYADLSGADLSGANLSGANLSGAKLRCADLEGADLTGADLTGADLGYADLIDAKLSGANLSGAKLGGAKLSGAKLRRSGLRGANLSGADLSYTDLSYAKLSYVDLSCADLSGANLAGADLTGADLINAKLRFAGLSGADLSGANTEHI............................... 501
146 3.000e-54UniRef50_A0A1I1IRQ1 Uncharacterized protein YjbI, contains pentapeptide repeats n=1 Tax=Alkalibacterium subtropicum TaxID=753702 RepID=A0A1I1IRQ1_9LA  ali  26  3...........KRVEPQVPKHLDHQTFDDSDLEDPYIEYVEIRDCVIPMHDIRRLEFKTVRFVNVQFEAIDLEEGYFRDVVFEKCQFVNAVFSHAMMKQVSFIGCRLNGTLFNDCKLEHVLFKDCVMDLCSFGYSELKVCDFDTSRLSEADFLELKWSDIRFLECLLDGSRFSRTSLSGIDISTSRFDSLSIELDALKGAVVSQSQALAFLDLLGLEIRD. 212
147 3.000e-54UniRef50_R6CJY4 Uncharacterized protein n=1 Tax=Ruminococcus sp. CAG:579 TaxID=1262963 RepID=R6CJY4_9FIRM  ali  25  2...QISAVKPMPDTRAFADPI---AYIRSCAEADEDISSAEFSGVEAAYEEVYSADLYSCKFSACRFTDCNFEKVYFKDCEFSGCDLSNSAFSDCCFKGCKFRGCRLLGISLDECVCEGVRFENCTLDYAVFSNSKLAVTAFSESAMLSAAFISCTQRGLSFSGCTITKPQFTRTSLKGVDFSDSRLSSLVTSDSELRGAYFTPAQAAELALLMGIKIKN. 217
148 3.000e-54UniRef50_A0A0P9FSJ3 Uncharacterized protein n=15 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0P9FSJ3_9BACL  ali  22  2...............................FIEEEYYDEHFLEAQYSQQEVTSVRFYDCKFTKCDFSETVFKDCKFSGCTFENCNLSLIQVLDCDFSQVSFNHSKLIGINWSEMAPPRLRFEECTLSHSTFIGLTLPRSVITKCTAKNVDFREADLTEADMSSTDFSESLFERTNLTAADFSSATNYMIDPGLNPIRKAKFTLPEAISLLYCMDIQLID. 196
149 4.000e-54UniRef50_A0A2P8DPD8 Uncharacterized protein YjbI with pentapeptide repeats n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2P8DPD8_9ACTN  ali  18  10LRSGAPLEGVDLGDSDLRGADFSRCDLSGADLRDTFLIEAEFTDCRLDGARLESAALDGARFTGGSAAGAVFTAAEAADGRFTRVDLANTQWSGTLLTGAAFTGCRLTGANFGGCRGIDYTFAECNLMLARLKGISMRGQTLRGLRMDEADLTKADLRETVWYESRLRGAVLAGARMQGADLRGADLGEIDLAQAPLSGATIAPDQATMLLSGVGIQVVE. 239
150 4.000e-54UniRef50_UPI000A055AD5 pentapeptide repeat-containing protein n=1 Tax=Nocardia brevicatena TaxID=37327 RepID=UPI000A055AD5  ali  15  121......................SQASVLNADLRNTDLRGKDLAGATLVQATLSGADLTDANLTGADLTDADLTDADLTGAKLIHADLDGVVLTRARLLLADLMDATLSSADLTGANLTSVKLIGATLARATLTGANLTGANLTSVKLIGATLARATLARATLIDADLSGATLVQATLSGADLTDAKLSDADLTGADLARAKLVRVDLTG-ANLTEADL... 315
151 4.000e-54UniRef50_A0A136P6K2 Pentapeptide repeats (8 copies) n=1 Tax=Chlorobi bacterium OLB5 TaxID=1617412 RepID=A0A136P6K2_9BACT  ali  25  1...............................MQQEIIEDKVFDNLSFKRSKLKAALYENCSFVSCDFENSDLAEFKFTDCTFTGCNLSLASLGNTAFRNVQFNGSKLMGVNFENCSGFSVGFNDCILDNTAFTGLNLKNTVFTNCRMFNADFTSAEMENSVFNNCDLKGAVFFKTGLKKADLTTSVNYIIDPELNRISKAKFSLTGIPGLLAKYDLKIE.. 190
152 4.000e-54UniRef50_A0A061PAV8 Pentapeptide repeat family protein n=2 Tax=Geomicrobium TaxID=767528 RepID=A0A061PAV8_9BACL  ali  21  5............LQAPKMRG--RRELFQQAICPEELYENIEIVEQSYDECDGKHVRFSNAYFKGVSFLSSKFAHSEWIDCVFKKCDFSNVDFANAIFHRTEFMNCKMSGATLSDMGIQDTRFVNTHMPYVSLSFSTCKRVRFEGCSLSSADVVEATFQSVELGDSTIEDVQFSNTNLGGVDFSDCQFERLTVSEGQLAGCTVSETQAIAFIRAFGIHVK.. 210
153 4.000e-54UniRef50_UPI000DAE5C53 pentapeptide repeat-containing protein n=1 Tax=Thermosporothrix hazakensis TaxID=644383 RepID=UPI000DAE5C53  ali  22  57...KTRGGSRMTLRSPVIPPKARHPWSAAQLTAQERYEQMLIEGMRFDGQDARLLHFEQTLCRDTGLRGVVSEGIQLVDCRLVDCDLANARWSNGGLHRVMFQKCRMTGFIGTESLFEEVLFHDCMLDLALFRYAVLRHVRFKDCLLQEADLQGAKLTDVRFEGCSLAQVQLSQSRLRDVNIAGCAIDGLHIGMSEVAGLTVDPAQALALVQLFGVKIE.. 273
154 4.000e-54UniRef50_E8X476 Pentapeptide repeat protein n=2 Tax=Acidobacteriaceae TaxID=204434 RepID=E8X476_GRATM  ali  26  4........KPKSRQAPQIDHDILTEDFAAQLDSGA-VHDALAADTTFVSPRGQSARLDRCLWRNVTLTAPNARGLRLYDTQIEGSDLANLDLTGGHLERVEITGTRLTGATFTEAQLKSVLFRECKLDLAFFRMARLQHCVFERCNLTDADLYNADLTGTIFKDCDLSRAELSHAKLIQADVRDCRLDGLRGTPADMAGLMISPDQAPQLITLFGVKVK.. 216
155 4.000e-54UniRef50_UPI000832C0A1 pentapeptide repeat-containing protein n=2 Tax=Streptosporangiales TaxID=85012 RepID=UPI000832C0A1  ali  22  2..PTSRPSRPAHPAAPAIPDDLAEAHPPEGLADDDVYLSTSFGAVDLSAGAAEDTEFAGCRFTRTRLAGTALRRARLTDVEFRGADLASTTVEDGVLRQVAVRDARLTGAVWSGTGLRDVLFDGCRADLSRFRFSRFTDVVFRGCVLTEADFHGAELRRVRFEDCRLDGARFDRASAPGTRFTRCELGGIG-GVEGLRGAVVDAVGAHGLAGAMGITIED. 226
156 5.000e-54UniRef50_A0A0X1S000 Pentapeptide repeats family protein n=1 Tax=Kurthia sp. 11kri321 TaxID=1750719 RepID=A0A0X1S000_9BACL  ali  26  3..............EPKLPQHLTETTWNRILAQEEEAEQCLIESINFEEDEACDLRFVQVIIRDCRLNNSSIKRLNALDVRFENCDLSNVDFSKSSIHRVVFERCKLVGTIFQGSSLGDVTFESCKMNFSLFNETKLKHVLFNQCDLEQSDFYAVTHQFLQFEQCRLSGLQMQQTDLTTLDLRSSQFTHLTVDLERLKGCRVNMEQALILASLLGIRIE.. 208
157 6.000e-54UniRef50_A0A1Z4QI21 Pentapeptide repeat protein n=1 Tax=Cylindrospermum sp. NIES-4074 TaxID=2005457 RepID=A0A1Z4QI21_9NOST  ali  15  124..SSADLSNAVLNGVDLSGVNLYQANLRGVRLDNVNLRGVNLNGVNLSGVNLRGINFNGVSLNGVNLSNTDLSGVDLRGVDLRGADLSRSNLSNANLNGVNLSNANLRGVRLDNVNLRGVNLNGVDLSGVDLRNINFNGVSLNGVNLSRANLNDFNLRGVELKNANLSYASLENADLGNAQLQGAYLEGANLRNADLRGANLD.................. 329
158 6.000e-54UniRef50_UPI000CF18AEE pentapeptide repeat-containing protein n=1 Tax=Hanstruepera sp. L53 TaxID=2071625 RepID=UPI000CF18AEE  ali  27  6....................................ISDQTFEKQDYRSKGLPKAEYDNCTFTNCDFTDSYLSATSFIECQFTDCNLSGVKIKDSTFNEVLFTHSKLLGINFAECSLFSIEAHHSIFSFSSFYNKNLNQTHFNHCIFEKVDFTNANLSKVRFEKSDLKHAIFENTNLELVDFRTASNFNINPDSNKLKKARFSKDGALTLLSNHQIIIE.. 190
159 6.000e-54UniRef50_A0A1Y3YG73 Uncharacterized protein n=6 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1Y3YG73_9FIRM  ali  25  2...NKKVFKEPKIPEELTEVKDGAELIRTAREEEGEIFRRQFTGTFLSRIDGKHISFQQVVFRNCKFLGCSFDRASFTDVKFIGCDFSNSSMNDVCFKSCAFENCKALGTDFYGSNIRHISIENCNFRDAGMDAVRMSYVKIYHSDFTDASFSKCNITNVDWKDDCFKNASFFKTWLKDIDFTECDITGIVISDAKLREVIVNLEQAIVLAKRLGIVIKE. 220
160 6.000e-54UniRef50_D2AUM2 Uncharacterized low-complexity protein-like protein n=8 Tax=Streptosporangiaceae TaxID=2004 RepID=D2AUM2_STRRD  ali  19  1MPSRTPAAGPPRPKEPRSPASLAAVEHFDRDLEDDVYKSMEFRGVDLSSRDADAVEFEGCRFVDTRLSGTAMRRGGFSNVELERCDLSGMAARASSMHRTRVSASRLTGMTWSECGFKDVTFDACRADLTGFRFSTFKNAVFHDCALPEANFQNADLRGVRFERCNLTGAQFSGAEMEGARFADCVLLGIG-GVTSLRGVTIRSRDAQGLASAMGITIEE. 227
161 6.000e-54UniRef50_A0A0M3UB72 Uncharacterized protein n=9 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0M3UB72_9PSEU  ali  23  7...........LVAAARAGGEVDAPRLDEADLRETDLAGLVLRGGSLAGADLRGVRLDRARISGTSLAGADLREADLTDAVLSGVDLSGARLAGATLGDTRFTGCRMIGTVLRGLRGLTTSFDDCSLQLADVRDVAMRGLRVADCDLSEADLSGADLRDVRFERCRLRGTVLRSTRLDGADLRGCDLGEVTPTPRELRGAIVSPTQASAICAALGLTV... 216
162 6.000e-54UniRef50_A0A0G4AWN8 Quinolone resistance protein n=2 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A0G4AWN8_9BACT  ali  22  1..........MILSRPKLPKILENSTLA-TMVDDGELEDVQLRDVDGTNISIAALDLSGVLLDKVVFLGAHFGRVTMRDVSIQASDLSSAHLSNGAVVRAEFVNCRLTGVDFSQTSLHDVVFKGCKLDYANFRQTDLRRVNFVDCTLQETDFGSAKLSSVEFQSSQLERTVFHNATCSKVDLTSSQLLDI-VGLSSMKGAIIDTLQLVTIAPHLGIIVK.. 211
163 7.000e-54UniRef50_F7KDB6 Uncharacterized protein n=11 Tax=Clostridiales TaxID=186802 RepID=F7KDB6_9FIRM  ali  28  1MEKKSLKTAPPVLSASLREIEDGLAFLQDARREDILVEQCRIRGLTAENEDFYKLNLEGVVFENCSFFHCNFEKASFIDVQFRNCDFSNSVLDDCYFNRCEFLFVKGVGTDFHESLLKETRWEECSLSFANFSGSRWESASLAGCDMQESYLADCRFKKVEWKDLNLKRASFFHTSLKGMDLRGNDVEGIIVSENELRGAVADIYQAADLAKLMGIVIK.. 221
164 7.000e-54UniRef50_A0A2M9TSB1 Uncharacterized protein n=1 Tax=Psychroflexus sp. S27 TaxID=1982757 RepID=A0A2M9TSB1_9FLAO  ali  24  2..................................DFIVDQDFKDEDYTESKMQRVEYEDCSFTNCDFSAANLSHLRFVDCEIINSNLSSVMLGDTSFQNVSFIDCKILGVDFSVCSAFSVRFENCQLNHSSFEKQDLSQTLFKNSKLFDVGFFECNLSAAVFENSDLMNARFNQNNLKKADFRTAINFVIDPEDNQLKGAKFSKHSLQGLLEKYQLKIEN. 189
165 7.000e-54UniRef50_A0A084JRY2 Uncharacterized protein n=12 Tax=Clostridiales TaxID=186802 RepID=A0A084JRY2_9FIRM  ali  28  4.....KLLTPILPEA--MDFALEDVDLYRRKEQEEAVSDVLIRNLHVTEEDLSHMRFSAVIFENCIFQDCSFEKGEFTDVAFRACDISNCNFEDSYFNRAEFSSSKGMGTKFCGNTMLHTVIKDCNFNYANFDSSRLEHIRFTDSQIRGGSMTQCRCKAFEWNRANLENASFFKTMMKGMDFTDSTIQGLVMSDNEIKGAVVDLYQAAELAKYLGIIIKN. 219
166 9.000e-54UniRef50_E7RJF8 Quinolone resistance protein n=19 Tax=Planococcaceae TaxID=186818 RepID=E7RJF8_9BACL  ali  30  1.......MKKTKRLTPLLPKELETRSFTEAI-DDQYISNCRISQETIDFNTEEALHIDRVVFENVKFLETSWPRSEFVDVVFLNCDLSNMDMSRAVFHRTEFRNSKLMGANFAEAGIRHTLFEECILNYATFGFTLCNTVSFVSSSMRFADFYEMELKSSEFRLCDMNDINFTQTSLKGIDLSTNTFESIQVSIDKLQGCIVSTDQAIAFARQMGMIIAND 213
167 9.000e-54UniRef50_UPI0009EE8AE6 pentapeptide repeat-containing protein n=1 Tax=Bariatricus massiliensis TaxID=1745713 RepID=UPI0009EE8AE6  ali  27  12..........MGLLKPVIQEDLELVELFLAKECEERVQGIVFQNINIESEDLSRLIVSGTKFLNCRFWNCSFERAEFTDIVFQSCDLSGSNFHSGYFSRVIFDSCKAVGTKFTETRMQQITIDNCSMNYANFDNSVLKGLAFENTELNSSNISQCHCKDIVWKNTGLINASFFKTSLYGMDLTDCTINGLVLSDDELRGAVVDIYQAAELAKRLGITIK.. 227
168 1.000e-53UniRef50_A0A1W1DZ73 Pentapeptide repeat family protein n=1 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A1W1DZ73_9ZZZZ  ali  18  1...............................MRGAQLQGVNLRDAELQGADLRDAQLQGAYLGDAQLQGADLGDAELQGANLGGAELQGANLRGAELQGANLGGAELQGADLWGAQLQGVNLRGAELQGADLGGAQLQGANLWGAELQGADLGDAQLQGVNLRDAELQGADLGDAELQGADLRGAELQGADLRDAELQGADLRGAQLQGVAQLQGVNLRD. 193
169 1.000e-53UniRef50_A0A264W2I5 Uncharacterized protein n=2 Tax=Planococcaceae TaxID=186818 RepID=A0A264W2I5_9BACL  ali  27  1..........MATQAPRFAGTLLETTLAAIPLHEDEILHVELSDENLIEEKYPRLRIQNSLFKNCSFTDSEFIQADWTDCRFENCDFSNVTLTKGSFNRVEFVNCRMTGIDFSESRLYDVRFDTGAMPYALFSNTTLKNSVLESIKLDFAHFYKATFDDVTIVNCSMEDVTFEETKLKDIDLSSNSFEIIKVELEDLRGATVSTHQALLFASLMGLKIKD. 211
170 1.000e-53UniRef50_A0A1Y2N6F9 Secreted effector protein pipB2 n=2 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1Y2N6F9_PSEAH  ali  21  2......TTAEILIAAVRAGEPVHDPDLAECDLREVDLAGLQLRGGSLAGADLRGARLDRARISGTSLAGADLREADLTDAVLSAVDLSRARLAGALLGDTRFDDCRMLGTVLRGVRGLAASFTGCNLQLADLGDLALRGLRVSECDLSEADLSGADLRTVVFDRCRLRGTVLRAARLDQADLRTSDLGEITPTPRELRGAVVSPGQAAAICGALGLTV... 216
171 1.000e-53UniRef50_S6HHG9 Pentapeptide repeat-containing protein n=2 Tax=unclassified Oceanospirillaceae TaxID=221817 RepID=S6HHG9_9GAMM  ali  22  5...............................FTETAYYAEHFKQVTLPGAEFLDISFEDCQFENCDFSESTFINCHFLECDFTNSNLSLVSLPSCRLNEVLFKQCKLLGIDWSKIHWSQVVFDQSVLNDSSFFALQLQGLKIIDCRARDVDFREGDFNQGSFSHSDLTGSLFGKTNLSGVDFSEAVNYQIDIENNRINGAKFSRFEAVRLLEGLDIELVD. 199
172 1.000e-53UniRef50_A0A224XBV0 Uncharacterized protein n=2 Tax=Lactococcus reticulitermitis TaxID=2025039 RepID=A0A224XBV0_9LACT  ali  22  1..........MAILNPKISADLPVSNDL-ILAEEAYFDGHHYKDSKADRSFCERVCFRQSIFTNCDFSGVDFASFECLDVVFNHCDLSNVVWLSGVFHRVEFNNCRMTGANFAESVLHNYVFNNALLNYSSFNFAKFKNVLFQESPMQDSEFTEVTYTNLQFQSCELTASNWAQTPMNQLDFSNSTFEHLTYSLERIKGLKVNPSQALTLATSLGIRI... 207
173 1.000e-53UniRef50_A0A1T4PLU1 Uncharacterized low-complexity proteins n=1 Tax=Marinactinospora thermotolerans DSM 45154 TaxID=1122192 RepID=A0A1T4PLU1_9ACTN :_  ali  21  3.APSTRSSAPLRHPAPRIPSRLAQALLRDGLGNESSASSLEYGPVDLSGRQAWAAEFEACRFDRTDLSGSVLRGARLVDVEMRGVDLAGADLHDGALTRAAVRNCRLTGASWAGGGFREVVFDGCRGDLASFRFARLTGVLFRDCDLREVDFQGARLSRVRFEDCDLKGARFDAVEAAGSRFSRCDLWGLS-GAVSLKGVVVDDTSAPALLHALGITVE.. 225
174 1.000e-53UniRef50_A0A1Y4IS19 Uncharacterized protein n=3 Tax=Gemmiger TaxID=204475 RepID=A0A1Y4IS19_9FIRM  ali  26  5...........KLLEPALPARLELAERPEELVDGDALTGWQIVRADLTGMDMNELEVQGCLFQGCRFTGANWHGARFADVVFRNCECSALQAEDADFCRCRFENTKAMGASFAGSRLAHVRLENSNFRQANLTGALLQQVLWKQTDLSEAFLAQCKHKSLAFRECTLMSTSFFGTLLNGLDFTDSRMEGIVVSDTELRGAIVNVSQAADLARVLGLVIR.. 219
175 2.000e-53UniRef50_S6B2J0 Pentapeptide repeat family protein 1 n=5 Tax=Proteobacteria TaxID=1224 RepID=S6B2J0_9PROT  ali  23  27.....................FTECDFSNADLSRLDLSAIEFSNCEITRVNLRGASICDSAWISCRGVGASLHATDCSDTSFLRCNFSNTDWRGARLSSARFEGCKLTGANFSDARLLGIHFERCLLVSAILRGVSFRKSELIGLDFTDADLGGADFRDAVLTECSLREASLRTASFLNADLRGCDLGSLNFSDAALRGAIISSSQATELLGGFGLTV... 224
176 2.000e-53UniRef50_UPI0003754BC6 pentapeptide repeat-containing protein n=1 Tax=Pantoea sp. A4 TaxID=1225184 RepID=UPI0003754BC6  ali  21  2...........................TNLLISDQEYIDEDFKDISQNEDEIVNTRFENCTFTHCNFTESTFRKCSFFECEFSKCNLSLLNVSYSSFREVAFHECKLVGIDWTRAAWSALNFHHSVLNDSVFFGLYLAQCSLIECKLQAVDFSEAQCEAADFSGSDFTHATFHHTRLTGANFAWAHGYNINVLNNEVKSARFTLPEAATLLTSLGIEIIDE 201
177 2.000e-53UniRef50_U4KQU6 Conserved hypothtical protein (Pentapeptide repeat) n=1 Tax=Acholeplasma brassicae TaxID=61635 RepID=U4KQU6_9MOLU  ali  31  1..........MNIKAPILRITDEEILDLNAY--DTFIENIKFTNEAYPPFHVKNYTFNGVIFDRIIFNLAKFSNCTFIDCLFDSCDLSNLKLDHTLFQRVQFNECKLLATSFSEASFKDVSFLNSKTKYLNFTKTKFNLVLFKQTNLQEAYFIEPNIQKLEFDHCDLNKAEFSQANLKGVDLSDSIIDGVNFDYQSLRGLIIDANQASMLVGLLGVKVKD. 208
178 2.000e-53UniRef50_D4JUY4 Uncharacterized low-complexity proteins n=7 Tax=root TaxID=1 RepID=D4JUY4_9FIRM  ali  25  12............LTAPKLPDNLFTVTDIDAELSESDFIAADFSRLICAETDFSAICFRNCLFHGCRFTACDFTGCTFIDCVFKGCDISNSDFSESYFKACSFISCKAVGTAFKYSFYKNVSFDGGSFELSDFQRSKLQSVAVTDTDFSSALFSSCEIKQTELKNVTLARSVFFGTKLAGLDFTSCNIEGLTVSDAELKGAKVDVWQAAMFAKLLGLIIE.. 225
179 2.000e-53UniRef50_UPI0006E3AE5B pentapeptide repeat-containing protein n=1 Tax=Microbispora sp. GMKU363 TaxID=718014 RepID=UPI0006E3AE5B  ali  25  6..SRSQQKQPKEPAAPKLPTSLAVARLPAHDLEDDTYRSMAFTGIDLSDRDVEIADFEGCRLVDTGFAGTRLRRADFVDVEFERCDLSTMAARTTTMRRSRVSSSRLTGTTWTECAFRDVLFDGCRADLVGFRFSTFTGTVFRDCSMSEANFQNADLRGVRFERCDLTRAQFSQAQMDGARFADCTLAGIG-GVTDFKGAIVRSQDAQGLAGALGITIE.. 226
180 2.000e-53UniRef50_A0A2M7UJY3 Uncharacterized protein n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43_11 TaxID=1974776 RepID=A0A2M7U  ali  25  9..............................DLKSKTYSNKNFQGLFLRQHDLTGKEFINCTFKNCDFSESEFSRSLFTDCIFLDCDLSNIKVNHCSFQEVIFEGCKLVGIIFSTINLISWTFKECKIRFCDFSNLKMIHSTFFKCLIKENNFINTNLKGVDFGRSDLQLSQFNNTNLEKANFVGSINYYIDPTQNRLEKSKFSQPEVLSLLAGFKIDIE.. 199
181 2.000e-53UniRef50_UPI0009E068D4 pentapeptide repeat-containing protein n=2 Tax=Micromonosporaceae TaxID=28056 RepID=UPI0009E068D4  ali  24  11MPSPSRPAEPAKPRPPK--ALELATVDEDDLRDEGTFTGLGFYDLELTGRSAKGAEFRQCRFNRTDLSGTAFVKVSLTDCLVERSNFANLHGDQSTLLRVAFRDSRLTCLQWLDGVLRDVTLRDCRIDLSAFRATKFAAVAFEDCNLAGADFTGADLTGATFTRCDLTGAQFSAATMTGTRLDQCDLSGV-AGVTSLAGATVSTADLVTLAAALGITIAD. 231
182 3.000e-53UniRef50_A0A173L2T3 2-iminobutanoate/2-iminopropanoate deaminase n=78 Tax=Bacteria TaxID=2 RepID=A0A173L2T3_9SPHN  ali  21  25..................PQSLIQCDLSDADLSRLDLSDWSFERCNLRKTDFSGAKLERTRWRSCRAAFANLTGCDLSEAAVAASDFNNASFKRTVLEGAKFGQCKLTGADLTDVRGVDFHFEETLLIDAKLPGLSFRRATLTRMDFSQADLRKCDFRQASFQQSSLREANMQGCRFEGADLRGADLGGLRLVDAGLRGATISREQAAQILGELGLNIR.. 226
183 3.000e-53UniRef50_A4XCZ7 Pentapeptide repeat protein n=50 Tax=Micromonosporaceae TaxID=28056 RepID=A4XCZ7_SALTO  ali  20  1MPVRSRATDPRKRREPRSPVPPTEVDLWEALESESTLTCQALYSARLTGQDASSVTFRQCRFRGADLAECRLDQVVLSDCLVTDSSWANLRADGGEMARVRLAQCRMTGVTWADGVLRDVTVTGCRVDLSAWRMTTFDAVRFEDCNLQGADFTNADLRGATFRGCDLTGAVFHHASMEGTRFRGCTLAGVDFS--SWRGAVVDHEDLIGLAQAAGIQVEN. 229
184 3.000e-53UniRef50_A0A250I8Q7 Uncharacterized protein n=2 Tax=Melittangium TaxID=44 RepID=A0A250I8Q7_9DELT  ali  20  10......................QAARLARRLEHEDTFEHETFADLELPGRELRQKEFYRCTFQRGQFQESHWRQCKFEDCVFTGCDLTRARFDAAALRGVRFEGSKLMGIDWSSVSPNEVSFEGSQLRYASFVGLSLRKTAFLRCTAQEANFFDLDLTDADFEGTELTGSNFRGCVLTRTDFAQAVGLVLDPARNRLKDTRVPMATAVSLAESLGMRV... 206
185 3.000e-53UniRef50_E9RYZ0 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=E9RYZ0_9FIRM  ali  24  1..........MKRQEPLIETEPDGKELMEKKLREELLAGVKISEIVVEEENYERIGARRTVFENCRFLACDMERCEFSDVIFRRCDFSNTNFRRGYFKRCLFENCKGVGVKMTECLISHVRFSGCMFSYANLDGSKLEYLEAAESSFRAAGISDCFCREVRWEHVELSEVNFFKTSLRKMNFTTCEIGGILISDDNLDGAEVNLFQAVELSKRLGIIIKEE 219
186 3.000e-53UniRef50_A0A1M6NRY4 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A1M6NRY4_9FLAO  ali  25  6......................................GKIFSSRQYKTGQIKQGDYEECTFTGIDFSSRDLSYFKFSNCDFEDCDLSNAKIHRTAFREIVFRNCKMMGLNFEDAHSFNIKFDGCNLDLCSFYQLDIRKTIFRNCSLKEVDFTEANLSSALFDHSDLTSAVFDRTVLDHADLQNAIGFSIDPNKNQLKKTKFAKDNLAGLLQQFQIIIE.. 188
187 3.000e-53UniRef50_D9R8Q9 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=D9R8Q9_CLOSW  ali  28  4.....KLLPPILPGA--MDVVLEDEELFLRKDQEEAVTDVLIRNLHITEEDLSHMRFSAVIFENCIFQDCTFEKGEFSDVVFNACDISNCSFEDSYFNRAEFRSSKGMGAKFCGNTMLHTVVLDCNFSYANFDSSRLEHIRFSDCRIQGGSLTQCRCKAVEWNRVNLENASFFKTMMKGMDFTSSTIQGLTISDGEVRGAVVDLYQAAELAKYLGIVIK.. 218
188 3.000e-53UniRef50_UPI000557D510 pentapeptide repeat-containing protein n=1 Tax=Deinococcus misasensis TaxID=392413 RepID=UPI000557D510  ali  27  35..............................LEPESTYSGLKIE-LDTSGTEIYGLTFQGVHFEDSNFSGTRWEWLRLQDVLLEHCNLAGLNWLEAGFTRVKFQDCRLLGAQFVGLQAAHLTLQNCDARLS-FWQGNFKQAHFKDCNFEDARFDTADLQKAVFRDCNLTRANLRECKLQETDFRGSVLAGFKVQVQNLQGAIIETQQLPELAHLLGIQIQE. 222
189 4.000e-53UniRef50_A0A242K4A5 Uncharacterized protein n=1 Tax=Enterococcus sp. 9E7_DIV0242 TaxID=1834193 RepID=A0A242K4A5_9ENTE  ali  24  1.......MKEKKRITPMLSGNLIAEMPT--FEDEATIDAVLLENEGLYEADFHHLFIKESHIKKFQMPASRLSQFECVNVVFEHCDFSNSEWIGSGFHQVEFRQCKLTGCNFAEAYLKDCLFSDCILDYASFSMSTMKVVHFEESSLRQAEFSELDWQHLKMKDCQLTQSQWFNTPLKNLDFSENQFDTIALSPESIRGMIVNAEQALTIAETLGIILK.. 210
190 4.000e-53UniRef50_A0A1C6CCG5 Secreted effector protein PipB2 n=1 Tax=uncultured Butyricicoccus sp. TaxID=1193532 RepID=A0A1C6CCG5_9CLOT  ali  25  3..........VRLPESLAPVPDAAERFAWAEQEERTVEGLHLCGADLSGTCYEGLRLRSVLFENCRLTGCRWERADLGNVVFRRCELSNSGWRDAFWERTVFEDCKAVGAGFAETGWRQAAFAACALAYATFDRARLREVAFSDCDLSHAAFHECTWKRLSLDKTRLREASFLHTPLAGLDLTGCELDGLVVSDAELRGAIVTAEQAAMLAKRLGLVIKE. 214
191 4.000e-53UniRef50_A0A2V1N235 Uncharacterized protein n=1 Tax=Lactobacillus bambusae TaxID=2024736 RepID=A0A2V1N235_9LACO  ali  26  6.............QEPRIQMDQLRSVPFTAILEDEDLKRTLIHDETVTGVDLDHPFVEQSQFTNTVFAGVTWDRIELTDVVFDQCDLSNCRFEGASLLRVKFINCKLVGTNFHESYVNQVTFQGCKMDFADFSDGRLTQLVLTGCQIVSADFGYAKVDRLTFDDCQLTDTSFEEATLKRLNLSSSQFDNLQIQPNQLSGCTLNESQAVLFAQLF....... 208
192 5.000e-53UniRef50_M7P9E5 Uncharacterized protein n=6 Tax=Bacillales TaxID=1385 RepID=M7P9E5_9BACL  ali  26  1.......MTVVKIREPKLMKELPETAWEEADEEDASVRSVCVDG----GAAVSRVILDGAWFRKTDFRGFRAPASELMDVVFDGCDLSNADFSRSSLHRCEFRGAKLTGAVFSESMLRDVRFTNCAGRYSSFNFSKLRNVAFDNCELESADFVDCSMKAVAFGQNRLDDISFLDTDLDGIDLTRTEFSRITVTPSKLAGCKVTREQAIGFARTFGLVVEED 213
193 5.000e-53UniRef50_A0A0M9EIC8 Secreted effector protein pipB2 n=6 Tax=root TaxID=1 RepID=A0A0M9EIC8_9RHOB  ali  20  27..................PYHLTNCDLHGTDLAELDFTGWSFETCNLTGASFKGATLEEATLKGCRAGNIVLQGADLTDALISGGDYSNANLRGTKLTHCTIRNCKMTGADLSEAQAIGVTLEKVLFHLAVLPRFSFRKMTLKRVDFSDANMNRCDFRDAVLEDCSLRNTHLVDSRFENADLRGADLGGIMLTDRRFKGATISKQQAATLLGQLGLQV... 227
194 5.000e-53UniRef50_A0A1C7IIG2 Uncharacterized protein n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1C7IIG2_9FIRM  ali  26  1MNSKMFQEPKAPVKLPVIEDVVS--VLEDAKISEEEITGCCFKGVFITKFDGKLLRFKKMAFENCKFISCFFDEASFTDVRFKNCDFSNTSLTDVYFKRCSFQSCKAVGADFYGSLMRHVSFLECNLSDMNLDASRMSYVKIKDTNLEESSLSKCGLDNLDLHQVKLAGASFFKTALKGVDMSDCDMDRIIISDEELRGVVLNMTQAIVCAKRMGIVIKE. 220
195 5.000e-53UniRef50_UPI00059A9FD5 hypothetical protein n=1 Tax=Beduini massiliensis TaxID=1585974 RepID=UPI00059A9FD5  ali  29  1..........MKINPPKILPKLEPVESIITVMDDGFISHGYFENTIIDEEGIR--EFDGCRFKNVQFFLAKDHRISFVDCHFDHCEIANLTLANISILRCAFVECKCTGLEIIESYMKDVHFERCLMTYMNFSKTKTDHLLFEENDLSYGSFNDMKIKGIEFKNNDLTRCEFFFTSLNGVDLRTNTIEGIAITLNDLKGAIVDTFQAISLSRLLGIIVKED 209
196 5.000e-53UniRef50_A0A239GDH6 Uncharacterized protein YjbI, contains pentapeptide repeats n=3 Tax=Streptosporangiaceae TaxID=2004 RepID=A0A239GDH6_9ACTN  ali  21  1MSSRTSPARPQRLKAPKMGASLPTAGLLEDLEDDGVYRSLEFRGSDLSSRDADAVEFETCRFVDTRFSGTKMRRGGFSNVELERCDLSGMAARSASMHRTLVSASRLTGMTWSECGFKDVTFDSCRADLTAFRFSTFKNVVFRDCAMPEINFQNADLRGVRFERCNLTEAQFSGAQMEGARFADCVLLKIG-GVTSLRGVIIKSQDAQGLASAMGITIEE. 227
197 6.000e-53UniRef50_A6VSR9 Pentapeptide repeat protein n=1 Tax=Marinomonas sp. (strain MWYL1) TaxID=400668 RepID=A6VSR9_MARMS  ali  14  120.................IGVYLREAHLPLTDLNLAKLNNVDLSRANLKSSILTNADLTDAVLLWADLTHANLTRANLTSAVLRFANLTGANLQGTNLTSADLTGADLTGAVLWWADLTHVNLSRANLTNTQLQEANLIGSTLWLTKLSGTNLSGANLTGASLRRAHLKNTLLHRANLSSANLSSANLSGTNLSGANLSGANLSGANLSS-ANLSGANL... 319
198 6.000e-53UniRef50_A0A1E2WQG1 Uncharacterized protein n=1 Tax=Nostoc sp. KVJ20 TaxID=457944 RepID=A0A1E2WQG1_9NOSO  ali  14  117..SGANLSGASLIGADLIGANLNKANLIVANLTGANLNKANLIVANLNRANLNKANLIEANLTGANLWQANLSEALLRRANLSELDLTGANLTGANLTGANLWQANLSGADLSDADLIEADLIRANLSYANLSYADLRDANLSHANLSYADLTGANFSEADLSGLDLNGLDFSNVDLSRANLSRTQALETDFTNAKFTGACLEDWNINSATKLNDID.... 346
199 6.000e-53UniRef50_A0A0P9CAC3 Quinolone resistance protein n=2 Tax=Alicyclobacillus ferrooxydans TaxID=471514 RepID=A0A0P9CAC3_9BACL  ali  27  2.......TKTTKLERAKLLPGLATVNLEDVDEEELELVNCSVSNSQMDDRSVDRLIISRAIIKNVSFVDSTLMNIDATDVIFDNCNLSNARLCGGTIHRAEFRHCKLLGLDVSNSTLGNVLFEDCHLNMSNFAESRLKQVHFEACLLRGSHFFNAMFQNIILDRCDLDDADFTQVSLKGIDISTCSFEKIRVSIDNLAGCEVSPRQAIAFAKLFGLTVKD. 215
200 6.000e-53UniRef50_A0A2M7W0N9 Uncharacterized protein n=1 Tax=Candidatus Dojkabacteria bacterium CG_4_10_14_0_2_um_filter_Dojkabacteria_WS6_41_15 TaxID=2014249  ali  24  14...........................NNSISSNETVEEAQIIGADCTTKKIEESEYYNCVFRNCHFNDATLKKCSFDTCTFEHCNFNMCKLTDTTIKSCKFLSSTLVGVDFTKTKVFQVVFRNCNLGFSLFSTLKMIGSTFVACNMEEVDFAEAKLDESIFHFSDLSRAIFNHTDLRKTDFRGAHNYTIDPRNNFLKDAVFSEPAVMSLLDSLGIKIAE. 209
201 6.000e-53UniRef50_UPI00047FC592 pentapeptide repeat-containing protein n=3 Tax=Peptostreptococcaceae TaxID=186804 RepID=UPI00047FC592  ali  30  2.......VKLINIDKPKISEVLETADVYEELEFNNKLEDSLVEDVVIEGLYNLKLSFDSCVFRNVVFLDCDLKKIDLLDVIFENCDFSNCVFSDSSIYRVEFKNCKLLGTRLEDSFFKNVLFENSMARYSNFSYSKFNGVNIVQSDFSEAVFQEIKNEKFAVDQVELNRAIFTGSKLKNLDISSSSVEDIDVRIEDIRGVKCSVAQALDFTRFMGIKIK.. 214
202 6.000e-53UniRef50_R5LLB8 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R5LLB8_9MOLU  ali  28  1..........MKLEKPKFH-NLEEKKILDCLETK-NFTNGLFKEKTEDDIVIKDITFDTCVFENVDFTKIKLENVDLIDVHFKNCDLSNQNFDKQFLRRVLFENCKLIGVSFIEASLKNIEFINCNAKYINFSSGKLVNLKIEESDFSESTFSRLDLTNLELNNVKLHSTEFIRTNLKDTDFSTCDITNILFDQTSLKGIVIDDFQAMNIASLFGVKIKN. 208
203 6.000e-53UniRef50_A0A1Q9U6L9 Uncharacterized protein n=4 Tax=Thermomonosporaceae TaxID=2012 RepID=A0A1Q9U6L9_9ACTN  ali  21  1MPSRTTTIKEPK--APRIPASLAPADPLEELRDDGTYVALDWGAVDLVGHDVESVDFERCRFTDTRLSAGTLRRAGFADVAFGGCDLANLRLFDSRAFNARVRDSRLTGMSWTDCGFRDVLFDECRADLSNYRFSRFKDVVFRDCNLQEANFQGADLSGVRFENCRLTGAQFSDATLTGTRFTGCDLWDI-AGVRSFDGAILAPAD............... 204
204 6.000e-53UniRef50_A0A1H7HG09 Uncharacterized protein YjbI, contains pentapeptide repeats n=3 Tax=Alkalibacterium TaxID=99906 RepID=A0A1H7HG09_9LACT  ali  26  2.........SVKIKRPSLPDNLPIINFSEIFDPEDYIEQAEIADCVITLSDTRLIEFKGVRFRNVQFDQLTINNAYFKDVEFIKCECINAELTETSLKQVSFNQCRLNGMLFTDSFLEDVSFTDCIMHLSSIGFSKVKSVLFDQCKLNEMDFLECSLKQTRFESCDLNRAKFSHTSLNTIDLSSSEFDAIAVSIDDIKGAIVNESQALGFLEMLQLKIKD. 213
205 7.000e-53UniRef50_K9EI80 Putative low-complexity protein n=1 Tax=Leptolyngbya sp. PCC 7375 TaxID=102129 RepID=K9EI80_9CYAN  ali  13  368.........PDLSGADLRSADLTEADLSRANLSEANLCRAKLCAANLEGSNLSRANLSGADMHLANLNRTDLRGAVLCEAKLTRVTLEEANLSGANLSDAAVFEANLSRANLSGAKLYKTYLVESNLIGANLSETDLTKMNLRETNLHGINLSGADLSKMDFTGVNLRGANLRKTNLCEANLNSAELNQANLSEANLRKANLSKAKLLG-TNLQGADLR.. 592
206 7.000e-53UniRef50_A0A1Q3ZL99 Uncharacterized protein n=1 Tax=Flavobacteriia bacterium 40-80 TaxID=1895763 RepID=A0A1Q3ZL99_9BACT  ali  30  2...................................NFYDEIFEKTT----DLSIGTYENCTFTDCDFSNKPFSSSKFIDCTFERCNLSNASIAGTAFQSVTFSECKLIGLLFEHSNGFSVNFSGCILDNSVFYKKHLKKAAFINCSLKYTDFTEAQLNEAIFHGSSLLHAVFDRSQLEKADFSKAHHFQINPQNNQLKKAKFSEQGLRGLLSGLDIVIVD. 184
207 7.000e-53UniRef50_A9AYK3 Pentapeptide repeat protein n=3 Tax=Herpetosiphon TaxID=64 RepID=A9AYK3_HERA2  ali  25  2VRPRRKRYQGITPPQHCPPAELKTVSEL-SLSDNSNYAQLIIQQLNFNQQRAKDIFMEQSLVRQCQFNQVVLQQSQLVDSSFEQCDLSHANWEKSHLERLEWRNSRLGGMKFVEAQAEHLVFSTCQLDYSVWWSARLEHVRFEDCRMLEISFEAAKLSDICFRNCDLSRANFRQATLSNVDIRGSQIGGMQIEPKQLQGLIIEPRQALEIAQSLGLTIRE. 220
208 7.000e-53UniRef50_A0A2S8SUZ4 Pentapeptide repeat-containing protein n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SUZ4_9BACT  ali  23  1.......MKKTLLSPPRFDENSLTPQDFDELELESEIDLRALKIGGVAHGEAENARFSSLVFEGARLSAVAMRRAHFEDTIFRVCDLAGLDARQVFASRIEIEACRATGILAPESDWRDAVFRDSNLSLAQFRFAKFERARFEDCDLREADFQNADLSGVVFQNCDLSGAQFSFARLQGADFRTSETQKIVVDASALRGLIVSPLQAAQFAAILGLQVR.. 212
209 8.000e-53UniRef50_A0A1F8TF65 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8TF65_9CHLR  ali  22  3................................SDAHYTDLIFEKVELARTRLTACHFSHCSFRRCSFMESALDNCRFLDCTFDGCDLSLAELNGSTFSHVQLNDTKAVGIDWTRASWKPIGFLESAISHSTFIGLSLREIQIRDCIAADVDFREADLSPADFSGTDLTDSLFLLTDLRQADLSRARNYRIDPGQNKISRAEFSLPEAISLLYSMDIEIKD. 197
210 8.000e-53UniRef50_A0A1G0PI23 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium GWB2_35_6b TaxID=1798424 RepID=A0A1G0PI23_9BACT  ali  22  4...............................LAEDYYDKVVFEKEDFSKQKIISTSFEECSFINCDLQGTILTDCLLSTCEFKNCNMSLVSLKNSRIQNVSFTGCKLMGVNFKEAHITKFKFINCLISNCNFSNMEIKNTSFTNSRVENCDFFQTNLTSSDFTESALVGSIFENTNLTKADFTFAKEYRINPATNKLKDAKFSLPEALSFFDYFGIKIE.. 193
211 8.000e-53UniRef50_UPI0008F7FF7F hypothetical protein n=1 Tax=Traorella massiliensis TaxID=1903263 RepID=UPI0008F7FF7F  ali  37  36...................................................FEFIKIDECLFKNVIFKGSSIIKSDFMDVIFENCDCSNMKFSNSSFHRVIFKSCRMIGCDFTDTYLSDVQFLSTRAQFINFSGSKIKNSRFIECDFRESRYVETDFNKCELDHCNFTQSEFIHTSLKDLDFSTSEIASITLTAESIPGIIVSSFQAVELSKLLGIVIKDE 205
212 8.000e-53UniRef50_UPI0009F8127A pentapeptide repeat-containing protein n=1 Tax=Blautia sp. Marseille-P3201T TaxID=1907659 RepID=UPI0009F8127A  ali  21  2...SKRELKPPVIPKELVLVGDARSILEESAEQEYEIVNRLFENIFLTKIHAVHLEFKQTVFKGCRFIGCDFSETSFVNVQFVDCDFSNSNLSDTYFKCCSFHKCKAVGADFYGSRINHVTFFECNFCETGFDATHISFVKMENADFTDAGFSKSRFANLEINQVCFRKASFFKTSLKNVDFSTCNIEEITISDEELRGIKVNMIQAVDLVKRLGIVVKE. 220
213 9.000e-53UniRef50_A0A2E2TMK7 Uncharacterized protein n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E2TMK7_9GAMM  ali  22  11................................DNNEFLECRLTDINAASLTLKKMVFEHCEFEKVNFADAILQHCKFIDCGFTDCNWSNVKLAYSSFNNVEFSQCKLVGINWTEATWPQITLSGCDLSLSSFFGLQLDEMMLQTCKLHDVDFRDSHLKYANFSGSDLLGSLFQSSHLEYADFCEAYNYHISPMKNNIKKAKFTLPDAINLLNDFEIEI... 202
214 9.000e-53UniRef50_A0A1L4C0U5 Uncharacterized protein n=5 Tax=Marinilactibacillus TaxID=191769 RepID=A0A1L4C0U5_9LACT  ali  26  2.........KKKVIDPNISSNLLEKDFYSMDEEDPIIENAIIKDCTISIDSIRNVEFKNLVFKNIIFDYFSVPNAYLKDVKFDHCQCINAEINESALKRVEFHQCRMNGASFGDSFLEDVQFKNCMMDLAGFAYSKHKNVLFSSTQLKESDFYENAFKNIYFDQCEMSGIRFSNTSLEGVDLRTSNFERMIVDTENIKGAIVTQDQALGFLQLLGLVVKD. 213
215 9.000e-53UniRef50_A0A0G0EE40 Pentapeptide repeat protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0G0EE40_9BACT  ali  22  5....................................LENKTFQSEDWSERKLSSFEFSNCNFSNCDFTQADLSDAKFVDCIFERCNLSNVKVANCIFNNVKFKECKIVGVIFSSLNLLSWGFDGSVINLCNFGNLDIKKTKFTQCSIGESDFFDCDLSEVDFSNSDLQLTRFQNVDLRKSNFVGAINYSIDPMINKIAKAKFSSAGVVSLLKAFDIFIE.. 189
216 9.000e-53UniRef50_A0A1J4ZZ77 Uncharacterized protein n=2 Tax=Anaerolineae TaxID=292625 RepID=A0A1J4ZZ77_9CHLR  ali  23  12......................................DRRFDRLELPGETVTSREFIACAFVDCRFPETTFDTCRFVDCTFRGCDLSMARVPNCAFTETVFENCRLAGVNWAEAAWRKIRFQGCALNHGTFIGLSLPELKVIDCATRDVDFREADLSRASFSGTDLAESLFQHTNLTGADLSRARNYAINPALNTLTGARFALPEAMALLYSMDIELVE. 199
217 9.000e-53UniRef50_A0A078MAF3 Pentapeptide repeats (8 copies) n=7 Tax=Staphylococcaceae TaxID=90964 RepID=A0A078MAF3_9STAP  ali  29  1..........MKLKPLKIASELEVVSYESIIEDEDQFDGIEINDAEFLDTDFGRLISYNSVIKNSNLSNNEFDNADLTDTRFVNCDFSNTVFLGASIHNVEFVNCKMIGVSFDESRIKNVKFFESLLNLSGISESKLENVLFENTRMVTADFFNNKFKNIGFENCDLTEARFVDTPLKGIDISSSHFESLSIKREDLEGCIVSSVQAIQMAALMGLVVKD. 211
218 1.000e-52UniRef50_Q6AKE9 Related to McbG protein n=3 Tax=Desulfotalea TaxID=109168 RepID=Q6AKE9_DESPS  ali  19  13..............................ILNIDLIADEIFSEIELQNTKLTEVEFSDCTFINCKFSKVIFFACRFENCSFKNCDLSSILIKHSVFAGVTFEESKLTGIQWADTGILNIKFRQCLLNYCSFIGVDLRKTEMTNCMVKEADFAETNLSKSNCRYSDFTGSRFVNTNLEYTDFSYASNYSIHPDGNKLKKTVFSLPDVLSLLDVYDIVIK.. 203
219 1.000e-52UniRef50_A0A2E6H1M1 Antibiotic transporter n=1 Tax=Halobacteriovorax sp. TaxID=2020862 RepID=A0A2E6H1M1_9PROT  ali  24  2..................................EYIEDQTLTEL---PAQLSEVEFTEVIFKNIDFKESYITGCLFIDCKFENCNLSNSKFPGCTFRDTSFKSSRVSGINWTEANLVSFNFDDCQINYSVFLGMNLDNFKCINSQAKGCDFSECSLKNADFSKTDLSETSFHHANLEKASFSDAKQYYIDPSVTKLKDAVFSYPEALSLLNSFKIKIDN. 185
220 1.000e-52UniRef50_A0A1L8PF77 Uncharacterized protein n=3 Tax=Alkalibacterium TaxID=99906 RepID=A0A1L8PF77_9LACT  ali  28  3...........KRVEPQVPKHLDNQTFDESDVDEPYVEYVEISNCVVPLYEIKRLEFKTVRFINVQFESINLEEGYFRDVIFEKCEFVNAVFSHAIFKKVTFKECRLNGSLFNDSKLEHVLFEDCVMDLSTFGFSSLKMCEFVHSKLNEADFLETKWTDILFKSCLLNGSRFSRTSLKGIDISTSTFDSLSVELDALKGAIVSQSQSLDFLDLLGLEIRD. 212
221 1.000e-52UniRef50_UPI00036558B1 pentapeptide repeat-containing protein n=1 Tax=Paenibacillus daejeonensis TaxID=135193 RepID=UPI00036558B1  ali  24  2..........TKHDKPRLPDQLTAAELVERLNEDGYVDKGSISHERLEARLQGKMTIDSFHFRHVDATAYRVDESEWVDVIFEHCDLSNLDLSNAIMHRVLFRDCKLMGLELSEATLRQVSFENCDMRYMNMRYADLKRVSFDQCAMMNADAYQASFQEVSITRSNVDQIQLTGVKLAGLDLSSCEFDAIDAEPGDLRGCKISPAQAIAFAPLLGLIVD.. 213
222 1.000e-52UniRef50_A0A1I2I488 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1I2I488_9MICO  ali  21  9...............PDKDGEIRHVDFGGQALDGVRYEDVTFVRCDLSEVTTSGAFFSGCTFVDCRFNASTHTSTAFTGCTFR----------GGNFFDTTFTGCKLVGSTFLRCEYGLVTIAGGDWSFVTLAGADLRKAQITGVRMREADLTGAQMQEAVLQGVDLSGAALARVDLTGADLRGSDVGTLDPLSAHLARAVIDPAQAVVLAEAMGLVV... 201
223 1.000e-52UniRef50_A0A2N2N3Y1 Uncharacterized protein n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2N2N3Y1_9CHLR  ali  21  7................................SETEYNRVDYKNLEIKESKMQMKEFTSCTFFKCNFTGTIFQRCSFRHCNFQNCDLSLTNLKDSSFINTRFEDCKLAGINWTQSEWKPADFIGCVLNYSSFMGLNLEKILMTHCIAHDVSFEDANLSYVDCTCTDFENSRFAHTNLTSTDMRGAKNYNIDPILNTLKKTKFSMPDAMSLLYNLPIILED. 201
224 1.000e-52UniRef50_A0A1E4LND7 Uncharacterized protein n=1 Tax=Clostridium sp. SCN 57-10 TaxID=1660094 RepID=A0A1E4LND7_9CLOT  ali  28  13..............EPSLPSELTLVEDLAALDDGAFLEGLHLRGLTLTPDALAGMDFDGVLLERCTLTESAWNKAAFLNTVFRDCECSGGNFSGSWFTRCVFERCKGVGANFTETRLRDVLLRGCRFRYANFTSSQLDCCTAEDTDLSEAFFAECKLTACRMRDATLTRAEFFRTPLRGLDLRACNIDGICVSTEELAGAVVTYDQAASLARLLGVEIRD. 225
225 1.000e-52UniRef50_A0A0U4GA92 Uncharacterized protein n=13 Tax=Bacillales TaxID=1385 RepID=A0A0U4GA92_9BACI  ali  26  2......KKKNRLIQKPDLPDQL-APIKINKLTDQSFYEMGTV-NEGIGPVHVEDVQFEQIHFKDVTFTDTELPFSQWLDIIFDHCDLSGSQLNDARFSRVEFRNCKLAGTDFDRAVMHDVTWTDCQAPYVLCSLTELRDVQFENCLLKGANFIDASQNNLQLGNSDIEDVQFTGTSLENVDLSRCRFTHLHIEEADLRGVVIAPEQAAGFIEVFGVKVKD. 213
226 1.000e-52UniRef50_A0A024QH13 Pentapeptide repeats (8 copies) n=3 Tax=Virgibacillus TaxID=84406 RepID=A0A024QH13_9BACI  ali  29  46....................................................EHVRFEEVYLKKVTLSQSRLSFSRWTDVIFNGCDLSNVDFQDAYFNRVAFHNCKLAGADFDQANFQDVQFIECEAPYCLFNQTLLRDMAFRQCLLKGANFMEVQFDNVQFGYSVIQDVTFTGSSLASIDLSNCQFRTIHLTGEELRGAIISAEQAVSFIELFGVQVKYD 214
227 2.000e-52UniRef50_UPI000463F244 pentapeptide repeat-containing protein n=1 Tax=Nocardia sp. BMG51109 TaxID=1056816 RepID=UPI000463F244  ali  11  88.PSGSDLRAADLCEANLIGARLAGCYLRKANLYSADLSGANLFSSDLSQADLTSADLSRADLTNASLAGARLAGTDLSWARLTGVNMSTAILGRADLTGADLSGAILSGADFSGADLSGAILAGAHLSRVHMHGTNLAGAILHRANLHRAYLHRANLSRADLRDADLRDAVLTRAILIDTDLTGADLGDVD.............................. 282
228 2.000e-52UniRef50_W4LNZ3 Uncharacterized protein n=2 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4LNZ3_9BACT  ali  16  35............IGVNLRGRDLGGYNLANADFSRANLEKVRFNRTNLSGANLSGADLTGAHLIQADLSHAKLIGARLRDANLVGANLSGANLAGADLTAARLTRVNLINTDLTAVTMTKVRMIGSELWGVDLSGVSLVGANLAGANLVGANLSGADLSGANLSGANLRSVNLTGASLVQARLRGSNLVRATLMQAQLSGVNLTKADLSG-ADLSQAILS.. 252
229 2.000e-52UniRef50_A0A2V2G6J2 Pentapeptide repeat-containing protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2G6J2_9FIRM  ali  27  20..........................LSAERDDREFMECESFSGEEISGADASGMEFKNVVFENCGFCDCIFKGASFYDCTFKNCTVKMCDFQNVYLRGVKISDSVLESCSFAGCHIKESHFKESSLRYGNFHSGVIERTEFADCSFKEASLAEMRLTRPVFSGCDFTGADFFKTPLKGIDFSDCDITAVALSETELKGAKVSAQQAVEIARLIGVKI... 213
230 2.000e-52UniRef50_A0A081C327 Pentapeptide repeat protein n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A081C327_9BACT  ali  21  8..............................NYPEEEYRAQTFEQLTIQAEQITHKTLDECVFQECTFQETRFHGCRFLHCTFKHCDFQLISVKDCTFMNARFEDSRVIGVNWIEASLNSLHFVRCVLNHSTFMGLPLKKATFQACLAKDVDFTEANLTQADCTNTDFSQSRFFHTNLTQADFSRARNYAIAAHLNTLKKTKFSLPDAMALLYSLDIMLNE. 203
231 2.000e-52UniRef50_A0A2K2TMR9 Pentapeptide repeat-containing protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2K2TMR9_9CLOT  ali  29  39..........................................TKLDVQGEVFDTICISKVKFENCLFLDCSFKKGEFTDVIFQSCNFSNCDFSDSYFNRCRFIGSKGMGAKFCGNSIQNLTVKDCNFSYANFDSSKLEKIRFEDSELRGAGLSQCRCKMVYWSRVRLSEASFFKTSMQKMDFTTCDIAGISISDDELKGAVVDLYQAAELAKRLGLVIK.. 217
232 2.000e-52UniRef50_W1RPB2 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=W1RPB2_9GAMM  ali  22  2...........................SNTILNGESFDGITFTDLSNIQDTISRKVFESCVFESCDFTEAFFDACTFKDCRFVKCKLTAINVRNSKFSDVQFYDSKVLGVDWTKAYWRGLDFKACLVNASSFYGLKQPGITFEDCRAHDVDFREATLSRAKFSGTDLTNSLFVNTNLTGADFNGATHYDIDVKKNTIKNAIFCRYEAVSLLTSLGIKL... 198
233 2.000e-52UniRef50_A0A081K814 Uncharacterized protein n=2 Tax=Oceanospirillales TaxID=135619 RepID=A0A081K814_9GAMM  ali  21  2...........................SNLIESSAEYLSITFSDGDFAHGKFQDIEFDACTFVNCDFSETVFEKCRFIDCEFEKCNLSLVKLNHSRFSDVVFKNSKIIGVDWTKVAWPNISFFQCIINDSSFFGLSLTEITLEECKAHEVDFREGDFRDGVFDYTDLTNSLFSNTNLSSASFAESTNYDIDINVNKIKNAKFTRHEAIRLLASLDIELLD. 200
234 2.000e-52UniRef50_UPI000DCAD6D3 pentapeptide repeat-containing protein n=1 Tax=Clostridiaceae bacterium 14S0207 TaxID=2082193 RepID=UPI000DCAD6D3  ali  21  3.............................EILRGNEYEEIIFSKLIVLNKNLTETNFLECNFKNCDFSGVDFSKCAFVECNFQNCNLSLIRCDDSKFRGVQFNNCKIVGVNFNKCDIIEMSFQESLIESCNFSNMKLKKTPFKQCDIFESDFIYTDLSECNFSYSNLKGSVFSKSNLSKANFSEAKQYNINLLDNTHNKAIFTMPEASSLLNNFNIKIKE. 195
235 2.000e-52UniRef50_R7A120 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=R7A120_9CLOT  ali  28  1....MSIVKPQKI---LFKELRKINNLVEEFKETDEIENITIENYRNNTVELINITIRKAIINNAEITDSNFDKNTFIDVEFNNCNFSNTAFNNCSFIRCEFNNCKLTGCNFIENGLSDVSFLTCNMVYVNFAMASIKNVLFKDTILRNSNFQENAIKNLVFKEADLTQTQFFKTKLSNIDLSESIIDGIAISTEDIKGAIINEFQAIDLIGLLGVKI... 211
236 2.000e-52UniRef50_E7G9L7 Uncharacterized protein n=4 Tax=Erysipelotrichaceae TaxID=128827 RepID=E7G9L7_9FIRM  ali  32  19................................DEELVQFMQFENETLTNRQEQGKEFKNCYFENIVCEDVNFENSYFMDIIFKNCDLSNVKFYSCLFRRVEFVNCKLMGTDFSESVYDNVSIKDCLCRFANFAFMKNKEVQFINCDFQNASIIETNLKKTVFQECAFHQCEVQHSSFYNIDLSNCDLSNIITTPEDIRGAIIESYQASSLIHLLRVKVKE. 206
237 3.000e-52UniRef50_B4SGS9 Pentapeptide repeat protein n=2 Tax=Chlorobiaceae TaxID=191412 RepID=B4SGS9_PELPB  ali  16  27....................NLKGADLSGAQLNKADLSRTDLVGANLRGADLSGAQLNMADLNRADLNGAHLYNANFGKANLIKTNLSKANLSGATLWDANLSGADLSGAQLICAILTNATLTGANLTEACLNSADLTRANLIGGDFTRASFSGATLDEVQLAGADLTMAFLGQAKLYRSDLSGANLCGAKLNRATLIEANLSK------ADMHGVII... 218
238 3.000e-52UniRef50_UPI000690E922 pentapeptide repeat-containing protein n=1 Tax=[Leptolyngbya] sp. JSC-1 TaxID=1487953 RepID=UPI000690E922  ali  15  15.........SVHKNANLAGRDLSGLDLHDIELPLARLMKANCSQTNLQGANLEQAMLSASKLEEANLREANLKQADLEKANLTAAKLNRAQLAYAILDDAILKNADLTGADLSEASCQRTNFSGANLEQTNLNQADLTGAIFKDVKLNGADLSGVELQQADFSNTDLSNVNLNEAKLQNANFVGANLTKATLTKADLTGADLSNATLIG-ADLTNAILID. 224
239 3.000e-52UniRef50_A0A0A6UT32 Uncharacterized protein n=3 Tax=Actinoplanes TaxID=1865 RepID=A0A0A6UT32_ACTUT  ali  21  1.......MRDDSPARPILPDALEDALP--GLESDDLHEKRTFDNADLIGVFAQTVEFTQCRFRAARLAGAVLPKVRLTDCLVERSDWSNVRAENGSMERLAVSGSRMTGLAWSGGMLRDVTFADCKLDLTNWRFARFAAVTLTGCNLTGADFTNADLRKATFVDCDLSGAQFSNASMRGARFQRCELAGIG-GITSWEGAIVHPDDLLGLAGALGIIVEN. 214
240 4.000e-52UniRef50_A0A075BS44 Uncharacterized protein n=2 Tax=Microcystis phage MaMV-DC TaxID=1357715 RepID=A0A075BS44_9CAUD  ali  13  128ILSGADLRGAILSEADLSEADLRGANLREAKLREAFLSGAKLSGANLNRANLSEAILNRANLSEAILSGANLREAILRGAKLSGAILGGAILSGADLSGAILSGADLSGAILSGADLRGVKLSGADLSGTDLSGVNLSGANLSGVKLSRVNLSGANLSGVNLSGADVENAIFE................................................ 300
241 4.000e-52UniRef50_A0A1I0RFQ5 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=[Clostridium] fimetarium TaxID=99656 RepID=A0A1I0RFQ5_9FIRM :  ali  27  1..........MKIIKPNIPKVLVDVESISFREEDIDIEKIIVKENYCEKVDFYKISMNGTVLENCKFINCDFEKSSFVDVIFIKCDFSNSNFQNSYFNKCEFISCKCLGIDMYNSSLKHVLISDSNFQYTNLNRANFNGVMVSDSDLSNANISECTQKNFEVVNAQFLNTSFFKTMLKGIDFTNSQIGAVALSDSELKGVIINEYQASDIVKLLGVVVR.. 216
242 4.000e-52UniRef50_A0A0S2VZ91 Quinolone resistance protein n=4 Tax=Clostridiales TaxID=186802 RepID=A0A0S2VZ91_9FIRM  ali  22  1....MAQSEPIHTKFPQ-PVEDFPTLARTAREEDEELSGLLIRDLQLEREDLSGLVLQDVVFDHCRLPDCDWFGTSFSDVTFHTCDLSGGNFENSYWLRFACHETKVLGIRLQNCRMRHGLLEQGRFSAANWNQSRLREVRFSSSALTGSFFSRCIFTGVEFQQCDLSQVNFFHTPLEHVDLTTCTIDVLVLSEDELKGAVVDLYQAAELSRRMGLVVK.. 216
243 5.000e-52UniRef50_R6BI94 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:533 TaxID=1262818 RepID=R6BI94_9CLOT  ali  30  1..........MKIKEPKLRKELYKEMPEGMEFSDTYFEEFPFGEV-------KDATFDGCVFNRIDFSNVNLEDVSLTDCRFDNCDLSNKCFDKMFITRCEFINSKMVGTSFIGAVLKDVKFSLVKGDYINFSGARLSNVLFEEANLSYGYFSESVMKNVYFDKSNLTNVMFYKVSHDDLDLSNSTLDGIIIDASFLRGVIINTFQAADLISFFGVSVR.. 202
244 6.000e-52UniRef50_A0A1F9VQE4 Uncharacterized protein n=14 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9VQE4_9BACT  ali  24  16......................................ERVFDKLQLKGAKLESKTFYACVFRNCDFTGASFRFCKFRDCRFESCNLSLAKVGASVFDGVSFKDSKLTGVNWTEAEWPKLTFQNCVLSDCSFLGLPLAGAAIKDCLAKEADFRETILSKADLAGTDFAGALFGATDLCAANLAGARNYAINLKENKVKDARFSLPEAMDLLYCLDIKI... 201
245 7.000e-52UniRef50_A0A0V7ZWN3 Uncharacterized protein n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A0V7ZWN3_9CYAN  ali  17  802...........................................GQYLSYADLRFVYLSSVDLRGVYLSGADLSSANLRRAYLSSADLTNIDLSNSDLSGANLVGANLVGANLIGANLVGANLIGANLSCANLVGAKLNSVDLSRANLMDADLSSANLSSANLIRTNFSRANLSIANLISVNLNSANLSSANLVSANLSRANLSSANLSS-ANLSRAKLIN. 977
246 7.000e-52UniRef50_A0A0Q9XQH0 Uncharacterized protein n=50 Tax=Bacilli TaxID=91061 RepID=A0A0Q9XQH0_9STAP  ali  27  1..........MKIQQPKISVNLELKELEEIFQDEEDIVEAKIQNANLSNKVLERFVVYGSYIKDCDFSNSDLGRADFTDVIFENCDFSNTKMDHGSIHRVIFKSCRMTGTLFNYMRFGNIVFDEVKADFISVVDSKIEALMTQKSNFENAEFHNSNLKKVVFDNSNLEHLSIYQTSLKDCDLSQSYFESFVVNKEDLYGCKVSRNQAVQFAALMGLVIVD. 211
247 8.000e-52UniRef50_UPI0002FBCDEE hypothetical protein n=1 Tax=Fischerella muscicola TaxID=92938 RepID=UPI0002FBCDEE  ali  13  83...RVNFAESRLIKADLSNSSLVEVDFSEADLSTANFQQADLTRANLSNANLSGANLSGANLSGANLSGANLSGANLSGANLSEVYLSEANLSRADLRQANLSGARLARLNLSEANLCEANLEGVDLSEARLVRANLSRVNLYEAGLIGTNLTEANLCEARLVKANLTASQLVGTNFEGANLSNCLIYGISAWNLKLHG...................... 298
248 8.000e-52UniRef50_K2G575 Antibiotic resistance protein McbG n=2 Tax=groundwater metagenome TaxID=717931 RepID=K2G575_9ZZZZ  ali  23  8....................................YEDESFQNIQLQAQDLSGRDFSGCTFKKCDFSWSDFMWSIFSDCRFEDCNLSNIKVSSCSLQDVSFRNCKLTWVIFSKINLISWDFNNCKIELCSFAWLDIKWSRFAWSVIRETDFSDCNLTGSDFTECNLQSSKFQNTNLTECDFTEAFDYYIDPTQNQIQKARFSGNQVLNLLACFEIEV... 191
249 8.000e-52UniRef50_UPI000DC7A3FD pentapeptide repeat-containing protein n=1 Tax=Blautia sp. N6H1-15 TaxID=1912897 RepID=UPI000DC7A3FD  ali  25  9MKMSKRGFKEPSVPKTLFPVHDGLALLQEAKAQETEIVRREISGIYLTRFDGSGLSFQQTVFQNCRFMGCNFNETFFKDVKFINCDFYQSGFSDAGFKNCAFLSCKGDGADFYGSSMYHVSFQDCVMKEALFDAGKMSYVKGSHTDFSKSGFSKCKMSNMDWNRVSFREANFFKTVLKGIDFTTCGIEGIVLSEGKLEGMVVNTLQALDFAKSLGIVIQSE 231
250 9.000e-52UniRef50_A0A1B9EVS7 Secreted effector protein pipB2 n=479 Tax=Actinobacteria TaxID=201174 RepID=A0A1B9EVS7_9ACTN  ali  21  4MAVSGRKKSGTGVTAARRPEVRLPPLDGDGLEPDGDYDGVRFDGVDLTDASGRGARFMDCALDGCALDRAELARARFIDAVLTGVRGVGTDLAEASLRDVEVVDARLGGVQLHGAVLERVVVRGGKIDYLNLREARLKDVVFEGCVLAEPDFGGAYLVRVEFRDCVLKRADFSGARMESVDLRAVAELDIARGVDRLAGAVISPAQLMELAPAFGVRVE.. 229
251 1.000e-51UniRef50_F0YXP1 Putative quinolone resistance protein n=12 Tax=Clostridiales TaxID=186802 RepID=F0YXP1_9CLOT  ali  28  14.............................ARQDEMPVENRNYKDETVTGADIHKVEFMAVTFERCRFVDCDFSGAGFYRTQMEKCDFSNCIFSGSYWKDSKIIECKGNGSRFDHAVLKKTCFLDTQLNMANFGQSLWEGCTAEMCGFREAFFSEVKLKKTGFSKCDFTKVDFFRTLLKGIDFSDSTIESIMVSDREVSGMKINMFQAVEMAKLLGVKI... 204
252 1.000e-51UniRef50_UPI00096AA417 hypothetical protein n=1 Tax=Merdibacter massiliensis TaxID=1871030 RepID=UPI00096AA417  ali  28  2.......TQKTKNIRSLRCTSNEEKSLISAMQEDIYQYDAYFQNEEIIAPTYDHYHFSGCRFQDITCSIDDFFENEYLDCIFTHCDLSAADLQRSHFYRCHFENCRLTGTRFYDCVWKDVTWNNCMCQYANFGGSHFERCAFTRCTIKEGGFIQCQQKSLAFQQCDLQSCSFVNTSLKEVHLENNKIDGLLVNEDSLKGVYVSPQQAILLASLLGIHIVEE 215
253 2.000e-51UniRef50_A0A2N2E5R0 Pentapeptide repeat-containing protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-12 TaxID=2013773 RepID=A0A2N2E5R0_9FIRM  ali  23  3........KKRRIISLKIKNESENEDFSRQSFAEQEIIGVEFTKCNFDYTDLNEISTNACLFKECGFTQTSFNGSSHNKSAFLNC-----RFIGSNLFKASFENCKMTGSTFETVNLLGINILEGDWSYVNLRNSDLKGINFNKARLTEIDLSGSNLDKADLRDADLTRAILSKTSLSGANLRGAKVEGIDFKNVSIRGAKIDIFQAILIAESYGGKVE.. 210
254 2.000e-51UniRef50_A0A037ZA44 Uncharacterized protein n=5 Tax=Clostridia TaxID=186801 RepID=A0A037ZA44_CLOTT  ali  28  8..........IRVLKPRIPNELANFEHLESILDYDSVSTVIINKCHLENLNARKVSFKEIIFNNVVFRNVSFECSEFMDIRFENCDLSNVNFIESSIHRVEFVNCKLIGINLSESTIRNVIFNQCNGQYAFFRFVDFKQVLFSDCQLPFADFQESEFSKVEFKNTDMTQSQMYGTKLKGMDFCSCNIDGMGARIEDVK....................... 196
255 2.000e-51UniRef50_A0A1C5RCT3 E3 ubiquitin-protein ligase SopA n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1C5RCT3_9CLOT  ali  28  1..........MKLIEPKLSYIEKTT--FDECLKEMKFQDIHIDENYEREINLDHLTFDGCLFENIDFNIIQLNHIDLIDVTFDKCDLSNQNFDHQYLNRVQFKNCKLTGTTFIETNLKDVLFENCQGRYSNYASSSLQNVYFKHTDLQEASFYDTHCKKIELKDTSLIRCELTSLHHKGLDVSSCQIQGALFDLQSLKNLVINDFQAVDLIGILGVKVK.. 207
256 2.000e-51UniRef50_A0A2G9N8U1 MCBG-like protein n=1 Tax=Candidatus Woesearchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_32_24 TaxID=1974457 RepID=A0A2G9N8U1_9  ali  25  70....................................IEKGTFENKNFSNHPLASKEYINCMFNNIIFSGANLTNCIFVDCTFNMCNFSNTDIDHCGFQEVSFIGCKLLSLSFYKVRLFSVNFNDCMIMNCDFHGFKMPKTEFLRCRIIENYFTNTNFSSSKFSESDLNKTIFKNSNLSKVDFRNAINYSIDPRMNHIEGAIFSNPDVIGLLDYFDIKIE.. 254
257 3.000e-51UniRef50_A0A2D5US33 Uncharacterized protein n=1 Tax=Dehalococcoidales bacterium TaxID=2026733 RepID=A0A2D5US33_9CHLR  ali  19  58..................................ETYYQEKLVKLSINGEDIQSRVFEDCEFDNCSFGGSRFEKCRFLNCKFVECDVSNIIPMNCEFREVGFIKCKAIGIDWTKTQIIKLSFSECLLNYSNFRLLKLPEITMVKCEAKEVDFIEADLTGGDFKNTDFNQSVFFKTNLTKVNFSRATNYSIDIKTSTVTNARFSLPEAMSLLYNFDIXIE.. 243
258 3.000e-51UniRef50_A0A2K9IZB2 Pentapeptide repeats (8 copies) n=3 Tax=Virgibacillus TaxID=84406 RepID=A0A2K9IZB2_VIRPA  ali  27  2......KPKQRLIQKPDLPEELLIRSL-NELTDNSFIEMAKYDHTS-SSFTASHVGFEDVFFTNVNMPQSKFPFSSWTNVLFDTCDLSQIDFQGTRFRRVEFRNCKLAGGNFSQTDMQDVRFTACEAPYTLFENAILRDGELIECLLKGSQFINTNLEYVQLDNVVLDDVSFAFTSLKGMDLRSCSFTNIHLSEKELRGAIISPEQAISFIHLFGVTVK.. 212
259 3.000e-51UniRef50_A0A1Y3XLX5 Uncharacterized protein n=20 Tax=Coriobacteriales TaxID=84999 RepID=A0A1Y3XLX5_9ACTN  ali  25  30...............................EGDATISMTAFEGLELADVRANGATFDQVIFRSCQFEGVDFSNCSLADVRFVGCRFIACTMERSWLNRCDFEGCSAPGLSFQKGRLTSVCFDESQLRYADFSEAAASVLAARKTALAESAWHRARLKHVLLDGCDLSRADMFGTSLEGIDLSTCDISGIVVSSTELRGCTVSPTQAAELVTLLGVRVSDE 221
260 3.000e-51UniRef50_A0A2E8X3H9 Uncharacterized protein n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8X3H9_9CHLR  ali  19  4..............................IKNDIDYETEIFFQMEIVGQKISNSSFDHCNFSGCDFSESEFIACRFIECEFKDCNFNVTKLTGSRLLESRFENCKLTGINWTSLSWTGITFESCDLSFSVFHSLSLPGLIITNGKAWNADFEDCDLTHAKFTNTDLKDARFNRTKLNMCDFSEATNYYIDPNSNSMVGASFSFPEVINLLAAFDINVK.. 198
261 3.000e-51UniRef50_C0DB47 Pentapeptide repeat protein n=3 Tax=Clostridiales TaxID=186802 RepID=C0DB47_9FIRM  ali  27  25..........................LLDCVREEECVRDLRFNGLAAGEESLRLLAAVQCLFVNCSFQSCSFEQSSFVDTVFQSCDFSNCDFSDSFFNRCEFRNCKGLGTKFAGSTVKNLTLAGCAMDFANFDACRLERVCVSDSRLKGAVFSQCRAKDVYWDRVDLTGASFFKTPLRGMDFTTSQIGSLVLSDEELRGLTVDLYQAAELSKRLGLMIK.. 219
262 4.000e-51UniRef50_A0A1M4SHW4 Uncharacterized protein YjbI, contains pentapeptide repeats n=1 Tax=Lactonifactor longoviformis DSM 17459 TaxID=1122155 RepID=A0A  ali  24  1..........MRLNPPCLPEMLEGTDFKNAKEEETDILEKSIADVWEEEEDFSRISFAKVVFKNCHFMNCLFERTSFLDVIFLNCDFSNSNFTDAYFHRCRIIGGKWMGVNLHHSVLKHTEITDGNFKLSNLDSCRFDHVSICETSMEHGNITACKMKDIQVLRTDFTLASFFKTPLKGIDFTECTIDRITVSEEELKGVIINPYQAVELAKLLGVIIK.. 217
263 4.000e-51UniRef50_K6VPC5 Uncharacterized protein n=2 Tax=Kineosphaera TaxID=211469 RepID=K6VPC5_9MICO  ali  22  24................................DRDYLVEETLEGELPEGATVTGVEFEGCTFEACRLAQARFVRCTFTDCRFSGCDLSMLTLTDSRLIGGVFEHCKMLAINFASLGVSPVRFEECRLQFAAFAGVALPAATWRDCDLRETDFTNAVLTAASFAGSDLRGATFSNTDLRDASLIDANGYAFDVRDNRVRGLRVDAGEGARLLEVLGLTIE.. 215
264 4.000e-51UniRef50_UPI0008392881 pentapeptide repeat-containing protein n=1 Tax=Piscicoccus intestinalis TaxID=746033 RepID=UPI0008392881  ali  21  3..................RAESSDELSIDQVRDGDVVTGRLVTGSLARGRTLADVEFDDCEFTGCELEGARLVRCTFTECRFTACNLSMTDLVDSRFSDVVVARCKGLALNLASLVADPLRFEDCRLDLACLQEADLTGARFIRCSLREADLSGALLRDADLTGSDLAGATFVRTDLRGADLRGAFGYAFDPRENRVRGLRVDPEGAAALLRVFGVEID.. 208
265 4.000e-51UniRef50_D3D690 Pentapeptide repeat protein n=13 Tax=Actinobacteria TaxID=201174 RepID=D3D690_9ACTN  ali  20  6.PSRVPRASERRPAAPAVPSSLTATD--SAITDDGVYTNFLFDGSDLADQRAEAVEIDTCRLTGVDLSGTRLTRAMVTNTVIERSNLSNLRAMNSSLIRVAVTTNRMTGVAWTNGRLRDVIFRDCRLDLTRFRSTTAANVLFEGCNLKQADFQDADLRGATFEDCDLTGAQFSGAKMDGARLLDCVLVGVN-GVTSMAGAGVAGRDAYSLAGALGITVLDE 227
266 5.000e-51UniRef50_UPI00077486FD hypothetical protein n=2 Tax=Herbidospora TaxID=28443 RepID=UPI00077486FD  ali  21  1..........MPRELRDLPYADYLEPLTGELGREGDYDGVHLRDVTFDGVDTVGARFMETVFQQVTLNDSRMDRSRYNDVWFHTVRWIGVNLAETDWFDAEIISSAMSGVPMFGSRVHQVTFHNCKLDSVNLRSATLRNVTFEDCLLREVDFAGATLKEVRFPGSELEDVRFDKAQLTKVDFREARSMGIADGLESLKGATISTRQLLDLAHALGISVRD. 214
267 6.000e-51UniRef50_A0A0Q0TP27 Uncharacterized protein n=5 Tax=Pediococcus pentosaceus TaxID=1255 RepID=A0A0Q0TP27_PEDPE  ali  27  1.......MQKPKIVIDNLPEE----SFFEIYKDEDRLINHQIRNQNAEKQFLERGIIEQSYFEHVKFNQSDFYRLELTDSIFVGCDFSNCKMEEAVFYRCEFRNCKMLGINLNGAIFNNVLLDGTNMQLAALNQMKVKDTMFNACNLKDSSFAENKLQGAVFEHCEIDQMSFYDTSLKHVNLSTCFFEKIDVEERLIRGMQVNATQAAQIAQLLGLRVE.. 211
268 7.000e-51UniRef50_A0A2T1EGZ0 Uncharacterized protein n=1 Tax=Chlorogloea sp. CCALA 695 TaxID=2107693 RepID=A0A2T1EGZ0_9CHRO  ali  15  58..PGCNLAGADLSNANLKKANLQGADLRAANLSEANLSEVDLTQADLRQANLSKTNLKGAKLTRANLRQADLSKANLITAYLRGADLSEANLSEAYLHATDLNQAILIKANLSKADLAGVKLSNADLTNANLQGANLLGVNLSEANLSNANMQYANLQRATLNKANLNKANLISAKLNGANLSGANLSGANLLTAILSNAELSTANMLHSAELSKANLSN. 297
269 8.000e-51UniRef50_UPI0005C65FC9 hypothetical protein n=1 Tax=Lyngbya confervoides TaxID=207921 RepID=UPI0005C65FC9  ali  16  75..SGTNLSQANLNVANLIQAILVGANLTGASLIRSELLRADLSNTNLTQANLQEADLREVRLRWSNLTRANLSRSNLRKSSLIGANLSHVQAHSVNLEGADLNNAIMIGLNLRTANLSGANLRGANLRWANLTGANLKDADLTDAKLSGADLTGAQLEGATLENTILVHADLSRANLRGADLSGATITGI-----QMQGAIV................... 284
270 8.000e-51UniRef50_R6IV04 Uncharacterized protein n=2 Tax=Azospirillum TaxID=191 RepID=R6IV04_9PROT  ali  23  2......................LKTLFENARNDDGYIDNRNFEDETADGLDISGCDFENVLFRRCKFSHCNFERASFGNTTFDGCDFANCNFENSYWKKAGISDSKGDGGNFSGSRFKECVWKDSSFCYANFSRAVFEGTHVRRCKFREAFLSEVKFRLTLFKETDFYRADFFKTPLKGMDMSDCILDGILVSETELRGMKGGIEQALSLAGLLGMEIK.. 200
271 8.000e-51UniRef50_G8X5G2 Uncharacterized protein n=26 Tax=Flavobacteriia TaxID=117743 RepID=G8X5G2_FLACA  ali  23  3..................................DFIYDQNFNQVVYNQYELTNKEFENCTFTGCNFTQAFFTGTMFVDCTFKNCNFKEAKIGHVGLRNVLFVDSDFTNVNFAMTDIYEFHFTNCLLDYAQFYKLKLKKIQFTNCSMVSVDFMESDLTEALFDNCNLRLAVFSDSILIKSDFYSSYNFSINPEKNKLKKAIFSQENIKGLLDTYEIIIK.. 189
272 9.000e-51UniRef50_A0A033ULX1 Uncharacterized protein n=22 Tax=Bacteria TaxID=2 RepID=A0A033ULX1_STAAU  ali  30  1..........MKIIEPKLHNDFEYEEEKDVTLYQSSY-DLYFDKA-LIQLDEETSQIDTMYFNQCTFESVDFTKIHGLDIIFKGCDLSNCIFSEASLNRVHFKDCRMIGANFTDVKLKHVQFSNCQLKMSQFQNCNLDHVVFNDNQMSETYLSFCTQKSVAIERCALESLEVVETSLKDINLSSNTIEQLVVQPNDLKGATVSEYQAYDILPLFGVNV... 206
273 9.000e-51UniRef50_A0A1Z8ZMS8 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TMED92 TaxID=1986770 RepID=A0A1Z8ZMS8_9GAMM  ali  20  9.................................GDQYQELVFDALQQANTCVRDCEFVQCQFRGCDFSAATLVGCRFIDCDFCDCNFNTVRFERGTMRGCQFQSCKVTGVNWTLLDWRSVSFVQCDLSYSVFQRLVLPQLLLHECVVHEVDFSECDLTAADFHSCDLSGAYFRHTKLDKCNFQQAYNFSIDPTQNSVTAARFSSPEVLNLLAAFRIKVDCD 202
274 1.000e-50UniRef50_A0A1H7QC71 Uncharacterized protein YjbI, contains pentapeptide repeats n=3 Tax=Nonomuraea TaxID=83681 RepID=A0A1H7QC71_9ACTN  ali  13  219....CDLTRIRVPGADLSGLNLGTAVLTRADLRGARLSGADLASADLSGADLRRAYLDGADLRHADLGEAYLNGADLSGVDLFKAKLRRADLREADLSGVDLFDADLRGADLRGVNLSGASLSGADLREADLREAILRGADLRGTNLKGADLTGADLTGTNLKGADLTGADLTGTHLN........................................... 397
275 1.000e-50UniRef50_K9VK78 Pentapeptide repeat protein n=13 Tax=Cyanobacteria TaxID=1117 RepID=K9VK78_9CYAN  ali  14  95...RADLSAAQLIRASLIRSELVRCELSNANFSGANLTEADLREVKLTEANLCGANLSGANLRGASAASANFQEANLHGADLTKAELSGVNLSNADMRQASLQQVNLSSANLSGANLKWADLTGANLNGADLSCAKLSGANLHGADLRNTNLGSASFVHADLTETNLINADWVGADLRGATLTGAKLY................................. 279
276 1.000e-50UniRef50_A0A1H4DET2 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Eubacterium TaxID=1730 RepID=A0A1H4DET2_9FIRM  ali  28  3...........KIEAVDLRDDLEVLIDFEVLAQEECLGDCVIKGILGSEQDFSELNVENARFENCRLLECSFKKSSFKNVSFRNCDFSGSRFEDAYFSQCEWKGCKALGSSFSQGVFKNILLADNNMKYTDFDGSQWRWAHWEEVDFTGAFITQSRLRDLEALTCDFTQTAFFKTPLKGLDLTSSTIEGIQVSDTELRGARLDPFQAAGLMRLLGIEV... 216
277 1.000e-50UniRef50_A0A2M9B3Z0 Uncharacterized protein YjbI with pentapeptide repeats n=3 Tax=Streptomyces TaxID=1883 RepID=A0A2M9B3Z0_9ACTN  ali  20  17..TRRKTTKAPRRPAVRLPAALERHGAAD-LEPDGDYDSVEFAGLDLTGADAAGARFMDCALRRCVLDAARLPGARLIDSVLEEVRGAGTDLAGATLRDVELTDTRLGGVQLHGATLERVVVRGGKADFLNLRGARLTDVVFEDCVLVDPDFGDARLERVAFESATIHRADLSGARLTDVDLRGARDLTLERGADRLTGAVITPDQLLTLAPAFAAQV... 231
278 1.000e-50UniRef50_A5I043 Uncharacterized protein n=69 Tax=Firmicutes TaxID=1239 RepID=A5I043_CLOBH  ali  22  1..........MSISNPRIPADLIMVDDFSSLYEEIPITQIKIYGEHIEHFDFSKSEINTSIFENCTFLDCSFEGASFVDVVFQNCNLSNSNFTDAYFERCQFIACKCVGVNMIDTIFKQTSMQRSNFQYSYFDKAKMTDIAFEDIDFTEVSITEAKLKRFKAKNSHFIKNNFFKTMLTGVDFTKNELVAPTVSPIEFQGAKISMVQAADLIGIWGIIVD.. 216
279 1.000e-50UniRef50_UPI0009951B2D hypothetical protein n=1 Tax=Bacillus patagoniensis TaxID=228576 RepID=UPI0009951B2D  ali  22  5............VKEPVITDDVLKKKEINTIIDTLDITVALIEEEVHEEAVIKNLELNNCRVNKVSMPLAKLKKADFIDVAFHKCDFSNADFSGAYMNRVLFKNCKMMGAKLTDLNAKDVVFEECQLSMGMFGESTFTHCAFRYGNLTSSDFYHVQFKDMELTECDIDRANFEGTSLKQIDLSTCLFNSITADLHRLKGCTINEYQAPFFTQLLGLNVK.. 213
280 1.000e-50UniRef50_W7CWS6 Pentapeptide repeats family protein n=14 Tax=Terrabacteria group TaxID=1783272 RepID=W7CWS6_9LIST  ali  27  3...........KIIAP---TQTYHHVIADQIIDSDTLTFSHYLNCEIE----CSAAFEGCRFENCRFLTTTMTKCEFLDVHFLNCNLANTDFEEAVFFRVLFEGCKLLGTNFINTYFKDVRWLNASLSYANFSEAKFVKSQFESCDMTESFFQDTTFETVFFMNNRLTGADFSQTVMKDIDLSNCEFYHIVVSPELIRGLKIAPVQASAIVHHFGVILTE. 208
281 1.000e-50UniRef50_A0A2D5LF38 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D5LF38_9GAMM  ali  18  5..........................LAGNIENGGRYVDKVFSEIALTEGSVQGCEFEECKFVNCNLSGCSFIECKFTDCDFKCCNLNLIKLNRTKCFETHFLECKITGVNWTLLDWKSISFETCDLSLCIFNSLDLREMCMHSCKAHDADFSECDLTGSDFYKTDFKESDFSRSKLNRCNFSESINYRIDPIECSVEGARFSSPEVLTLLHPFNIKVDHD 205
282 1.000e-50UniRef50_A0A2A2HQ54 Uncharacterized protein n=1 Tax=Methanosarcina spelaei TaxID=1036679 RepID=A0A2A2HQ54_9EURY  ali  26  9.............................AQSDDKYIERMRFEGEMISDIDIARIEFESVQFIECQFNKCDFSKASFYNSVFDNCNFANCIFMDSYWKDSKILTCKGDGSNFSKSHMKETSLADGSFRYADFSSSVLENCTIRDCNFTEAFLSEIRLKKPMLKAVNFTETDFFKTSLKDIDLSDCIIDGITVSDNELRGATVNAGQAIELAAILGIKI... 200
283 1.000e-50UniRef50_V5XLW1 Pentapeptide repeat-containing protein n=121 Tax=Firmicutes TaxID=1239 RepID=V5XLW1_ENTMU  ali  26  4...........KIASPELP-ELVEGNFY--LEDETTFSGIFSEGEDQSYLSSRNIVLKSSHIKKLAMQKSRLERFECSDVIFEKCDFSNLEWFGASFHRVHFKQCKLTGTNFSDSFLRDCVFEECVANLSSFSYTNMKFVRFSDNQLKNTDFFDSNWKDLVVENNDLSGSNWVNTPLKGLDFTTNTFSQINLSMELLRGLIVNQEQAIIISAGLGLVIE.. 208
284 2.000e-50UniRef50_K9W8U3 Putative low-complexity protein n=1 Tax=Microcoleus sp. PCC 7113 TaxID=1173027 RepID=K9W8U3_9CYAN  ali  14  101..KNANLSGANLRDTNLRDANLWGANLSGACLISSNLINANLIGANLSSVNLINANLRDAKLINSDLSGANLSRADLRDASLIHANLRDANLNEADLRGATLISAILNRINLRDANLIGAELSGADLSEADLSGANLLKANLTRANLSNTNLNGANMSRVNLIGVKLSGANLRSTNLNRANLSNANLCGADLKLANLSLANLSFADVTVFAYNLGIT.... 322
285 2.000e-50UniRef50_A0A2D0MWS0 Uncharacterized protein n=2 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0MWS0_9BACT  ali  12  350..SRANLSGADLRGADLGIADLNRANLSIADLKGADLSFADLNDANLSRADLRGTDIRGANLSRADLRYADLRDANLFSVNLFSANLFSANLSWASLSRADLSGAHLRDADLSGADLRIADLSVADLRGADLSGADLRGADLSGADLSGADLSGADLSGADLSGADLSG.................................................... 516
286 2.000e-50UniRef50_UPI000B8A2928 pentapeptide repeat-containing protein n=1 Tax=Bacillus lonarensis TaxID=1464122 RepID=UPI000B8A2928  ali  26  19.......KKKREVIPPKINSDKLKHVRNLTLEDEDHYKRVALVKSDLSHRITNHLIFSEVTLTQIDFIATNFNRSEWCDVIFIKCDLSNTAFEQAIFHRVEFIDCKLSGVTFTASAFRHVTFNNCYAPLVIYGDCDFKYSAYLKSVLDESSFYNNKFSNVELIEININDVEIHQTSLSGIDLSKCSFEKLLVSADDLKGCIISPEQAVPFIQALGLKVK.. 230
287 2.000e-50UniRef50_A0A2U2CAY0 Uncharacterized protein n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2U2CAY0_9RHOB  ali  24  10.......MTPTRAMLERLSDEGEPVLFRGCDFEELDLGGLRFDTCNLARAGLTGARLEEVTFDHCRAPGARFVAATLSDVVVDGGDFGNTNFLDATLSSVAFRRCKMTGTDMTGVSAINVTFEEVLLVLGMLPNFPFRKAILNGVDFTEADLRGCDFRDAVFSASSLRDAHIVDCRFQGADLRGADLGGIRLTDARFKGAVISKRQAGDLLSQLGLNV... 226
288 2.000e-50UniRef50_E6UB07 Pentapeptide repeat protein n=8 Tax=Ruminococcus albus TaxID=1264 RepID=E6UB07_RUMA7  ali  25  12................................EDLEIKEKVFDHEIIASVDMSGFEFSSVTFIGCRFIQCDFNKAGFYGCKFEKCDLSNCKLEECYFKDCEFAGCKANGADLGRSVIKHTKMNTSSFSYGLFSECVIDSCEIIDCDFSGALLTKAEIKKTTLKDVRLISAEFFQAKIRGVDLSKCDISGIVFSHEELRGVTVNFEQAADLARLLGVIVK.. 200
289 3.000e-50UniRef50_A0A1Z4QDN3 Pentapeptide repeat-containing protein n=1 Tax=Cylindrospermum sp. NIES-4074 TaxID=2005457 RepID=A0A1Z4QDN3_9NOST  ali  13  1MDTNEFLRRYAKGERNFSGIDLGGAILSAANLSVADLSAADLNAANLSAANLSGADLSAADLSGANLSAADLREADLSGADLREADLREADLSGANLSASDLRAADLRAADLSGADLSGADLRAADLSGANLSGADLSGADLSGADLSGADLSGANLSGATLTEVQLITANLRNTNFAQA......................................... 181
290 3.000e-50UniRef50_A0A2X1BC94 Type III effector pipB2 n=4 Tax=Burkholderiales TaxID=80840 RepID=A0A2X1BC94_9BORD  ali  24  18............LARPQPPTRFERCTFDDEDLSNLDLSGIQFEACSLARTRLKSAILTDTLWQRCKIGQGNFELADLTVARFIACDLHMSNWARSRLSSAHMEDCKLIGASFIEARTLGLTLRHCPLVGANLRGLSFRKQHLDQLNLSDADLGGCDFRDARFSGGSLQGASLKGAQFHGADLRDTDIGNLTIHDTSLRGAILSSEQAEQLIASLGVQV... 225
291 3.000e-50UniRef50_A0A068R1X7 Pentapeptide repeat protein n=2 Tax=Xenorhabdus poinarii TaxID=40577 RepID=A0A068R1X7_9GAMM  ali  20  10..................................EEIHVEIFNNLIQPEKKFEKISFYNCEFQNCNFSSAVFKECKVIDCKFENCNLSLIDIDKSRFNGVEFYECKMIGINWTTASFPRFTFEKCKMNDSSFYGLMLKNLDLIECHVQGVDFREGDFSSSNFTYSDFSRSLFNNTNLSETNFSEAQNYFIDIYKNNITGATFTRFDALGLLDCLDINLVD. 201
292 3.000e-50UniRef50_A0A0W1A170 Pentapeptide repeats (8 copies) n=1 Tax=Legionella waltersii TaxID=66969 RepID=A0A0W1A170_9GAMM  ali  22  5.................................GTEYSDKQFIELDCQSIEIKNNRFEHCVFINCIFDAGFIRQCKFIECGFKSCSMNLVKLTGSSFVETEFTDCKMKGINWTEITFPSVIITSCDISYSSFYELKLPGIAIVDCKAHDADFRAADLSNSDLSGTDFENSEFNHTNLKSADFRRSINYRIDPTENNVRDAHFCLPEAISLLASFKIKIDE. 197
293 3.000e-50UniRef50_A0A238UEM1 Uncharacterized protein n=1 Tax=Tenacibaculum jejuense TaxID=584609 RepID=A0A238UEM1_9FLAO  ali  24  2.................................NDYYDNETFKKVAFTNDQISRSDFDFCIFENCDFSDMHIVNSEFLECEFIDCNLSNTRLKESSFKEVHFYSSKLLGIKFYEIDLLKINFTDCQVDYSSFYQLKMQNFQFVNCSVKEVDFTEANLQFSYFDDCDLLGSIFEASDLRNVNFKTARNFSIDLESNRVEKAIFSKDNVANLLEKYKIKI... 188
294 3.000e-50UniRef50_A0A1Q2D791 Uncharacterized protein n=2 Tax=Vagococcus penaei TaxID=633807 RepID=A0A1Q2D791_9ENTE  ali  27  2.............KKPQLAIDSLTPTSFFTIFDDSDFSNHCIEQEEILEQQIQRPLLDKCYFKQVNFSKSLFQNIEMTDCIFENCDLSNCDLSESIIYRTQFLNCKLVGTSFYKSYFHDTEFYQSKMTFTNFSESKIKQSIFNDNFMENADFIECELKKTLFKTCQLENTNFFDTSLKKIDLSTCQFNQLDIQLDGLQGCTLNQEQTLYFAKFLGITI... 209
295 3.000e-50UniRef50_Q11UG1 Uncharacterized protein n=2 Tax=Cytophaga TaxID=978 RepID=Q11UG1_CYTH3  ali  23  11.............................................DYSGLRLEEAEYENMLFLNCDFTNARLNGVDLIDCTFEQCNLSNATLDAASLKNCTFIECKMLGLSFSQTRGFEIHVTHSNLSFASFDKKKLYKSTFTECNMEGVNFTQADLSKSKLQACNLLDALFSDTNLSGVDFRTNTNFLIHPEANTIKKARFQSQDLHRLLMGYNIIVD.. 186
296 3.000e-50UniRef50_A0A1F8QIX8 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_57_8 TaxID=1797652 RepID=A0A1F8QIX8_9CHLR  ali  22  55...............................FAETAYYQKEFIAVHLSDEDVRTVKFEECHFDDCSFVRCKFENCAFIDCKFDRCVLSAINPAGSRFLQPAFSRCKVIGFDWAKAKLHGLDFSDGQLDYSNFSSLQLPRIRIVKCCVREASFTEMDMSDGIFTDTDFLGSTFFKTDLSRADFRRAKSYCIDVKNNVIKNARFSLPEVLSLLDGLNIVIE.. 243
297 3.000e-50UniRef50_Q8EA45 Pentapeptide repeat protein McbG n=84 Tax=Bacteria TaxID=2 RepID=Q8EA45_SHEON  ali  23  23...............................LRGRHFFAQQFIGLDETQAHWQDLEFEECEFHDCQFSDSTFRQCKFIDCRFVGCNLSLVKVSLSHFNGVSFEECKLVGVDWTRASWPRVTFKACILNDSSFMGIKLDEMVLEACKVHDVDFREGSFNRANFTFSDFRHSLFGRTELLEADFSEATDYDIDIFNNKIKGAKFSRDEAIRLLNGLDITLVD. 217
298 4.000e-50UniRef50_A0A1D8FWH4 Secreted effector protein pipB2 n=110 Tax=Actinobacteria TaxID=201174 RepID=A0A1D8FWH4_9ACTN  ali  24  23.........................VIADEDWYGREVTGRTYTRYSFVDTDWTEIRTENAVFDACVFSGVRFNASRHTGTAFTNC-----TFQRCTLFDTAFTDCKLVGSHFQRCEFTLLAVRGGDWSFTALPGAKLNRAGFDRVRMREADLTGADLTGAEVTGCDLSGSALRGCVLNGADLRGSDLSALDPRTADLAGARIDLGQAAVIAAALGCRVE.. 211
299 4.000e-50UniRef50_S4AY16 Pentapeptide repeat family protein n=34 Tax=Bacteria TaxID=2 RepID=S4AY16_ENTCA  ali  26  23..............................LEEELLFEGAFFEGGDYSYDACKNLILKQCHFKKVTMQKTRLSQWECQNVLFENCDFSNLECFGASFHRVHFKQCKLTGTNFAESYFRDCTFEDCVANFASFSNTNLRTMLFRQCQLNDSEFYEMDWKHLTLQENQLNNSNWFHTKLATLDFRTNQFQKIALSFEQLRGLTVDQEQALVIAAGLGLVID.. 211
300 4.000e-50UniRef50_A0A1I4I8J9 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Halanaerobium salsuginis TaxID=29563 RepID=A0A1I4I8J9_9FIRM :  ali  18  7MLANKIKIGVIKIYLDSENKEFNQSDFAKQSFREDNFSGFNFNNCSFKAAHLEEIKTEKTIFIECDFSGARLNASQHINSTFLNCNFS-----GASFFSAIFKECRLIGADLINTDLTAFKILGGDWSYVNFSHSELNNFNFSDVKLIESDFYAAQLKKTKFKNANLSRAKLTTANLTGADLREANLSEVDFTGVNFKNVKIDLFQAGIIMESMGAILD.. 220
301 5.000e-50UniRef50_Q07ZY3 Pentapeptide repeat protein n=6 Tax=Shewanella TaxID=22 RepID=Q07ZY3_SHEFN  ali  21  13..................................SHYGDDLFDSIKVVALQFKHITFERCHFNQCDFSQSDFYHCHFIECVFSQCNLSVMSVVATEFDDVTFSDCKAIGIDWTKAQWPQIKFERSLLDGSNFYALHLPELSLVGCRAHDVDFRETNLSKADLRLTDFNLSQFSHTNLTKANFTDALNYQIDITANNVKQAKFSRFEALSLLEGLDIQLVD. 204
302 5.000e-50UniRef50_G8R8M3 Putative low-complexity protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=G8R8M3_OWEHD  ali  24  4..................................SFVDDEVFESKDFTSEALKKAEYSYCTFRNCNFESTSISNFIFDECEFENCNLSNADVRNTSFRNCSFSGCKMLGLKFNECSSFLLSFSFCNLQFSSFHNLKISKTYFNNCKLEDVDFSDTQLNEADFNLSNLRGAIFDGTNLTKANFSTANGYSIDPENNKIQRAQFSKDGLAGLLDKYQLKIE.. 190
303 5.000e-50UniRef50_A0A2N1VSC3 Pentapeptide repeat-containing protein n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-2 TaxID=2013809 RepID=A0A2N1VSC3_9BA  ali  25  9....................................FEKMEFSNYKPENNKLISKTFENCKFINCDFSGCNFSDSFFTECSFTNCNLSNVNLKNTRLQKITFFECKLLGINFTEINFVKLSFNKSLIRDCNISELNLTGTTFTDCEINRCDFYKSNLSKTIYKGSSLPGSLFESTNLSGADFSEAINYKINPANNKIKGAKFSYPEVLNLLSIFEIEIE.. 193
304 5.000e-50UniRef50_A0A0W1AMC6 Pentapeptide repeats (8 copies) n=3 Tax=Legionellaceae TaxID=444 RepID=A0A0W1AMC6_9GAMM  ali  20  8................................SNTEYYEQKFSNLSYPSTIIEDKLFEGCQFVSTNFSESQFIRCKFIDCEFKNCNLSTVQFKASSFKDITFFESKVTGVNWTMLNWPHIRFYSSIISHSSFYGLELQELVIEACIAHDVDFREADLRRANFKLTDFEKSQFVHTKLYASDFTEAHSYSIDPTQNDIRKAKFSFPDAIHLLDGFDIQI... 199
305 5.000e-50UniRef50_C7QAY1 Pentapeptide repeat protein n=2 Tax=Catenulispora TaxID=414878 RepID=C7QAY1_CATAD  ali  20  3...SMPSSQPIPPARPDLPPLAELAPLDSRVRDEGQYEYQRVSEVSWDDVFASHARFSQCLLAEVTVVGGEWSKTTFADVRLEDSRLLGPDLSASHWRDTELVRGIASGVQWHDADVRRVHFDQVKLDAVNFRGAALTDVVFTDCLLREADFGGAKLTRVRFPGCTFEEADFSRAKLADVDLRGARLH-FKAGLDALRGATIDGGQLVELAPALGLRI... 220
306 5.000e-50UniRef50_A0A1G3MK91 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWC1_61_12 TaxID=1802180 RepID=A0A1G3MK91_9SPIR  ali  21  2.............................ERLQAEEIDDQTFVKLDFSELSLLGREFSACVFNDCNFTGSNLSGSTFEDCRFVGCNLSNPILENSRLIDLRFAGCKVVGLRLFTCRAFDLQFDACKLSVCNFSDVKMKKSKFTACQIDECYFQNSYLPEADFTASSFRNTLFSQADLQKANFRRASGYSIDPRLNNIRRAVFSVPAVLGLIDCFDIVIKDD 195
307 5.000e-50UniRef50_A0A1I5BW65 Pentapeptide repeat-containing protein n=1 Tax=Bizionia echini TaxID=649333 RepID=A0A1I5BW65_9FLAO  ali  27  6....................................ICDKTFKKQTYTINPLPKAEYNNCQFIDCEFSEAFLSYIAFTECEFINCNLSSAKVKDTSFNDVVFKGCKLQGVLFQYCNLLALSFENCVLNLSTFNDLKLKKTLFNSCMLKQTDFSNTDLSYSTFLKCNLEHASFYNANLSYTDFTTSQNITLNPEFSNLKSARFSSENVLGLLKCYKLIIE.. 190
308 6.000e-50UniRef50_G2LF12 Putative low-complexity protein n=3 Tax=Chloracidobacterium TaxID=458032 RepID=G2LF12_CHLTF  ali  18  56...RANLASASLRDAFLVRANLEGANLRGADLESANLEGANLRGADLSRANLEGANLEGADLTGARLPSAQLIDAKLENAVFANADLRNAYLGGANLTAVDFQNAILEAANFTGANLRDAVLRRAVLPGADLSGAKLERAVLEGADLSQVSLLEADCRHATFQGARLKGAKFSRTHLYGSDFSGAEVDEVDFSVA.......................... 262
309 6.000e-50UniRef50_A0A0A1GY14 Uncharacterized protein n=1 Tax=Lactobacillus hokkaidonensis JCM 18461 TaxID=1291742 RepID=A0A0A1GY14_9LACO  ali  25  2.............QAPKVTEAMLTPKSFLQIYDDEDLENGLIKNEILEQQNEDHPMLETCIVDHVIFNGSEITRFEATDVIFTNCDFSNCNFSEATFYRVQFLNCKMVGINLNGSYLNNVEFKNCLLNLASLNIVNAKDVNFVECRLAEASFNENKLKKIKFEQCDIDKMAILETNMRNVDISTCEFESLEAQQELIRGMQVNEQQATYFANYLGVKIK.. 210
310 6.000e-50UniRef50_D7C197 Uncharacterized protein n=23 Tax=Streptomyces TaxID=1883 RepID=D7C197_STRBB  ali  20  9..SRIARIK--NPTAPKLPPSLRTAEERDTLEDDAIIKGVRYESTHFVGLEAEAVEFESCMFENSRFTGTELRRSQFSDSAFNTCDFSQVTAHDVSLIRCTINGSRITGSSWKSGTFRDVRIEGCISAPAMYRYMKLYSVVFTDCKMTGADFQSASMHNVCFDNCDLTGAQFSNAQMGTVRFENCTLNNVG-GAASLKGATVSMELALSLAREAGILFED. 227
311 1.000e-49UniRef50_A0A166UYM7 Uncharacterized protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A166UYM7_9CYAN  ali  13  17.....NFSGGNFIGGNFSSFHLKDIDLSEAYLSSANFQRTLLDRANLYRAYLCSADFSYAKLYEANLCEADLTKAKLNGAYLVGATLTGAKLSGASLTGVNLRRADLRGVNLCGANLTEINLRGADLRGANLSGANLEGTSLTGIDLSGAYLNGADLHGVDLDGVDLSQAKLSGANFQGANLSAANLSQTQLRVALLQKANLRAANLEEAANLTKANLRN. 250
312 1.000e-49UniRef50_A0A1W9LV19 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9LV19_9DELT  ali  18  558........................................NLRGFNLSKAALNELSLSSVSLSEADLRYADLCYANLLEADLNGANLSGADLSYATLWGANLSGADLILANLIGADLSGANLSGANFSGANLLEANLSGANLSGANLSGADLSDADVSYADVSYADVSFIDLTHTDLKDADLSKANLSYANLSKANLSKANLSGANLNG-ADLEGANL... 734
313 1.000e-49UniRef50_K9SSF9 Putative low-complexity protein n=1 Tax=Synechococcus sp. PCC 7502 TaxID=1173263 RepID=K9SSF9_9SYNE  ali  14  31...............DLSDCDFTGANLSEVDFAGTDLQKANFSGADLSRAKLRRATFGETNFSNTNLSEADLRRVNLSGADLRGANLSTADLIGADLRRATLEGAILAEADLSRTNLVGTNMTDANLSMANFTGSDLSGAIMI----------RADLRRANISRANLNEADISRADLSGVDFSGSNLSQANFEEANFLGTNFSRTNLIE-ANFSNTNFRE. 224
314 2.000e-49UniRef50_K9X0X3 Putative low-complexity protein n=1 Tax=Cylindrospermum stagnale PCC 7417 TaxID=56107 RepID=K9X0X3_9NOST  ali  16  123..SQANLSQANLRGANLRGADLSGAYPSGADLRGADLSGAYLSEAKLSQAKLSQANLSQANLSQADLSGAYLTGAYLSGADLSGADLSGARLSRADLSRADLSAADLRGAYLSAADLSAAYLSGADLSGVNLSGVNLSGFDLSGANLSGANLSGANLSGAKFER--LRKANLRNTNLAQA--EGFDLNNLPVEDNNIS....................... 342
315 4.000e-49UniRef50_A0A2V8T977 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8T977_9BACT  ali  17  30..SDMDLSNVDLAEANLRMADLNRAVLREARLTGCFLSGALMNDANLTGADLVESSMIGAKLKGADLSRADLSGSDLTGASLQGAELAGAYLVGTFLNETDLSGANLNGAQMAGSNLVGASLESADLSYTDLSGVRLDGCCLIGANLMGANLAGSTLKDCDLRGADLTGADLSGCNLTGAKLRDVKFSGVKLADT.......................... 227
316 4.000e-49UniRef50_A0A1Q7ULG8 Uncharacterized protein n=1 Tax=Ktedonobacter sp. 13_1_20CM_4_53_11 TaxID=1805225 RepID=A0A1Q7ULG8_9CHLR  ali  18  122..SEATLRGTDLSGANLTRANLSSADLVGSDLRGADLSGADLNSADLREANLYSATLNRATLRGAVLRGVNFNRADLGEVTLRGADLRKATLRGATLNGSILREANLSGADLNDSDLSCADLKGATLSGADLSGANLSRADLSIVCLREADLYLTQLSEAILVGTDLSGAD-----LRGANFIRATLSGINLRGADLRGANLNG................. 328
317 5.000e-49UniRef50_UPI0009FDE383 pentapeptide repeat-containing protein n=1 Tax=Nocardia paucivorans TaxID=114259 RepID=UPI0009FDE383  ali  17  22.........................................................NRANLSGTNLSGADLSGADLSGANLSGANLFGADLSGADLSGANLFGAKLFGTSLTDANLHRADLSGVDLTDADLTDADLSGTDLTGAKLHRADLTGADLTGAKLFGTSLTDVNLHRADLTGADLSGADLTGAKLGRANLRHANLTGADLTG-ADLSGADL... 198
318 6.000e-49UniRef50_A0A1F8Q4F4 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_54_18 TaxID=1797648 RepID=A0A1F8Q4F4_9CHLR  ali  17  188...........LRGSGLSDSLLVGAAMQDLNLKSADISQLNLTRVDLSRCDLSEASLNEVKLSEARLQDATLSRARLTLVNLKGADLKHADLSKIRLSQVTLAGANLTGVDLSQANLRGENLNEVRLRNADLRMAVLSEAHLQAADLREADLSGAELNQADLSAANLSAAVLSEARLIQADLSMANLTQAVLSRAILTDARLCQADLTG-ASLNGAVL... 393
319 2.000e-48UniRef50_A0A1Z4L7G8 Pentapeptide repeat-containing protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4L7G8_NOSLI  ali  14  72..SGANFYKALLIEANLSSANFSVANLSKAKLSQADLSYGNFIGADLSEADLRGANLIGTDLKNANLRDADLDAAKLIRANLCFANLIEANLIGADLSEASLYEAEMLGAYLYKTDLYKANLTKAHLSGAYLLSANLNEADLSQADLSWANLRRANLAGANLRKANLRGADLRGANLSGANLQEAIMPDLKFGFGKLKKCIV................... 276
320 3.000e-48UniRef50_S9PHD9 Pentapeptide repeat family protein n=3 Tax=Archangiaceae TaxID=39 RepID=S9PHD9_9DELT  ali  12  19....................DLREA-LEAAGEAGVELTQAMLDGANLSGANLEDLDLRQASLRGANLRNANLADIDLSGANLHEANLRGANLEHAEMHEVVLADANLEGCNLEDARLIGANLQGANLEGVDFSRANLEGANLEGSNLEDARLSEANLSRVNLQRANLEGVDLDGANLTHADLRSANVERADLRDANLEDANLRGANL.............. 209
321 4.000e-48UniRef50_A0A2V9MEI0 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9MEI0_9BACT  ali  14  2....ADLSREEVLQKLKSGENLERACLRELALNHANFECADLRRADLEGVNFEESNLKKANLSCANLREAYLMGANLEEINLQKADLEEANLDDANLQFADLSHANLEGATLERANLKGARLSYAQLELANLGGALMEGAQLSNAHLNESYLGGANLREANLQYASLEKASLEEADLTGANLMEASLEGANFKAALLKGAIFEDAILIG-VNLSRADLR.. 220
322 5.000e-48UniRef50_A0A286C699 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Nitrosomonadaceae TaxID=206379 RepID=A0A286C699_9PROT  ali  17  39....................DLAFTDASGANLGFQDFSGANLEECVLVSANLKEAGFSRSNLRGANLSKVSSMGADLSAANLTKTNLSGADLTETNLSRADLTGAILWWTHLSGAIMSGADLTGAYLTGVDLTAADLTGAVLTKTNLLGAKLSGAKLSDADLSDADLSRADLTGTDLSGADLSRANLSWAKLTRADLTKTNLTCANLSG-ADLTGADL... 235
323 1.000e-47UniRef50_A0YQQ5 Uncharacterized protein n=4 Tax=Oscillatoriaceae TaxID=1892254 RepID=A0YQQ5_LYNSP  ali  13  276..SESNLADANLEQADLMGAELRGATLKGTNLSQANLREANLKGANLTRANLREVNLQGANLQQANLQQAILQGANLKDANLIRANLREAKLQDAKLQRVNLERANLQAANLTDANLSNANLTDASLNQTQFYQAVLIRVDFYNTDFQDANFQDADLKGANLRGVNLKNANFQNANLKHANLS--DIEIINPRQ........................... 488
324 1.000e-47UniRef50_K9W7P0 Putative low-complexity protein n=5 Tax=Oscillatoriales TaxID=1150 RepID=K9W7P0_9CYAN  ali  14  121..SDTNLSETILCSANLSRADLRGADIRDSNLQGVSLSDAKLRGANLGRVNLSHANLKGAYLIRAYLGGADLRCAEIDGADLTEADLSEAKLNCAKLRGTNLKAANLSLADLSDVNLIRANLSSADLMRANLRDADLIRTNLSGADLRGADLSLADLSLANLCLANLGSANLIRANLSGANLSDANLSEADLRGADVKNAQFARAQTQRVLLRRGAIFED. 348
325 1.000e-47UniRef50_A0A2G4JDL0 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Nitrosoarchaeum sp. TaxID=2026886 RepID=A0A2G4JDL0_9ARCH  ali  13  85..SNTNLKSTIFKDSNLSGAIFTKANLSGANLINVNLSGVDLSSVDISYADLTGANLSGVNLSGANLDNANLSGTSLSNVDLRGVNLSNADLSKANLFRKDLSDANLSGADLTGANLSGANLSDANFSYAKMPGVNLEKSDLTRTNFSYADLSKANIRYAYLLSTTLFHTNLSGAKLSGADLTTADITNADYRTA.......................... 286
326 3.000e-47UniRef50_A0A2P7TW91 NACHT domain-containing protein n=1 Tax=Sphingobacteriales bacterium UPWRP_1 TaxID=2116516 RepID=A0A2P7TW91_9SPHI  ali  18  736.........................................FSYQNLRSINFTGVNFTGVDLTGANLIGVDLTGANLTGANLTGTNLAGANLSEVNLAGAYLLNVNLSGVDLTCANFNHANLIGLNLSNTTLNGAKLEDATFRESNLSGADLNNAILCRSNLIYCNLSCANLSHANLAYANLSNCDLSHANLSHANLVYANLSNSNLSH-ANLSHANLEN. 930
327 5.000e-47UniRef50_A0A218QU83 Uncharacterized protein n=1 Tax=Tolypothrix sp. NIES-4075 TaxID=2005459 RepID=A0A218QU83_9CYAN  ali  13  51..SGANLGKANLRGANLNGANLSNADLSEANLNEANLMMAKLFGADFSKANLNSAYLSKAKFNHANLNKANLNKADLKSANFSKANLSEANLSEASLLNVDFSKTDLRQTDFSRTDLSDFNFSRMDLSQCNFTEANLSDANLIETNLNNANLSRANFSGANFRGANLTAVQALATNFTGVEFTKSCLQDWNINSA.......................... 258
328 5.000e-47UniRef50_UPI000C796B78 pentapeptide repeat-containing protein n=1 Tax=Pygmaiobacter massiliensis TaxID=1917873 RepID=UPI000C796B78  ali  28  3.......IYPPRMPSSLVRCSQLSDLSERALAEESTLSQLLIDHAQENRFDFSALEIRASRFENCTFSACRFSHATFIDVCFENCDFSNSTFTDAYFERCQFLRCKYIGAQMQDTRWKSVLIQGTSFELAYLDGAKMTDIIMDDSNFSNVSWSEANLKKVQNLKCRFVRNNFFQTALAGMDFSCSELAAVSASGAELKDCEINALQAADLITLWGVKIK.. 216
329 5.000e-47UniRef50_UPI0009F9C578 pentapeptide repeat-containing protein n=1 Tax=Amphibacillus sediminis TaxID=360185 RepID=UPI0009F9C578  ali  25  10...........KILKPNLSTIERISDFESVCVENPIIEDVIIEDCSIGKEVEKGLEIRDAILRRVNLDGFSCEKLYLRNVRFEKCFLTNAQLEEITMDRVEFINCQLTGVLMPDSRLNHVWFSNCNMQLVGMGYSQQKNVHYQECLLRQADFYLNQWKNVVLNQCDLTGANLAQTKLAGIDISRSSFDNITIGIDDLKGCIVNEEQARAFSRLLGLVVRSD 220
330 7.000e-47UniRef50_A0A2N6M4U6 Uncharacterized protein (Fragment) n=2 Tax=Fischerella TaxID=1190 RepID=A0A2N6M4U6_9CYAN  ali  19  89..SGTNLSSVQLVSANLSSVQLIGADLSNANLEHTNLSSADLSNAELVGVNLSSANLSDARFLSANLTKANLSGVNLNNAKLVNTDLSNANLSYAVLKNAQLSGAKLRNANLKNANLYGTQLLGARLDYANLEGANLEGANLEGADLRGANLSGANLKSVKINQADLRNADFEDANLQGADLRNTDLSNVKFTRAKVDNALFGYNQGLSLLKLRGAVFEDE 348
331 7.000e-47UniRef50_A0A2H3P8H4 Uncharacterized protein n=1 Tax=Longimonas halophila TaxID=1469170 RepID=A0A2H3P8H4_9BACT  ali  16  328.......................................QHLSAISWMGCRLSTVTLIFADLRSADLRGVNLLRANLLSANLLGADLRDANLRGADLRSADLRDANLRGADLRRAELWRADLRNVELQDANLRNVELQDADLRDANLIGADLQDADLQDADLQDADLRGVNLLRANLLGADLLGAHLQGADLRDTDLQETNLRDTNLWS-ANLQGANL... 505
332 8.000e-47UniRef50_L8M6M3 Putative low-complexity protein n=1 Tax=Xenococcus sp. PCC 7305 TaxID=102125 RepID=L8M6M3_9CYAN  ali  14  278..KGANLKGAHLEEAHLEEAHLEEAHLEEAYLKDAYLNEAYLNGAHLERANLEGARLEGTYLKGANLEGAYLKEAYFIEANLEGAHLEGAHLEEADFNFANLKEANLKEVHLDRTYLRKANLSKANLNKASLIEANLNKAYLIEANLKEAKLNKANLSGVYLNGSDLNRADLNGANLKEADLNGAIFTSVNLTSKQIKSA..................... 481
333 8.000e-47UniRef50_A0A1Z4M371 Pentapeptide repeat-containing protein n=1 Tax=Calothrix parasitica NIES-267 TaxID=1973488 RepID=A0A1Z4M371_9CYAN  ali  14  738...NTNLSDANLNNTNLSDANLNNTNLSGANLNNTNLSGANLNNVNLSGADLKFINLSGANLEHANLQGANFSGANLEDANFSDANLEDANFRGANLQYANFRNANLQYANFRSANLRGTYLRLANLGDANLQGANLEDAYLSGANLEDTNLSGANLTNTNFSNAKLENNRFFR............................................... 949
334 9.000e-47UniRef50_A0A150TIU2 Uncharacterized protein n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A150TIU2_SORCE  ali  12  534..SRAVLARADLTRADLTGARLAGCNLGQASLTDADLAGADLTRAVLAGADLTRARFRGARLHGVDLEGASLVKCSFIEVDLRGADLTGADLSGARLRGATFEGADFTGAALEGANLRGMNLAGCRLGGADLSGCDLRGARFDRAIAHEARFTKADLSGASLVDANLMLALVDRANVRGASFRGANLFRADLSKIEADDATLDEANL.............. 795
335 9.000e-47UniRef50_UPI000D390951 hypothetical protein n=1 Tax=Mycobacterium sp. YR782 TaxID=2135747 RepID=UPI000D390951  ali  12  1................LAGATLTGATLTGANLSYADLTNANLSYANLTGANLAYAYLTNTNLAGANLTNANLAGRNLQTAILAGANLTGATLTGALLNGANLSGATLTGQNLANFNLTGTNLSGANLTGVNFTGATLTNANLAGANLANANLTGQNLQGYNLTGVNLTGANLTGVTLTGANLTGANLTGQNLQGYNLTGTNLSDAILTG-VNLTNANLTN. 203
336 1.000e-46UniRef50_B7CCY7 Uncharacterized protein n=1 Tax=Holdemanella biformis DSM 3989 TaxID=518637 RepID=B7CCY7_9FIRM  ali  27  9.......................SLEPMDEWTYESYVSDYIFENVCIEQ-NLDNVTIDGCKFSKCQFKDCSFSFIEGMDIIFDHCEFENVHFNQCSLSRVHFISCRISGMEFSQSLVQDTLFQLCKGHYCDFGGSTFKDCMFDINDLTGSGFVQCDFKKTSFDKCILNSTEWFNTKLKELDFSSCEIENIAVSSDKLTGVVVNSSQALEFVKLLGIVVKD. 204
337 2.000e-46UniRef50_UPI0006C8575E hypothetical protein n=1 Tax=Planktothricoides sp. SR001 TaxID=1705388 RepID=UPI0006C8575E  ali  13  73..SDATLQRATLKEANLRKANLQWADLQEAQLQGANLFQCRLMCANFRGASLRLANLEAADLDKAELSGVDLRVANLIQAQLRNADLKQGKLQGANLSKANLTGANLEGVNLQGANLRGANLFGANLQNANLQQANLEEADLTEAKLFAANLQGANLQKTRLQGASLKGAQLLGTLL............................................ 253
338 2.000e-46UniRef50_UPI0009DCBE81 pentapeptide repeat-containing protein n=1 Tax=Streptosporangium roseum TaxID=2001 RepID=UPI0009DCBE81  ali  20  145........................................TLSAFDESGEVNDRADFSFSRFPKAFLISAFLRGADLTEADLRGANLTGADLRGANLAGTDLTRANLAGTDLTGTDLNGADLTGADLTGANLTRADLRGAFLNGADLTGAFLNGAKLNGAFLNGADLTRAVLRGAVLRGADL-GADLTGADL-GADLRGADLTSADLTRAANLHGAVLRD. 326
339 2.000e-46UniRef50_A0A0R1VSW1 Uncharacterized protein n=2 Tax=Lactobacillus TaxID=1578 RepID=A0A0R1VSW1_9LACO  ali  27  2.......TQPNPHSSSRINRSAYEPKKFQTILEDEDLEYTSVSDETIDTLTLKHPIIEHCTFDHVIFTSCNFNKFEVSESTFKNCDFSNCILDEESLYQVQFTDCKLVGTVLDQSYLNDVTFSNCKMDLAGLNKLNVKHASFQQTSLNDATFNDCTFKKISFNDCQINHISFMFTKLKGVDLSTSHFKQLELEDFQLRNVIVNEEQAVQLAHQLGLKIK.. 216
340 2.000e-46UniRef50_R5Z1P2 Pentapeptide repeat protein n=1 Tax=Clostridium sp. CAG:492 TaxID=1262813 RepID=R5Z1P2_9CLOT  ali  29  1..........MEIMKPNLDGITECNT-IKGVIREAKIRDCFFNKCYEANVETDKMEFSSCEFKDCICLNSKFEKVYFTDVLFENCDFSNTMFYECNFVRVTFRNCKLVGSNLCNVNMYNILIDNTNVSYANMSLGTYKEVCFSESKLSNSVIQEVIFKDVEFDKTNLIASQLCRTNLNGIDVSNCDITGVAISQDYIKGLIVNEMQAVELSKLLGVVVK.. 213
341 2.000e-46UniRef50_B1BZY5 Uncharacterized protein n=11 Tax=Firmicutes TaxID=1239 RepID=B1BZY5_9FIRM  ali  27  8..........LKIKKPIIHLLNENDLEV-----VESYYQCLFNKTPLDIVEIKNNTIDECKFLKIDFSKINLTNTHFVDCIFINCDLSNISFEKISIHRCYFINCKMVGVGFINCSLKDVMFEDIQGKYMNMALGNISNVEFKECCLDESSIMETKIKNLEFNDVSFINGEIFKTNLQDMDFKSTNIEGIKIDIYSLKGIHVDMYQAVELSRLLGIIVD.. 211
342 3.000e-46UniRef50_X1HG63 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1HG63_9ZZZZ  ali  15  24...........................EGLDLSRREFENIDLSQLDLSGIMLREASLWYARLEGAKLTGAHLERAILRGAYLEGADLSDAHLEGADLQGVHLEGANLSGAHLKKAELLKAHFEKARLPDAHLEGADLEEARLDWADLSGAYFKEAYLMNAHLEGVNLSGAHLEGAHLEDTSLEGAKLSGAHLEGANLQRANLQGATLQQ-AHLQQANLK.. 215
343 3.000e-46UniRef50_A0A1F9ZNN5 Uncharacterized protein n=1 Tax=Firmicutes bacterium GWF2_51_9 TaxID=1798011 RepID=A0A1F9ZNN5_9FIRM  ali  31  1.............MKKKNPYELYLSTELETFEDRAKYMDLRFENRTIT-VDFP-VEFNGCVFERCTFSG-DFKKSQFIDCLLEHCDLSNIDLEGSRFHRIKMTGCKGLGVRFSKSKGQYVTIEESILNYGEFADVDFQDMLLKKCDFSQGSFFNSSLQRIQLQQIDLSSTDFSDTPLSGLDISDCKIDQIRMSPKCLKGLIVSSDQAIALASLLGIVVK.. 206
344 4.000e-46UniRef50_C8WGB0 Pentapeptide repeat protein n=17 Tax=Terrabacteria group TaxID=1783272 RepID=C8WGB0_EGGLE  ali  24  11.......TRPPRPARPDIPGELTEVDDLAGWIERDRVSHVLVRRDAAEGADFSLVELTESRVEGCSFVGCDFDRAMASDVAFSNCDFSNSTFSQANFTRCTFSSCKFTGADLLEAVLSRVEVRDSTFAYASVAKGKLEDVSVRSTDFSGADLAELRQRRVELDDVRFAGTSFFRASLDGVDLSSCRLADIVLSMEELRGCSMDLFQAAGIARRLGVNVKD. 230
345 4.000e-46UniRef50_A0A2N6ALH7 BTB/POZ domain-containing protein KCTD9 (Fragment) n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2N6ALH7_9FIRM  ali  32  1.......................................................SFKQVVFRNVVFKKTVFERVELEDVRFENCDLSNLGLGGAIIHRVEFENCKMVGLNLGGAAIQNTAIDKCNCKYANLRFSLCKRFEARDSILDFADFQSSEMVDARYEDTSMRECQMSGTSLCGIDISTCDIEGIGIRMEDMKGAVVSPVQAVMVAGMMGLVVKD. 165
346 4.000e-46UniRef50_B6FKT6 Pentapeptide repeat protein n=1 Tax=Tyzzerella nexilis DSM 1787 TaxID=500632 RepID=B6FKT6_9FIRM  ali  28  25..................RYQLLDKENLQFISEEELISDFLIKDCEIKNIE-EKIFISNCIVENVVFTECNLDKIDIYKTKFIHCDMSNINMSNAVLNECFFVNCKMMGTNISSSSMNNIVFNNVMAQYINATDIKTKKCKFINSNFSNSYFNNSILSRIELEGNDFREAWFNGVELKNIDFSSCNIDGIKVDIEDIEGVKVNMAQAIELIRLLKVQI... 223
347 6.000e-46UniRef50_A0A0N0BNL8 Uncharacterized protein n=2 Tax=Halobacteria TaxID=183963 RepID=A0A0N0BNL8_9EURY  ali  13  1...............................MRKADITKAALRSAYLSDAYLKKADLSEAHLVKTDLSNANLESADISDAYLPRADLSGAELKDANLSGADLSEANLSGAELKDANLSRADLSEADLSEADLMDADLSKANLREADLSDANIERANLLSVNLLDADLSKANLEGADLSKARLVNADLSKTELRGADLLKADLANATLTGAL.......... 180
348 7.000e-46UniRef50_A0A1X6WP89 Quinolone resistance protein n=3 Tax=Enterococcaceae TaxID=81852 RepID=A0A1X6WP89_9ENTE  ali  25  5...........KLEQPRLSSHLEEILP-EYLEDELMIQQNLIRETSLSDGSYASLVFEKSHFYKVDFSSNFFQRFEVVDCLFESCDFSNIEWIGASFHRCIFKNCKLTGANFAESLLQNCQFIDCNIPYASFNFTQLKRVYFSDCHLDYSEFNDIKWNNLEIHQCQLNKTTWVNTALNKLNLSSCQFETISLSPDLIRGLIINYEQMITVGLTLGLVLDE. 212
349 8.000e-46UniRef50_A0A0U4B7H3 Uncharacterized protein n=3 Tax=Deinococcus TaxID=1298 RepID=A0A0U4B7H3_9DEIO  ali  30  2.............................................................FRRVNLTGSVWERVRLLDVRFEDCDLSGARWTDVSLDRVEVTGSRLLGLQAAGVRLRHVRLTRVHAPLSVWQRADAAHLHLNGCDLSEASFMEANLPGAVLRDCRLHRTDLRGAQLDGADLRGSALGGLRAGAADLQGVTVEAAQVLDLAHLLGVQIEE. 160
350 1.000e-45UniRef50_UPI00034C6B3E pentapeptide repeat-containing protein n=1 Tax=Oscillatoria sp. PCC 10802 TaxID=1173028 RepID=UPI00034C6B3E  ali  16  18................................QGGDLSEANLAQFNLSGADLSGAKLMFANLHGANLSGANLSGANLVAADLVSADLRGIDAEGINLLDAKLNRANLCGADLGFANIVNSKLEEANLCGADMDGANLIGARLNSANLSGANLGGANLGHAELVGANLSNADLNDARLVSADLSDANLAGANLTSANLLNANLSGANLSG-ANLSGANLAN. 209
351 1.000e-45UniRef50_A0A0M1JL06 Uncharacterized protein (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A0M1JL06_9CYAN  ali  12  4..SQANLSEADLSEANLSKANLSNANLSNADLSNADLSNADLSGANLKKAKLSEANLSNADLSGFNLSQANLSGANLCGANLKKANLSEANLSKANLSETDLSEVNLSGANLSKANLSKTDLRNANLSWADLRKANLSEADLRGANLSKTDLREADLSNADLTEADLTKADLKGANLENATVTQARFGS................................ 208
352 1.000e-45UniRef50_UPI000AFF5BBB hypothetical protein n=1 Tax=Micromonospora citrea TaxID=47855 RepID=UPI000AFF5BBB  ali  15  372............................................INLATLHLRGSKLSGADLRGADLTEADLRAADLHNVNLQDSCLLMANLREANLSGVDLRNANLVEADLQNVHLAKANLRKARLRGVDLRNANLVEADLRDAHLVGADLRDAKLPGANLRNANLRRVDLRRTDLVGADLRGGNLLVADFRDANLRGADLRRTGLAGAANMTEADLR.. 550
353 1.000e-45UniRef50_A0A1D9GA45 Uncharacterized protein n=1 Tax=Moorea producens JHB TaxID=1454205 RepID=A0A1D9GA45_9CYAN  ali  19  270........................................................LRSADFSDANLSEVNLSGADLSSANLSGANLSGADLSRADLSFANLSHANLKGANLKGAKLNAANLSSANLSYAHLKGAEMSSANLRGADLSCANLRGADLSGANLSDTKLRNANLTHINLRGANLSGANLSGANLSGNNLHRVNLSGADLSGFADLSGANLSD. 453
354 1.000e-45UniRef50_M5AHL7 Uncharacterized protein yisX n=16 Tax=Lactobacillus TaxID=1578 RepID=M5AHL7_LACBR  ali  29  4...............PRILPATLTAQSFLAITADEDLQMAHVQQQTIADQSLEHPLIDQCLFEGTTFINDNFYRAELTDVIFKNCTLVNCQLEAASLYRVQLQNCKLVGTTFDHAVFRDVVITDCDLSLANLNEVKFTSVKIIASRLVEVNCLDSVMIKTQLTRCDLNQADFSGTGLKALDLSTCDFDELRLTANDLRGCHLNTEQAAYFAQLLGVQL... 209
355 1.000e-45UniRef50_G9YPA2 Pentapeptide repeat protein n=18 Tax=Clostridia TaxID=186801 RepID=G9YPA2_9FIRM  ali  23  18......................................DVTVEGECLAGADLSGLEFRRVCLHRCRFQNCDFSGAVFDRVEWRGCDFSNCRFGGTVWTDTVVRDCKGDGGRFTASRWRGCTLGESAFRCANFAQSRWKKCRMENCQLRRAVLAEADVAGLSPHRTGFQEVDFFRTPLKGVDFSDCALEGITVSESELRGMKINPAQAVDLIPLLGIQL... 199
356 2.000e-45UniRef50_F4XJ47 Uncharacterized protein n=4 Tax=Moorea TaxID=1155738 RepID=F4XJ47_9CYAN  ali  15  53...GANLSGSLLIYTDLTGAIFDKAILRHAYLNRAKLTRTSFQRADLTMTSLEDANLIRVNFSLADLEGANLFRTNLIAVNFTKANLSRVNFTEAVMTGANLNEAQLIGSNFDKANLTGADLVKANLKGANLSQANLSYTNLREANLSETNLRKANLTGADLTHANLQGANLIEAELDGVILNTS.................................... 239
357 2.000e-45UniRef50_Q46EK4 Uncharacterized protein n=18 Tax=Methanosarcina TaxID=2207 RepID=Q46EK4_METBF  ali  15  170..KETSFKRTDLEKTNLQEADLQGADLEEANLQRANLQGANLKEANLQRTDLRKANIQGADLGKANFEQANLKGANLKKANFEKTNLEEAKLKEAILQGANLIKAKLIKAKLQKANLKSANF-----NGANLIKAKLEGANLQRANLKEANFNGADLQRVNFRKANLQGAKFKEANLEGA......................................... 342
358 2.000e-45UniRef50_UPI0009EA5927 pentapeptide repeat-containing protein n=14 Tax=Micromonosporaceae TaxID=28056 RepID=UPI0009EA5927  ali  11  51..TGANLAGVDLRGADLTGVDLTGANLAGVDLRGADLTGVNLTGALLIGANLAGANLAGVDLTAANLRGVDLAGVDLAGVELAAANLTAADLTRADLTGAFLIGADLTGVDLAGVNLAGVDLRGVNLTGVNLTSADLREANLDRANLTGVNLCEANLYGAVLTSTKLAGAR.................................................. 219
359 2.000e-45UniRef50_A0A1J1LVA6 Uncharacterized protein n=13 Tax=Oscillatoriales TaxID=1150 RepID=A0A1J1LVA6_9CYAN  ali  13  562..TEANLSESNLQLANLNAANLTGANLSYTNLTNVNLSRANLQGANLQGADLRGANLTAANLENVNLRGAILERAVFTQANLKSANLVDTNLTGAT----------LTQADLSQAILIHAQLRDTNLSQSILRHADLTGVDLTRANLKQVDFSYASLENAIVRHTNLKDAILLYTDLRGANLAEAQISGIKLGNN.......................... 749
360 2.000e-45UniRef50_A0A192H182 Uncharacterized protein n=2 Tax=Lactobacillus backii TaxID=375175 RepID=A0A192H182_9LACO  ali  28  12......................ETDAQLNQIEPEEAFSNQCFDTQQLEQEEFVGSYFKEVIFKNCVFNEINFVRLSLHNVIFDHCELLNSELIGAGMQRVEFQNCKLTGSNFADSVLQDCLFDNCKADYTSFSGAKFKRLNFLSSNLMSADFSFLNWQQLEFTDCQLMAANFLSTRLTKLKLKSNQIDSVKVTAQSLAGLIVAPEQAVDLLLAIGVKVD.. 209
361 2.000e-45UniRef50_A0A1C5KS21 Secreted effector protein PipB2 n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5KS21_9CLOT  ali  25  13.............................AREEDDQICRLTQLRQELKGLDLSELELRDCHFHGCRFTDCDFSGAVLERCLFHSCQLVQCRFGNSCWRDTALLECKAEGSDFRGARIRECGWKDTLLRYSNFNESQWRSAKLECCDLRETTLSSAVVKELTLEKVDLTGAELFRTSLKGTDLSRCTIDSISLSAAELKGARIAPHQAAVVARILGIDVAE. 205
362 2.000e-45UniRef50_A0A1T4K8U8 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Anaerorhabdus furcosa TaxID=118967 RepID=A0A1T4K8U8_9BACT  ali  28  1..........MKIEQPKI-QTLNQATFNDCIIDQDFYNKLIDENPTMD--MDEECRVDSCHFKKIDFTKTKIDVKEFLDVIFENCDFTTMEFNEVNFHRCKFTNCKMSGANFYHCIMKNVEFDACLIRLSNFSNGKIELSRIQNSNLEESRFFQVELKKIEFKENDVTKGEFFETSLNGVDFSSSIIEGITVDLNSLKGIKVNSTQAIRLASLLGIEVVD. 207
363 3.000e-45UniRef50_A0A2W4WUD4 Uncharacterized protein n=1 Tax=Phormidesmis priestleyi TaxID=268141 RepID=A0A2W4WUD4_9CYAN  ali  15  97..SDADLTFAHLIDADLSNAILDRANLSGAILNEANLSGANLEGAYLKDADLSGVKLIGANLRNANLSGVNLIGANLEGAYLDRAILIYAKLIGANLEGADLSEAYLRGADLSEAYLRGADLSKAGLSEAFLFKAYLSDTNLRGANLRGANLGEADLSSANLSSAQLKTALLCRTQLEGIDL....................................... 283
364 3.000e-45UniRef50_V5V8T4 Pentapeptide repeat protein RfrL n=5 Tax=Cyanobacteria TaxID=1117 RepID=V5V8T4_9CYAN  ali  16  14.............ERDFNRASLTNGEFINADLRGIILSRADMEWVNLSGANLSGAVLCGAEIVNAMLIKAELVDANLAGANLSRSDLSWANLTRANLSRAELSETTLRGTVLQGANLSRVDLANADLRGLTLDGVNLSGANLQGANLHGTELKQANLTRVDLIQADVSNANLSGTNLSGANLRGANLTAANLTGANLSRVDLTEVKLSE-ANLTKAKL... 217
365 3.000e-45UniRef50_R9M3G5 Uncharacterized protein n=5 Tax=Clostridiales TaxID=186802 RepID=R9M3G5_9FIRM  ali  23  5....................ESLEQALEEAREGGDLMEALTFDRITAEALDLSELTCRRLSFRTCRFTGCDFSGAAFYDCDFTGCQFAECRFPVSYWKTCRLTGCKGDGGDFRRGRFKDCALRECVFRYANFTGTVWERCALAECNLTESALAECKISKTTFQTVDLTGAELFRTPLKGTDLSSCTLDRVSLSEAELKGAKLHAGQAAVVARILGIEI... 204
366 5.000e-45UniRef50_UPI0002AC56E7 pentapeptide repeat-containing protein n=1 Tax=Leptolyngbya sp. PCC 6406 TaxID=1173264 RepID=UPI0002AC56E7  ali  11  104..SEASLIRAELLRADLSNATLNQANLSEADLREARLRWARLSGANLSQSDLRKSNFLGANLEGAQLYAAQMEDTVLSGAVLQRAELRHATLMGADLSGANLRGANLRWADLSGANLQEADLTDAKLSGATLVGADLSGATLVNTILVHTDLSRTRLQRVYCVDSDLSGATLNGAFLAGADLVTAE................................... 290
367 6.000e-45UniRef50_A0A0N8GCH9 Uncharacterized protein n=1 Tax=Methanosarcina flavescens TaxID=1715806 RepID=A0A0N8GCH9_9EURY  ali  15  617....................DFRESDFSLTVLSGADLSNCDLSNTCFRKTIMRNVKLSNSILRFTDFSESCLKRADIEKANIKGANFEKANLEGAKLREACLKKTNLSGVNLERANLFWSDLSWVNLHSANLIGANLERAYLIEANLEGAILEGANLEGAVLEGANISGANLHSANLIEANLEEANLEGANLEKSNLKEAYLNKANLIG-ASLIGATLE.. 829
368 6.000e-45UniRef50_A0A0C2D878 Pentapeptide repeat family protein n=1 Tax=Enhygromyxa salina TaxID=215803 RepID=A0A0C2D878_9DELT  ali  14  471..SGANFGGGDFSGAKFSGTNLSGANFSNADFREANFRKANFSGANFSGANFGGGDFSGANFDGANLVGANLGGANLTGTDFRRGQLSGVNLSRANLSKAYLAGADLSGADLSGADLSGADLTATDLSGADLSGARLSGARLSGARLSGTDRSSADLRGAIPSGDDLHGSDLVGTD............................................. 644
369 7.000e-45UniRef50_A0A2A1ZQC4 Uncharacterized protein n=1 Tax=Candidatus Izimaplasma sp. ZiA1 TaxID=2024899 RepID=A0A2A1ZQC4_9BACT  ali  29  1..........MKMKKPIIKGELEYTKDLNGVIDSSHVDYVRINGNKLVSKDKFRIIFDTVIFDKTIFTENTFEKAEFIDCIFNNCDFSNTSFYSSTFIRCEFNHSKLSGSHFVESFLNDCLFNDCVAEYIDFADNKMKNILFNEVKMNESNWFDNLFKLVEFEKCNLKKALVHKTKLNTIDFSTSDIEDIRIDQNSIKGLTIASWQASEVCRLFGLKIK.. 210
370 8.000e-45UniRef50_UPI000C822CCE pentapeptide repeat-containing protein n=1 Tax=Faecalitalea sp. Marseille-P3755 TaxID=2015901 RepID=UPI000C822CCE  ali  31  7............IEMPKLSNDQLIPYQKNRLTD-SYYEQTCFDHLHIEQCG-ERLHLSSCKFDHCIFSKCNLERFDGMDLLFDHCDLSNLDLSHAVFHRCIFIDCRLTGADFTNTTFRNTTFQNCSAAYFNGACSSFKQCAFIQCDLSNSSFNDCEQQHLIFQECNLNQCEFHHTKMNCVDLSTSTIEGILLSLDTIKGMKVNQEQAISLVALLGIEI... 210
371 1.000e-44UniRef50_H5XZY1 Putative low-complexity protein n=4 Tax=Terrabacteria group TaxID=1783272 RepID=H5XZY1_9FIRM  ali  10  163..SRADLSGANLRRANLSGANLSEADLSGANLSGANLSEADLSRADLSGANLSRADLSGANLSEADLSGANLSGANLSEADLSRADLSGANLRRADLSGANLRRADLSGANLRRADLSEANLSEANLSGADLDFSCL.................................................................................... 297
372 1.000e-44UniRef50_R9KXF8 Uncharacterized protein n=3 Tax=Enterorhabdus TaxID=580024 RepID=R9KXF8_9ACTN  ali  25  21............LVLPTIPEELR-ALEADELLDGEPLEAIDARDLIIADGNFSELEASHARFTNCFLSCCDFSGALFTDTVFEECDFANTYFDSAGFTRCTFKNCKLTGASFMEANLEQVAFTDCTLAYSAQNRCRWWGMEATRCDFSGADMTEMELHYVLLDDDRFIGTSFFRTPLLGIDFTTCQLEGVALSMAEIYGTKMNVYQAAALARRLGVIVAE. 231
373 2.000e-44UniRef50_UPI000B9ADD13 hypothetical protein n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9ADD13  ali  13  213..SGADLSRANFIGADLSEANFIGADLKVANFSRAGIERANLRRADLSGAELKRADLSGADLSGADLSGADLSKAELVRVDFREANLSGANLSKANLSKANLRGADLSGAYVSGANISRANLYRANLSGANLSGAYLRQADLSEADLKGANLNGANLEEADFRETEFKNSEVKNAKFS........................................... 421
374 2.000e-44UniRef50_A0A0M0LAF2 Uncharacterized protein n=5 Tax=Planococcaceae TaxID=186818 RepID=A0A0M0LAF2_9BACL  ali  30  2..........PKIIEP--SQHYLTTFENEEIMLEEIEANSLLKGCQI-DCRFGTRQLNEVKFENCVFLTDDFTNMEFLDVIFAKCDLSNCNFAESVFYRVKFDTCKLIGSSFFRTQLKNVELLDCLLNYGTFSESKMNAVAFKDGQLNESTLQDVKLTQVTFQGMELNAADFSDTNLKGIDLSSCYFEQINLDPTLAKGLSIRHDQATAIVAILGINI... 206
375 2.000e-44UniRef50_A0A1I5M3U6 Uncharacterized protein YjbI, contains pentapeptide repeats n=1 Tax=Oscillibacter sp. PC13 TaxID=1855299 RepID=A0A1I5M3U6_9FIRM :  ali  23  18............................EARESDERISSAAFLGEEVENFDFTDLECSHVIFDGCQFTNCAFTGTAFYQTLLRGCSFSGCCFGSTYWKECQFRDTKADGCDFRKSRLKSCTLNGCFLRYANFFEGVWEKTDLTDCNLREAVLSAMRFSKIRLERVDVSQVDFFQTMLKNVDLSTCSIEGITVSESELRGSTIDAAQAAVLAKLMGVQV... 209
376 2.000e-44UniRef50_A0A0R2JI03 Uncharacterized protein n=2 Tax=Weissella minor TaxID=1620 RepID=A0A0R2JI03_9LACT  ali  29  51........................ELNMESIQPNDLIYGETYHDSIIADSFLP-LHFDNLTFINCTFEQTDFSHSDLLDCHFTNCDFANCSFEESAIYRSKFKKCRLTGTNFSECRFKDSLIDACDARYATFSFSKTTHFTFENTNLSESLLQQTHHKDLIFDTCDLEGADFTQTNLDGINLANSEFEQLLFSTELMRGCSINAGQAAIMLHLLGIQI... 244
377 3.000e-44UniRef50_A0A199AUC0 Uncharacterized protein n=18 Tax=Dietzia TaxID=37914 RepID=A0A199AUC0_9ACTN  ali  22  1MPPPLRRRSPRPPAAPVIPRREQLEPPRTELETDGLWDGVLAAAEHAPDAQIGGMEIRESALENLRLSGARADGLRLTDVVISGCDLSGLVADGASLTRVRFAGCRLTGIVLSDARLTDVTFEDCHADMINLRMARLQRVRLASTRCRQADLLEARIADLTTEGTDLRGAAFDRATLSAVDLRGADLEDLR-GASALRGALISPDQVLGLIGEAGIRVD.. 229
378 4.000e-44UniRef50_A0A081BPN1 Pentapeptide repeat protein n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A081BPN1_9BACT  ali  14  1...............................MRGANLSNATLSSADLTDANLNGANLRGADLTGCTLKKVDLGKAELECAELRGADFECADLGRASLCGVTLSEVALNGANLSNADLTGVVLANAELVDVDFSKAILTEANLSKAILSHLDFSKAVLQKTNLRGALLQGANLTEANLRGANLCGADLTGANVHSADLGGADLSGANL.............. 176
379 4.000e-44UniRef50_I4FE59 Genome sequencing data, contig C295 n=12 Tax=Cyanobacteria TaxID=1117 RepID=I4FE59_MICAE  ali  11  811...GANLERANLKGANLYMANLERANLYRAYLYRAYLYRAYLERAYLERANLYSANLERANLYMANLERANLERANLKRANLYEANLYGAYLAGAYLEGANLERANLYGANLEGANLERANLERANLKGANLEGANLERANLEGAFLRGANFKDANVKGTILD.......................................................... 970
380 5.000e-44UniRef50_Q38YU5 Uncharacterized protein n=27 Tax=Lactobacillus TaxID=1578 RepID=Q38YU5_LACSS  ali  25  4......................LEPYQENYFETDEAYENQLVTEMPLKEVTINMAYFKGSHFKDIQFEQMTFDNCDFQDVLFEHCALLNCSFIGNTFQRVAFDGCQLIGADFAEAGLRDVRFVACKLDYAGFNQTRMRHVDFEECSLQEVAFEYVDWQWLMMSGNDLNGIDLTGTNLKAFDLSRNTFEKAVFSLDLLRGATVSSAQTLVIMSALRINVR.. 200
381 5.000e-44UniRef50_A0A1Q7WAL9 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q7WAL9_9ACTN  ali  24  4.....RTVSGLRILVPGLDPADLEPVTE---APDDDLDDAKVEGAVWPGLELTGARFCGSHLVAVEMPGALWRNGGLSGCRLERVDLSGARLAGTTIERCEFVGCRLTGVQLTDVTLRNVVFEDCRFDYASLVNLRVAGTVWQGCVLDHAVLTNCRLPGAVFTGCRFGELELHECDLRGTDLTGNELAGIT-GLASLAGAVLDDDQLADLAAILGVTVR.. 218
382 7.000e-44UniRef50_A0A1Y4T2X1 Uncharacterized protein n=6 Tax=Faecalibacterium TaxID=216851 RepID=A0A1Y4T2X1_9FIRM  ali  21  34.RPGVMGRKDRLPAAPALPAGGQGLVLLEGPEGEDEGAGLWVRGADLSGEELDGLTLSRCLLEDCRLTGAGLRKAALTDCILRCCDLSGAQGYDGSWQRCAWQGVKALGANLSGSRLKDWSCTDSRLEALRLDDGVLEHASLLRTSLAGANLAGLRWKQLVLEDVDLSGACVTGASLRGLDLRSCRLDGLTASLRELRGAIVDPIQAAVLARLLGLDIR.. 263
383 9.000e-44UniRef50_R6SIB3 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=R6SIB3_9CLOT  ali  26  1..........MKIVKPKITNITKK--DIKSCFATQEFFEAELENETPTNLTISDINIDSCSFKNVDFSNISLASVDILDSIFEDCDLSNQNFNKQFIDRVIFKNCKLLGTTFIDSNIRNVQFIDCNCRYINFSGADINNLHIVNSTFQNSSFNETKTKEVLLEETIFEGSEFAGATLKNVDFTTCNINGAIFDQKSLKNIIVNNFQAASIATMFGVIVKD. 208
384 1.000e-43UniRef50_D5A367 Pentapeptide repeat-containing protein n=6 Tax=Arthrospira TaxID=35823 RepID=D5A367_ARTPN  ali  16  28......................................ERDFEDINLNEINLSRINLAGANLSGASLSVANLSASDLREVNLTRANLNVARLSNANLTKAILNQATINVANLVRADLTEAQLINTLLIRAELVRAKLSKANFTQANLNGADLRESKLQQTNFNGANLSGANLRGANLPKADFTNAELRQANLTYANLSNADFSGANLLQGADLSGANLTE. 233
385 1.000e-43UniRef50_A0A261KT47 Uncharacterized protein n=2 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=A0A261KT47_9CYAN  ali  13  101..SGADLSRANFIGADLSEANFIGADLKVANFSRAGIERANLRRADLSGAELKRADLSGADLSGADLSGADLSKAELVRVDFREANLSGANLSKANLSKANLRGADLSGAYVSGANISRANLYRANLSGANLSGAYLRQADLSEADLKGANLNGANLEEADFRETEFKNSEVKNAKFS........................................... 309
386 1.000e-43UniRef50_A0A1Y4MUT6 Uncharacterized protein n=2 Tax=Erysipelatoclostridium TaxID=1505663 RepID=A0A1Y4MUT6_9FIRM  ali  27  22....................................YYQGIFTKNPKQSITIKNTTIEQCQFEKIDFNLIELNNTHLVNCVFKNCDLSNLEFDHVSLHCCHFINCKMIGIGFIDCSLHDLLFLDVQGRYMNISYGNIRNVTFQNSVLDEASIMEVDVKDLEFNQVSFINGEVFKTKLKGMDLKTTNIEGLRIDQTSLVGIHVDMYQAVALASLLGIIVD.. 204
387 1.000e-43UniRef50_UPI0006916E58 pentapeptide repeat-containing protein n=1 Tax=Erysipelotrichaceae bacterium NK3D112 TaxID=877415 RepID=UPI0006916E58  ali  31  13...........KLSAPSVICEPEKGT-LSKGFSEYRTEALLFCDE-VCERELSQQEFFECVFRNVTFSDCD--SCMFVDCIFDHCDFSNADFHETVFRRCEMKMCRMTGTDFSYGRFQDVLMEGCESSYANYACSKWRIASWKDMSFTEAGFMSCSFEDVRVKRCRFINADFNDTKLKDMDFSDSDISGISLNVQNLKGAVMNSSQALACTRLLGITIKD. 218
388 1.000e-43UniRef50_A0A1I2UTC6 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1I2UTC6_9FIRM  ali  24  3.......IKRPQISKELIQIDDFTSYAQDFLSEELPISEIKSCEERIEGAGFFKIEIRKSIFENCTFHNCDFEKASFVDVVFQSCDLSNSKFSGVYFERCRFVSCKCIGIDMSDTVVKQTTFEQSNFQYSYFNKTKMTDVLFDYIDFSESSMVESKLKRFVAMDSKFVKNNFFKTMLATVDFTNNEFVAPMVSTPELKGAIINMFQAANLIGLWGVIVKQE 218
389 1.000e-43UniRef50_A0A0P6X0T0 Uncharacterized protein n=1 Tax=Leptolinea tardivitalis TaxID=229920 RepID=A0A0P6X0T0_9CHLR  ali  25  1..........MKIHSPRFPK-PMPVTELEPLGDHAHIFQSSLTGEEYNNLTAGGLIFEQVKCRKLQLMRSKLPGFRTVDSLFDTCEMSGSEWDRVFFRRVVFQGCRLLGTQMLEGIFEDVEFIHCQMEGLSMVSAVFKNCQFTKCILRKATFDSADLRKVAFLDCDLTEANFHLAKLDGTDLRTSIIDGLQVGVEEMHGAIIAPHQVLQVVGLLGVKVQD. 209
390 2.000e-43UniRef50_A0A2R5FYC3 Pentapeptide repeat protein n=1 Tax=Nostoc commune NIES-4072 TaxID=2005467 RepID=A0A2R5FYC3_NOSCO  ali  11  132..SDANLSRANLSRANLSRADFSNADLTGANLIGLDLTGSKLTGSKLTGANLSNADLTGANLIGIDLTGADLSGAFLVDANLGNANLSRANLSAAILNNVNISGANLNGLEFSRTNLSEANLNNVFLVNANIKYANLSGLDLSGADLTGADLSYSDLRGTSLNGAGLIRTQALRTNFTAANFTGACLEDWNINSA.......................... 334
391 2.000e-43UniRef50_A0A2V2DTS6 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2DTS6_9FIRM  ali  25  14.............................AYETDDPVENVLFQKERLVRVNAAKTAFRGVVFESCTFEDCDFSGCDMRKAIFRKCLLVGCDFSGGYWNGCTLDSCNASGCDMGDSRIVDTNIQGSQFQYAVCWRTRWEDCRISDTAFTEACLNEMILKRTEFYNVDMTKAELMGTMLKGIDLSGCTIDGIVISDSELAGAQVNVGQAIALARLLGVKV... 204
392 2.000e-43UniRef50_R6II32 Uncharacterized protein n=2 Tax=Phascolarctobacterium TaxID=33024 RepID=R6II32_9FIRM  ali  25  12...............................EDDRRISDMSFHDETLNNEDLSKIIFHNVQFSKCRFTRCDFSQSRFLSVAVKNCDFSNCNFSESFWKQVTIADSRGNGADFSQSCCKELTLYDSSFAYANFSKSQWENSAVSNCSFKESFWAEVRLKKLTLAASVFSGADFFKTPLKDLDFSDCKIDGITVSETELRGMQINLLQSADIARLLGIKI... 200
393 2.000e-43UniRef50_A0A1Y4AKA7 Uncharacterized protein n=2 Tax=Coriobacteriales TaxID=84999 RepID=A0A1Y4AKA7_9ACTN  ali  30  34.................................EAEVSRGAFRALELIGSDAADATFEQVLFHDCLFEDVDFSNSTLTDVRFENCRFISCRMERCWLNRVDFCSCSAPGLSLIKSRITSAFIDDSQLRYANFSEANVRGLRVCTTNLAESSWHATALKSAGFSDCDLTGAEFIRTPLSGINLTSCRIGGLVVSQDELCGCVIAPEQAVDLIGLLGVHIADD 223
394 2.000e-43UniRef50_A0A0R2HB03 Uncharacterized protein n=2 Tax=Weissella viridescens TaxID=1629 RepID=A0A0R2HB03_WEIVI  ali  25  2.....................TDETLPISDLEYGGSYTNCVIIN------DGAPLRLDTMQFEKCTFSTINFDESEILDCTFIHCDFSNTDWSGSIIYRSLFENCRLVGIDLAQTQLKDTRYTNCHALYANFSEAKMTNTAFQTTQLTESYFQNLSIKKTTFVACQLDGADFGGTSLKGVDFSKSNFESLVFSPELMAGCTLNQEQAAIFMINLGVKIK.. 194
395 3.000e-43UniRef50_A0A0V7ZLD5 Uncharacterized protein n=1 Tax=Mastigocoleus testarum BC008 TaxID=371196 RepID=A0A0V7ZLD5_9CYAN  ali  19  72...................................................LETKNCSGCNLRRVNLNRANLRNAKLNRANLRNANLRYADLSYADLRNTNLAGANLRNTNLRGARLNYAKLKDVDLRGAKLAGAELDGIDFEDVNLRGVNLNGVDLSDVDLRNIDLSGVDLQGTILRGSDLRGVNLYGVNLKGVDLSGVNLSGVDLRG-ANLDGADFR.. 238
396 3.000e-43UniRef50_A0A0R2NKT3 Uncharacterized protein n=1 Tax=Pediococcus argentinicus TaxID=480391 RepID=A0A0R2NKT3_9LACO  ali  24  1................MLNQVNLTKQPFEEIYNSEDFENALIEHELITQNSIHHPVFENCLFKNVTFIENDFEILEINNCQFVNCDFSGEDYSKSSFFKSEFKESKLVGTKLPESYFSEVHFTDCKMDYATFSDSKFKSTKFTDSNLTSSDFVHCTLQKTIFDRNDLSEVSFLETSLARIDFSTCKLERLEVAQNQLHNCIINREQAAEFAQFLGIQIR.. 206
397 3.000e-43UniRef50_A0A075TUZ0 Uncharacterized protein n=2 Tax=Weissella ceti TaxID=759620 RepID=A0A075TUZ0_9LACT  ali  26  5......................DARLALDELEFGNTYIDCHLT------YSNDALRLENITLKHCTFDQSDFSQSEWQDCVISQCDFSQADFSSAIIYRTTFDHTKLMGANFTKSRLNNVQIKNCMADYAIFAEGQWQAVTFDDVRLRDTSFQATKIRGLIFKGCLLDDADFYETSLKGVDFSQSEFSSLRFSMEQAQGAIMSAEQAVQIALNHGISV... 195
398 3.000e-43UniRef50_UPI000A271507 pentapeptide repeat-containing protein n=1 Tax=Clostridium merdae TaxID=1958780 RepID=UPI000A271507  ali  25  5.........SPQLPEEFIRTNNFSAYAKEFLESELPISAIKSNETVIQGEDFYSIEIKESVFDNCTFHACKFQKASFTDVIFQSCDFSNTEFTDAYFERCIFVSCKCMGLDMSETVIKKTVFKDTNLQYACFDRSKLTDVLFEEVDFTESSMAEAKLKNFEASKSKFLKNNFYKTLLANIDFTDSDLAAPTVSSPELKGAKINMLQAADLIRLWGIVVK.. 216
399 3.000e-43UniRef50_A0A1M6Y8M1 Uncharacterized protein YjbI, contains pentapeptide repeats n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1M6Y8M1_9FIRM  ali  29  1..........MKINQPQTANLREAGPIVNQIIEELAAERLLFSSDYISGEDLSGIDYSCVEFNNCKLLNCNFNKSGFTNVYFKYCDISNCTFENGYFNQVEFLSCKGVGSKFQNSTIKHVLFNDVNFSYSNLEHSKLQKVIITSSDFSSASFAECILKELELRDVTLNNCDFFKTPLKGMDFRESRIDGIILSDSELAGAIVDTYQAAALAHFLGVEVK.. 215
400 4.000e-43UniRef50_A0A0R1W4F1 Quinolone resistance protein n=3 Tax=Lactobacillus TaxID=1578 RepID=A0A0R1W4F1_9LACO  ali  24  3.....................TKQELPLDATVAGETYEQCHF------DYAQDTIKLDSVHFINCTFEQTDFKFSEWLDCTLTQCRLPNADFSNSLIYRTKFMNCQLTGVNFTRNRWHDSTVSDCQGMYLIMAESILKNCQFNETKLTDSSFQSVRVSKLVFSECELSGADFTDTALNHVDISKANFESLTFTPSLIRGLKINSWQAAMLLGEMGVDVAD. 196
401 4.000e-43UniRef50_R7GE53 Pentapeptide repeat protein n=1 Tax=Clostridium sp. CAG:440 TaxID=1262807 RepID=R7GE53_9CLOT  ali  29  12.................................ELDVKNEVFLNYNEQNIQAEKIEFVNTKFNNCKIINANFIEASFTNVEFINCDFSNTNFNEANFIKTKFINSKFVGCNFVESNMLENKIQESNFSYSNLTSSEIKNTEILNSNFKNSSICECILKNVKFKDSNLTLTQLFNTSLNNIDFSSCEIQGIGVNIKDLKGLKVNDIQALELSKILGIIIK.. 197
402 5.000e-43UniRef50_G5FCV3 Uncharacterized protein n=8 Tax=Clostridiales TaxID=186802 RepID=G5FCV3_9CLOT  ali  27  2......................LEQDLITASAEDDIICAAAYAGEELAAGTF-KTDFQRTSFTSCRFAGCDFSGSSFFDTSFTNCDFSNSRFSGCYFKNCSMNGCKGDGCDFSQSTFIASVLEKGTYCYGNFSNTLWKDSSIVQAKLCMAYLSDSKFKKLKFDQVDLTRAEFFHTSLKGVDLSGCLIEGITVSESELRGLKIDASQALDIALLLGVKI... 198
403 5.000e-43UniRef50_U4TUU5 Uncharacterized protein n=2 Tax=Lactobacillus TaxID=1578 RepID=U4TUU5_9LACO  ali  22  1.................MPAQEEPAVVTDTKIGLDDLAPETIYRHCTIDYSNQDINVQQVTLDNCTFVQHDFTKSTWMDCTFIGIDWSNTQFGGSYFTGCTFKEAKLVGADLYDCGIVDLTLADCLANYVNFSESIIKGLQARDCQLLESYWTAVRFRKIRFQRCDLTRADFGETKLKGIDFTSSELAALRFDWHLAAGMKISPDQAVNLVGMLGIDV... 202
404 5.000e-43UniRef50_A0A1H4M9A8 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Streptomyces TaxID=1883 RepID=A0A1H4M9A8_STRMJ  ali  21  12..PRIKS-----PTAPHIPTLRLAEMPTDDLDDDAIVKGVKFDSTHFVGLEVEAAEAEGCAFESMRFTGTSLRRSQFTDCAFNTCDFAQVAAHDVSLIRCTVDGSRMTGSSWSHGIFRDVRFEGCVSTPAMYRHTKLYSVTFSDCRMQGADFQSSQLRNVLFEGCDLTGTQWANCQLGSVLFKNCTLIDVG-GAASLKGATVSGPGSLELALSL....... 218
405 6.000e-43UniRef50_A0A151FX09 Uncharacterized protein n=1 Tax=Bradyrhizobium liaoningense TaxID=43992 RepID=A0A151FX09_9BRAD  ali  14  208.........................................LFRANLSGQWLVGEEFGGADLRFANLTGTNLGSADLRGADLGRANLSSAKLNGTNLSSAKLVNANLGGADLSDADLTHADLEGANLTGARLASADLTHAHLEGANLTGAQLASANLSNADLSSADLSSAKLIDANMRSANLAGANLGFANLTDAELRDASLTGANL-GYADLSRADLNN. 389
406 6.000e-43UniRef50_UPI0003F58684 pentapeptide repeat-containing protein n=2 Tax=Solirubrobacter TaxID=207599 RepID=UPI0003F58684  ali  23  8............PAAPDVVDEELDAWVAEPLATGFAIADAHVAHADLAGARAAGGSIARSRVSSVSLASSRLRSLSLVDVVVGDCDASNADWTGGRLKRVVFERCRLTGAALTEVEAEEVVFRDCRLDLATFRAARIVRAVFERCRLDEADLYAAALQQVRFTDCRLHRVDVDQARLASVDLRGSDLDDPRGDLRALRGAIIDSVQLAGLAPLLGIEV... 217
407 7.000e-43UniRef50_B1WS62 RfrA family pentapeptide repeat n=14 Tax=Cyanobacteria TaxID=1117 RepID=B1WS62_CYAA5  ali  19  34....................EFPELDLSGADLSRVMLICVDLSRSNLMGINLSRGFLTKSNLSQASLNWADLSYAKMSQSQLIKTDLTKANLTGAFMVKSILIKAKLSGANLSHSNLRSADLSYANCCGANLQKINLREANLTGVNFNWANLSQARLSCANLQEVSFFGANLSHTFIKDVDLSYADLEGINLQGAKLQGANFQGAKLHHIANLQGANLRD. 247
408 7.000e-43UniRef50_R7F6E4 Uncharacterized protein n=2 Tax=Clostridium TaxID=1485 RepID=R7F6E4_9CLOT  ali  27  2.......................EENFFDKLEIEEELKNETVQNMSQKNLNVYKKDIDNSKFIHTEIIDSSLEKVYFKDIVFDNCNFSNTTFETCSFINCKFKNCKMTGCNFIENTFMSVQIQDSNLNYSNMSNTTFNNLKLKDTTLINSYMQDSILKNVKFDNIDFTKAQIFNTRLKDIDLSTCIIQGLSTTLADIKGAIINELQIMDLAYLLNIKIKD. 198
409 8.000e-43UniRef50_R7L1D8 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R7L1D8_9FIRM  ali  27  3......................LQEIMLNAQENEDDIEKQSFSDDMVRGIKLYGIDIEESDFNSCRFRECEFEKVYFKNVSFKGCDLSNIHMYDCTFKQCSFDKCRITGSSFSESLLESCVFSDCTGPYSSFGACTFKKSSLKDCTLNESSFADAKLRGTALKNNVFSGCDFGGADIGGCDFSSSSISGARFSLSALKDVKVNYEQAIELAKLLGLKI... 198
410 1.000e-42UniRef50_A0A1U9JNH2 Uncharacterized protein n=1 Tax=Aquaspirillum sp. LM1 TaxID=1938604 RepID=A0A1U9JNH2_9NEIS  ali  17  32............................DSLLGDLGLADADLAGADLFTANLPGADLAGADLSNAKLVGANLARANLAGANLAGANLARANLAGTDLAGANLPNANLACANLAGANLAGTNLTDANLAGADLPNAKLAGANLADANLAGTYLPNAKLACANLAHTNLASVNLSNADLSGADLSDAYLTRANLAGANLSGANLPGTNLSGIANLSGANLS.. 226
411 1.000e-42UniRef50_A0A1C0YUZ6 Uncharacterized protein n=1 Tax=Caryophanon latum TaxID=33977 RepID=A0A1C0YUZ6_9BACL  ali  27  4..........................................................GIVFERCHFVDCTFSHIDFTDASFLHCDLSNCTFSNSLLYRTAFTNCKMVGTKFVGMTLTATSFVDCLMERAAFEESVWKHVTYQASTLTNSDWYAVKHDHLLIDRCELTDARFEETTLNGVDISTSQFSALHISKDDVEGCIIHAEQAPILLAICGIRLKE. 165
412 2.000e-42UniRef50_A0A132P484 Pentapeptide repeat-containing protein n=58 Tax=Firmicutes TaxID=1239 RepID=A0A132P484_ENTFC  ali  26  4...............PKVNEASLNKGSFFHIYENEDFENILSQKEVIENQIICHPIIYKSIFKHAFFASNDFQRMEITDCIFENCDFSGCILTKSMLHRVKFVNCKLTGTKLMESYIGNTLFENCKMDYVNLSGSNIKESNFEHSVLSSADFVDCSLTKTMFYTNDLENASFFDTDLKNIDLSSNSFEMIEVRPEHLKNCTLNQLQALGFARKF-LQIK.. 208
413 2.000e-42UniRef50_UPI000CF96E8D pentapeptide repeat-containing protein n=1 Tax=Anaerotruncus sp. Marseille-P4302 TaxID=2044573 RepID=UPI000CF96E8D  ali  25  30.........................................YEKETITGEIIDH-SFSGCRFDHVTLPES-MESCGYTDCLFVHCDFSNCRMQESAFRRCAFEDCRLIGTDLEDSFFEDIRFQHCSMRYASFGASRWKRGAILSSECSECSFTSCTFADMELSEDLFEQAEFGGCRLAGMDFSTCSISGMLVSMVDLKGIIVNEEQAVVLAELLGIHVKHD 207
414 2.000e-42UniRef50_F3NSV8 Uncharacterized protein n=8 Tax=Streptomyces TaxID=1883 RepID=F3NSV8_9ACTN  ali  26  13...............PPLEPYGDGP-----LEPEGDYDGLEFPGTDLAAQDGTGSRFMDCALTGCALDETRLAHARVYDSRLSGIRGVGTNLADATLRDVELVDARLGGTRMHGAVLERVLVRGGKIDYLNLRGARLRDVVFEGCVLVEPDFAGARLERVEFVDCVLKEADFGAARMKDVDLRRAAELGIARGVERLSGAVISPAQLMELAPVLGVKV... 214
415 2.000e-42UniRef50_C6BS10 Pentapeptide repeat protein n=4 Tax=Desulfovibrio TaxID=872 RepID=C6BS10_DESAD  ali  23  2.............................HIEDYESYENISFENVDLEDQTLLEVNFYRCTFEASSLQYAEFIDCEFQECRFVGCNMSVAVFSNSKVIDTEFRDSKLLGINW--GNLGPVIVSNCLMDRCAFSSQNLLKVKFNSCSLREASFSDCKLARVKFDDCDFAGCQFHQADLSSADFTSSRNYFMNAETNKLKKTKFSLPEAVSLLANLDIELKE. 193
416 3.000e-42UniRef50_UPI000CF3FD26 pentapeptide repeat-containing protein n=1 Tax=Candidatus Saccharibacteria bacterium YM_S32_TM7_50_20 TaxID=2056494 RepID=UPI0  ali  22  1..........MKLSPPLLKYAGSQTIPAAQLQSDITLEQVRLTDFEATSLIARSLAFDEAIFEKVTLTQAKLEKLSIGDAELTTCNLSAVDCNNASCIRVCFKDCRLTGIDFSRSTLKDVLFDTCKLDMANFRFSKLNRVTFRNCVLDEADFQEAELHEVSFALSHLSRVELTHAKLTKVDARSATLHDLR-GWSYLHGLIIDGTQAPELAAELGIHIE.. 213
417 3.000e-42UniRef50_UPI0008DB1D01 hypothetical protein n=1 Tax=Enterococcus timonensis TaxID=1852364 RepID=UPI0008DB1D01  ali  27  3...........KLMAPTLPTHFSSVSEVIS----EEIYDGISLSGNFAKKSNQNITLRSSHITNGQVASVQFRNFSTTDVLIENTDLSNVDFSGCSLQKTAFKNCRLMGANFSESYLEDVTFTDCQMDFSAFNYTKVKFISFTSCQLKESEFYALTWQNLTFKQNDLTKASFMETKLDKLDLTHNTFESLQFSQALMKGVILTPAQGIIFLNLLGIDI... 205
418 3.000e-42UniRef50_UPI000833C9A1 pentapeptide repeat-containing protein n=1 Tax=Actinomadura hibisca TaxID=68565 RepID=UPI000833C9A1  ali  21  1....MRTGHPLRPRAPKIPKALAPATDADALIHDGKYLSVAYGPVTLAGADVEDPEFERCRFEQTRWAGVTLHRAGFADVAFTGCDMANARLFNSRMFGATVTNCRMTGLHLSEGGLRDVVFDGCRADLASFRFAHLRDVVFRDCNLSEADFQNAELHNVRFERCKLVATQFSFVTMNTVRFSGCDLNGVR-GVTSFEGAIVASALLDALASALGIRIED. 221
419 3.000e-42UniRef50_C5R9Q2 Uncharacterized protein n=4 Tax=Lactobacillales TaxID=186826 RepID=C5R9Q2_WEIPA  ali  29  3.....................TKQQLSLDEVVPGEIYEDCLFL------YSSERIHVDSVKFKNCEFQQTDFSDSEWLDCQIESCHFLNNDFSSSVFYRTIFNKCQLMGTDFSNNHWKNTIIIDSKADYLNLSGSKIETSQFEKSSLVSAYFQNMQIKKLKFTQCELDKADFLDTDLVGVDISKSFFETLNVTIDQVRGCIISPVQAIAFISLLGVKINDE 197
420 4.000e-42UniRef50_A0A133XWX5 Pentapeptide repeat protein n=1 Tax=Aerococcus christensenii TaxID=87541 RepID=A0A133XWX5_9LACT  ali  15  24.........................................................ECADLRHADLKNIDLVGTNLKGAHLIGADLKGANLISAHLKYADLEGANLEGANLEGANLEATNLEDADLEGAGLKDAHLRGADLIGAHLKGADLEGADLEGVSLNEANLKGAHLKYAYLVGADLEGAHLEEADLKDANLEGANLEGTDLA-CADLEGANLK.. 184
421 5.000e-42UniRef50_A0A2S6RU33 Secreted effector protein PipB2 n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6RU33_9PROT  ali  14  197......LSMADLSDTTLISANLAQASLRSAFLNGADLSEANLESADLTGADLTDAILRNTKLEKVALTGAKLNGSDLTGANLKDANLTDATLSGANLTKTELEGVNLTKANLSDAILQDANLSRAILREANLSRVNLSGADLSGAVLRKANLTGADLTNTRLVGVD-----WRGANLTDVDLSTSRLTQSEVADAILCGTRM................... 387
422 5.000e-42UniRef50_S0P2T4 Uncharacterized protein n=3 Tax=Enterococcus TaxID=1350 RepID=S0P2T4_9ENTE  ali  26  5.......................QTLTIDQLEAGETYKNCRLA------PSGKGSSFSDIVFDHCEFEKQRFTHSEWLDCTFNNSVFSNQDFSDSVFYRCSFDHCQLLGTNFSRNRWKETRVIDSRGDYLNFSESLMEKNVFVQVSLNEAFFQQVTIKKLVFDQCEMNQADFSETKLAQVDFSTSAFETLYFSPQLMKGAVISPYQAVQMMAMMGVKIR.. 195
423 6.000e-42UniRef50_A0A0C1N1S1 Uncharacterized protein n=2 Tax=Nostocales TaxID=1161 RepID=A0A0C1N1S1_9CYAN  ali  12  33...............................LGERDFTQVNLENTDLSQADLAGINLEKANLKGANLSQTNLSEANLISADLRGANLTQTNLRCARLNDSDLRQADLYRANLSWANLSEQDLRGANLARVDFQGADLSAANLSEANLKEVKLDAANLKGAVLVRANLSYAYMPRVQLVQANLQKATLVRAELTAANLEQCVLDRANL.............. 213
424 6.000e-42UniRef50_A0A1J0AH32 Pentapeptide repeat protein n=1 Tax=Gloeomargarita lithophora Alchichica-D10 TaxID=1188229 RepID=A0A1J0AH32_9CYAN  ali  11  65....TDLSGASLRGAGLMIAKLSGAILWQTDLTQADLGGANLLQGDLSHAKLVEADLSRALLGGANLTQANLSQANLWDADLSRANLRQADLTEASLRGADLSRAVLQGAVLSRAKLSSAILNGANLREAKLDGANLTQCDLSSANLREANFSEADLTGTIFNRAILTGTIL................................................. 232
425 7.000e-42UniRef50_A0A0R2IDY3 Uncharacterized protein n=8 Tax=Carnobacterium TaxID=2747 RepID=A0A0R2IDY3_CARML  ali  25  1..........MKIVKPK---QIITALVEDQIVKIEEVESHTHYKKCQITSNFGIKKINEVIFENCTFDRLDFKQMEFLDVIFDNCNLASGDFSEGLIYRSEFKNCQLSGANFIDSKQKNVKWQGCLLSYANYSSSNMESVHFIEGRMTESYFQDCQLKNVIFEEIDANGVDLVGSKLTGLDISKAHFDFLNLDISLAKGLKIGYDQAYKLITLSGIEIVE. 207
426 8.000e-42UniRef50_A0A1W1I2L3 Uncharacterized protein n=1 Tax=Nitrospira japonica TaxID=1325564 RepID=A0A1W1I2L3_9BACT  ali  16  78...........HRKADLCQADLRQASLAQANLERANLEGAILRQADLSQSTLVQARLAETDLTKAHLEMANLSGADLRRARMSGADLTQVVGDEAAFLGAVLIEARL-----REAALERAHFEGANLTSADLTGADLVDSHFYGALLHRAILSGADLLEADLRRTDLSKAHMKGTNLQSALFDGAILRGTQLVDADLEGAYFDDADLTE-ANLQDALLR.. 279
427 8.000e-42UniRef50_A0A0G3CFF0 Pentapeptide repeat-containing protein n=2 Tax=Methanosarcina barkeri TaxID=2208 RepID=A0A0G3CFF0_METBA  ali  11  258..KGADLYGANLIEAKLEGANLERANLEGANFKGANLQGANLKGADFTEICFSGANFEEAHLEGANLKKAYLCEANLKKAHFEGANLEGANLEGANLREARLCEANLKGASLDRV--PHLCLEGANLERAYLWKADLTGANLEGANIKGADFKGAILEEADFTEVDFKE.................................................... 428
428 8.000e-42UniRef50_A0A1G8BUP0 Uncharacterized protein YjbI, contains pentapeptide repeats n=4 Tax=Arthrobacter TaxID=1663 RepID=A0A1G8BUP0_9MICC  ali  24  1MSTTGKWADSIRGMA----GVGEVRSGLDAGIGREDFSGLRFVDCDFTELRSEGSIFSGCVFRNVRFNVSSHVNSAFDNCRFEHCN----------FFDAGFDACRFTGSLFSDSSLKPVRVEGGNWSFVSLAGADLQRSSFSQVNFTEADFSNADLRNATLRDCRLTSISWNGARLRGADLRGSTLEGIDAAEFNVHGAVVDVAQALTVAEAHGAVIR.. 208
429 8.000e-42UniRef50_A0A1H1P775 Pentapeptide repeat-containing protein n=2 Tax=Microlunatus soli TaxID=630515 RepID=A0A1H1P775_9ACTN  ali  23  2IRPTESTTSSTRVRSP-LQPRIRTPRPVDGADGELIMNGVQVRSIDLTGVDSDFAELAGSRLAEVRLSASQWRHAAFADSELIGCDLANAEFVESGWQRIAIGHSKLVGIRAAGCSWKNVRLSDSMINLANLRFLEAQRVQFEGCNLTGVDLGSAQLTDVRFVDCDLSEADFSNARLARVRFERCRLARIG-GVAGLAGASVDLLQLADLAAALGLRVETE 227
430 9.000e-42UniRef50_A0A0B5I726 Pentapeptide repeat protein n=14 Tax=Actinobacteria TaxID=201174 RepID=A0A0B5I726_9ACTN  ali  21  1....MATSRKKKVAGARRPEVRLPPLEAYGLDPDGDYDGLELAGLDLAGQSGEGARFLDCALRECGLDGVRLTGARFLDSVLTGVRGVGTELAGAQLRDVEVVEARLGGTQLHGAVLERVVVRGGKIDYLNLRAAKLKDVVFESCVLSEPDFGSAVLERVEFTDCVLTGVDFTGARLVDVDLRGVQRLEIGGGVESLSGAVISPMQLLDLAPVLGVRVEE. 222
431 1.000e-41UniRef50_A0A1F6CAE6 Uncharacterized protein n=1 Tax=Handelsmanbacteria sp. (strain RIFCSPLOWO2_12_FULL_64_10) TaxID=1817868 RepID=A0A1F6CAE6_HANXR :_  ali  12  33...GANLQDADLRNADLRDANLEGANLQDADLRNADLRDANLEGANLQDADFHDAVLRDANLEGANLQGVNLSGRSLKDANLEGANLEGANLEGANLQDADLRNADLRDANLEGANLQDADFHDAILCDANLEGANLQGADFHGADLREANLEGTNLAGFKYQGGSLEKVR.................................................. 210
432 1.000e-41UniRef50_A0A0M9DXV6 Small GTP-binding protein domain protein n=1 Tax=Candidatus Magnetomorum sp. HK-1 TaxID=1509431 RepID=A0A0M9DXV6_9DELT  ali  71ILSRANLSGANLSRANLGGANLGEANLSGANLIRANLGGANLGEANLSGANLGGANLRRADLSGADLSRADLRRVGLRGADLRGANLREANLSGANLREADLSGANLSGADLNGANIHRTNFINAILEGVDCKSINLSRNQLKELNLTSINLSGNQLKE.............................................................. 237
433 1.000e-41UniRef50_A0A242A9A3 Uncharacterized protein n=2 Tax=Enterococcus TaxID=1350 RepID=A0A242A9A3_9ENTE  ali  25  22..............................LEEEKIFEGAFFEDADCSYDTCKNLVLKQCQLKKITLQKTRLEQWECQHVVFEQCDFSNLECYGASFHRVIFKQCKLTGTNFADSYFRDCTFIDCTANFSSFSNTNIRTMLIDHCQCNDSEFTEIDWKHLTFKDNQLNNSNWIHTPLASLDFRSNRFEQIALSTDQLKGLIVDQEQGLIIAAGLGLVID.. 210
434 1.000e-41UniRef50_UPI000C1C0D0B pentapeptide repeat-containing protein n=1 Tax=Miniphocibacter massiliensis TaxID=2041841 RepID=UPI000C1C0D0B  ali  27  19...............................VEDDIVSFEEFEKIVAYEIDFSKIEFRNTEFRNCEMTNCSFKNSYFYKVVFRNCDFSNSNFEDVFFKECKIYDSKGVGSNFYKGIFKNVIVEDTVFKYGNFVKNSWDDVKITNSDFSESNLMESKFKKVKLKEVDLHLANVFHTLFKGIDLSDSNIERIVLSDDELKGTTLNSIQAVEVVELFGIKV... 207
435 1.000e-41UniRef50_A0A0R2B7C4 Uncharacterized protein n=4 Tax=Lactobacillus TaxID=1578 RepID=A0A0R2B7C4_LACCL  ali  31  19......................................DTTYVNCEV-GYANHNSDVSDVVFDHCTFKQTNFSNGTWIDCLIKNCDFTNADFTRSYWLRCELQDVKLMGANFGESAIKKLKLTNCVADYCNFSDSKVKDFSAMGSRFIESYWNNIAFTKTAFAECDLTEADFSETKLKGVDLSSSQVAGIRLNLQLARGLKVSTFQAADILAGVGVEV... 198
436 1.000e-41UniRef50_UPI0003FA4462 pentapeptide repeat-containing protein n=1 Tax=Acholeplasma axanthum TaxID=29552 RepID=UPI0003FA4462  ali  25  1..........MKINKPNVSIINEKTLEL--FTYENEYTNALIEGNDYDSFTISDTTISSCIFKDIDFEKISLTNINIVDSVFENCNLSNKVFDKKLLRRVIFKNCKLFGSSFIDSSLQDIEFLSCNLKYLNFANANLKNIFFNTSDLSNSFFMETKNKNLYFQETKLNETEFIKTTLTKVDFSSSDIFGTHFDLLSLRGIIIDEFQSRYLVGMLGVKIKE. 209
437 1.000e-41UniRef50_R5T6K8 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:710 TaxID=1262833 RepID=R5T6K8_9CLOT  ali  30  22..................................DSFSNVIIETEPDENIVISDVTFDSCIFKNIDFSNIELNNVDLIDVIFDSCDLSNKEFNERLISRVEFINCKLVGTTFIDSSVRDVLFNKCQAKYINFSDSIINKVSIENTDLTDASFNCVKIKDINFSKNNFYRCEFLKTKLTNVDFSDSNIEGIIFDNYSLKGIIIEPFQSASIVGMLGVNFKD. 207
438 2.000e-41UniRef50_R7HH63 Uncharacterized protein n=1 Tax=Mycoplasma sp. CAG:472 TaxID=1262904 RepID=R7HH63_9MOLU  ali  26  1..........MNIIKPKIKFTEE------FIFVDNVYKNASFTKNPENKVIIEDIDFDSCIFKDIDFSLIELINVNFLDCIFESCDLSNKNFDEKLIERCEFNSCKLLGSSFINASLKDILIDNSTLKYVNFSGTSMNKIKITNSNMSESYFTETKFKNIELDNNNFNKAEFLQTKLYNIDFSNNDISEIVFDNYSIYGAVIDPSQSQFIVGSLGVRFK.. 203
439 2.000e-41UniRef50_A0A2U3AJA2 Uncharacterized protein n=3 Tax=Kurthia TaxID=1649 RepID=A0A2U3AJA2_9BACL  ali  31  4..........IKPTATMHDIISDSRIWLSTLAVETHYKDCVIMWDD------SSTTISDVTFEHCDFQDFDFSNFELLDVTFIQCDLSTIKFHNAQLYRSEFHSVKLLGTEFLHTTQKHAGYYDCVMNYSLFTDSQLKQCIFDKCELKETYYQEMTLNEVEFNYCLLHQSNFSHTSLKGINLSTSEFDILTVDAQLVKGLTIRQDQATAILPSLGVT.... 204
440 3.000e-41UniRef50_A0A2S6RNF8 Secreted effector protein PipB2 n=1 Tax=Alphaproteobacteria bacterium MarineAlpha9_Bin6 TaxID=2013101 RepID=A0A2S6RNF8_9PROT  ali  12  159..SSANLTMAYLRKANFSDANLDGAILRGANFSGANLNGAELRHADLSSADLTKANLRKANFSHANLDGAILNYALARGANFSGANLNGVELRHADLSSADLTRANLRKANFSHANLNGAILSYALMRGANFSGANLNGVDLRHADLADVNLTGTDLSGLELSPDHLVAAVLCRT.............................................. 336
441 3.000e-41UniRef50_A0A1U7IB45 Uncharacterized protein n=1 Tax=Nostoc calcicola FACHB-389 TaxID=1357508 RepID=A0A1U7IB45_9NOSO  ali  25  3.......SKKKAIDPPNLPSFEMMNIPDNQLYELESYENIYLSNCQLEGI--KGVDFQYAYFDTVKAINTYFKKLSLQDVRIIKSDFANTEWEEASLNRVEFVNCRLLGFKGIKSRFKNVIFKGCQGQFSQFNFSKFDCVIFDNCILEESTFLEASLTNVKFINCQMNNVILGDAKFKDTDFRGSNIEGLQININQLKGAILDLFQAAYILQRY....... 209
442 3.000e-41UniRef50_A0A2A4RI96 Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A2A4RI96_9BACT  ali  23  3.......SKPIKEIVPEAPSQGEVEVASEQLVDGAMLESVSLSGDCVKPKIVQRLGIEGARITGSVLAGAKLPGVRMVDCCFDRADLAGATWNDARLVRTRFDESRLTGFDARMSELRDVVFHNCKMPESFLSEAQLTRVRFDECQMPGLDLSNAKIHSAVINNCDARSLNLLGAKIELLDLRGSMIDGIAIDPLFIKGLIIDATQAPAIALALGVRIAD. 216
443 3.000e-41UniRef50_UPI000D6E26AC pentapeptide repeat-containing protein n=1 Tax=Reichenbachiella versicolor TaxID=1821036 RepID=UPI000D6E26AC  ali  29  18........................................YFTDEEYNSISLPFGEYESCSFKNCKLSDVDLKEYKFIACEFIDCDLTNTKVRSTSFQDVSFDNCKLIGVQFSEAKGLEVNYKNCLMESCSFINKNISKTKFIDCNLKSVDFYETNLSSSLFDNCNLEAALFENTNLSLCDLSTSFNFTIDPNQNNIKKAKFSRENLVGLVAHLDVKI... 198
444 4.000e-41UniRef50_R5LGP7 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:921 TaxID=1262847 RepID=R5LGP7_9CLOT  ali  24  2.............LKPNINNISDFNDDINAYFSNDTVKNYSISNQKLFLLSLDEIEFSNSILDNIVFYNCNLEKIYFNNCIVKNCDFSNNNLYKSSIKQCEFTNCKFTGTNLSYSYFENVKFFECNLKNSYLNNSFFHLSEIENSNFSSSFLNDCKLAYTTFDHANLTNCNISNTKLNKIDLSTSLISGITVYPNDIKGLTLNEEQALEFVKILGIKIK.. 208
445 4.000e-41UniRef50_A0A2K8KQU3 Pentapeptide repeat protein family protein n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2K8KQU3_9GAMM  ali  20  2........................PNPLDSTSE---YLSLTFVGLDLSNETLSFKEFDGCVFKECRFDSVTFKNCKFIECEFVSCNLSVVNMSYSRFMDVAFRDSKIIGVDWTKAAWPNISFHNSLLNDSSFYGLHLADLIIEDCKVHDVDFREGNFSQGDFSGSDFANSLFNGANLSGVSFENAENYYIDLNHTNIKQAKFSRLEAVCLLESLDIELLD. 200
446 4.000e-41UniRef50_A0A2M7XD55 Uncharacterized protein n=1 Tax=Candidatus Uhrbacteria bacterium CG_4_9_14_3_um_filter_41_35 TaxID=1975034 RepID=A0A2M7XD55_9BACT  ali  23  3..............................IFAENEFEDQLFNGRVIFSSDLKDKIFEKCKFISCTFLDCDLSGAEFSDCSFENCSVGPVKVLDASFRNVIFKNSKLVGVDFSKCSFFELHFFKSLLDTCNFSMTKMTVSTLSEIIIRDCTFFETDLQKVDFQNCDLAGSSFHLARLEKADFRSAKNYSINPATNKIKGARFSLPEAISLLSGFDIELE.. 193
447 6.000e-41UniRef50_R1EU53 Uncharacterized protein n=2 Tax=Emiliania huxleyi TaxID=2903 RepID=R1EU53_EMIHU  ali  18  129..............ADLRGEQLEGRDLQGVTLPEARLAGANLKGSDLRGADLEKAVLQEAVLSGAKLAGTNLRDADLRKVKLDNANLYKAQLEGASLTRAQLQGADLRGADLYKAQLQGACLIEAQLQGADLGGVQLQGAELSAAQLQGADLSEAQLEGADLQGADLRWAQLQGADLEGADLRSAQLEGANLEGADLRGADLTGANLAGAADLRGAVL... 471
448 6.000e-41UniRef50_A0A0R2EZA9 Pentapeptide repeat-containing protein n=4 Tax=Lactobacillus TaxID=1578 RepID=A0A0R2EZA9_9LACO  ali  24  2...............PDYPIVEDQTLAFDDLQPEHTYQNCTIT------YAHEAIKLSDLILDHCTFQQENFSAGEWLDCTIRHCRFLNADFRNSQFYRCHFEADQLVGSDFGNSHLKQVTFHDAQADYCNFSEANLDDCHFETTRLQESVYQATTIKHANFDRCDLTGADFSDTALKSVDFRTSIIEDFRFTPRLVRGCRIDPLQAVPFALALGVTIED. 201
449 8.000e-41UniRef50_A0A2E3BEK5 Uncharacterized protein n=1 Tax=Oleispira sp. TaxID=2024846 RepID=A0A2E3BEK5_9GAMM  ali  23  16...................................EYYNQDFTNIQFSKNELNKVEFDNCSFKNCDFSETIFKHCKFLDCNFSHCNLSNIQINYSRYNEVFFEHCKMLGIDWTRAYWPNFKFSNCILNDSSFHGLKLSELQLESCKLQDVDFREGDFSQSNFINSNFSYSLFNNTILIEADFTDAINYNIDINNNNIKHAKFSRDQALNLLVGLAIEIVD. 206
450 9.000e-41UniRef50_UPI00031AA1D7 hypothetical protein n=1 Tax=Calothrix sp. PCC 7103 TaxID=32057 RepID=UPI00031AA1D7  ali  10  87..SKVNLSESNLTGCNLSEAKLTKANLSKTNLSGADLSGAILSRAILSEANLSNTNLSGVNLTGVSLANANLSQANLIDANLSMVNLSGVNLSKANLRNAVLRNANCYRAKFVSANLECCQLQEANLKQANLTAANLHSAELTNANLQDADVSGANFCDSNLNEANLTRIQAGGTDFTGAKFSGTCLEKIDIS-TKLNDINVS.................. 318
451 1.000e-40UniRef50_UPI00036B7B62 pentapeptide repeat-containing protein n=1 Tax=Calothrix sp. PCC 7103 TaxID=32057 RepID=UPI00036B7B62  ali  17  103..........................LENLNEDGESLAGLTATDADLTGVQLQGADLVRANLKGTNLSKSDFSDAKLDKADLAGAILVGANLMSANLCDANLSKTDLSDAQLVKAQLINAKLVNTNFSGANLSGANLSYADLRGANLSSVNFSDADLSCINLGETLISNTNFSGANLSGVDFNNFRLNGINFSGARLVGTNLSKAKLCGAANLYAANLSD. 300
452 1.000e-40UniRef50_D4ZPU2 Pentapeptide repeat-containing protein n=21 Tax=Cyanobacteria TaxID=1117 RepID=D4ZPU2_ARTPN  ali  12  190..TRANLMGANLTEADLTKANLGRANLRGANLTDAYLNLASLVEADLHQANLTRANLSRANLSKTYLRDICLNGAHLTKVNLSGADLTGINLAGAYLSEATLVGALLMEANLSAANLSGANLQNACLINADLRGAYLDRVDLTDANLTGANLTKADLREANLRAAILAGVELKGAQLAGA......................................... 377
453 1.000e-40UniRef50_A0A1V1P5Z5 Pentapeptide repeat-containing protein n=1 Tax=Candidatus Magnetoglobus multicellularis str. Araruama TaxID=890399 RepID=A0A1V1P5  ali  15  319..SDANLSKADLKGADLREVSFSEVNFSNADLRGADLRRADLRRAYLRRADLRDNNFKETDLERANLIGANLRKANLEGINLEGANLEYAFLRKANLKEVNLMNANLSGADLRSANLREANLMGADLRFADLIGVDLKYAHLIGADLRYTHVNEANLSEANLSRVNLKEAIIQGANLEGANLNLANMEGAYLNKVDLKDV..................... 561
454 1.000e-40UniRef50_A0A2N5K358 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2N5K358_9CHLR  ali  17  23.............................................DYSIVGLGVVDLKGANLQRVEIQGVNLSGADLRFADLQRADLRFADLQRADLQRADLREAKLDGAQLSSADLQRAYLQGTRLTTADLRGAKVDNADLTGASFQRADLTGASFQRAHLQRANLGGSDFSEADLSEADLQGASLRRAKLDGADLTGAQLRGADLQG-ASLRRAKLD.. 195
455 3.000e-40UniRef50_K9VB64 Stress protein n=4 Tax=Cyanobacteria TaxID=1117 RepID=K9VB64_9CYAN  ali  16  279..............................NQGERDFTGVNLAGVNLSGKSLIQVNLSSANLRGAELYQSNLSGANLTEANLCDANLNKANLSSAQLGKTQFINANLSEVNLSEANLSGVNLSDVNLSGTNFSMANLSKANLTGLNLRNADLSNANLSNTNLFEANLEGANLEGAKLEQANLAGVDLNCFNLSEANLSGANLTKANL-EAAKLLQANLS.. 508
456 3.000e-40UniRef50_A0A1Q3T2X2 Uncharacterized protein n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3T2X2_9CHLR  ali  20  32..........................................RNLNLSGLNLSVVNFAEMDLSGAAFAYAHLNGANLLNTNLVRTNLNSARLNGVKGHGVRFDQADLANASLIEAKLEEASFAGAFLNKTNFSGADLRGADLSEANLSETDLSEANLSEASLSQANLSRAILRDTDLSATDLRGAVLGGAKLDGARLDGANLSQVRLL-LANLHKAQLS.. 212
457 3.000e-40UniRef50_A0A2G6KHK5 Uncharacterized protein n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6KHK5_9BACT  ali  13  594..SKANLHGANLRKANLAGVTLTGADLKECDLSSSELSKANLNGADLSEIDLRQVDLGKANLSKVNLHGTNLYGTDLRGTTLIEADLGDANLGKTKLSEVDLRWVNLSRANLSHADLRWADLSAANLSGANLSDA-----ELGGADLRWVNFKKANMIGTDLRNADLRHARLVETNLSHADLTGSRISGISV............................. 783
458 7.000e-40UniRef50_UPI0008337871 pentapeptide repeat-containing protein n=1 Tax=Nocardia mexicana TaxID=279262 RepID=UPI0008337871  ali  12  122..TGAKLTGADLHGAKLMKTNLTGADFTDANLTDANLNSATLTKAILSGQVLRDTVLSLADLSDADLTYTDLTRAELLATKLSGARLAGAKLAGLDLIETDLGHADLTGADLTDTQLLDAQLTGSRLNDANLSGANLAGANLVGADISGANLVGTDLSGVTWD.......................................................... 282
459 1.000e-39UniRef50_A0A1U7H766 Low-complexity protein n=3 Tax=Nostoc TaxID=1177 RepID=A0A1U7H766_9NOSO  ali  10  291..SWANLNRANLCGANLRSANLYGASLRAGNLQGTNLYKANLQQATLKIANLSGAKLFLANLQGAKLGKANLHGANLSGANLNGANLSGANLNAAKLHEVYF-------ANLSEASLTEADLYQANLIGVNLQRATLHQANLTQANLMGANFSGANLSDVKLEGTILTGA................................................... 458
460 2.000e-39UniRef50_M0KXZ3 Pentapeptide repeat-containing protein n=2 Tax=Haloarcula argentinensis TaxID=43776 RepID=M0KXZ3_HALAR  ali  11  84..SGADLGSADLSGANLQKADLSGADLSYANLSGADLE-----NADLSSADLRRTNLSGVKFVETDLADADLRNIDFSDTELVGTDLSGADFFAT----------DLSGADLRVADMSNVNLREADLSGADLGGTDLSDANLREADLSGADLGGVDLSDADLRNTNIDDTSVNG............................................... 240
461 2.000e-39UniRef50_A0A2E4VG49 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E4VG49_9BACT  ali  15  64..SNAELYRAELSVADLRKADLEGADLRRANLRYASLSDANLSGANLWRTKLNDARLQGANLSDANLSDAKLSGADLNGANLSDAKLWNADLSGAYVIEADLSDAKLDGADLRSATLWNANLSHSNLWRTKLNGANLNGANLNGANLSEANLSEANLTNIEYDD......................................................... 225
462 3.000e-39UniRef50_R0JHX6 Putative low-complexity protein n=1 Tax=Corynebacterium crenatum MT TaxID=1310164 RepID=R0JHX6_CORCT  ali  315...NVDLRGSNLDTTNLEGAFLGGANLRGANLRGASLGRANLRDANLEDADLLGANLEGADLLGANLEGADLLDVNLKGAGLLGANLKGADLWGADLRDAKMRSAKMRSANLLDANLEGANLEGANLEGADLLDANLKGADLLDVNLKGAHLKGAHLEK.............................................................. 470
463 5.000e-39UniRef50_A0A1U7HC95 Uncharacterized protein n=1 Tax=Hydrococcus rivularis NIES-593 TaxID=1921803 RepID=A0A1U7HC95_9CYAN  ali  19  11..................................TEYQYSNFMFLSLEKLKQKKFNLCAIDITEIDWKEIDLEDADLQEANLSGINLSGTNLSRANLFKVKLFGTNLSGANLSGANLNSTNFSRANLSGANLSSANLIVANLSRANLSGVNLSGANLIVAHLIHVNLSSANLNEADLEDANLSGSDLSGVNLRNANLRGATLNGTILRD-ADLRGIRLEN. 195
464 6.000e-39UniRef50_A0A075HNQ7 Pentapeptide repeat-containing protein n=1 Tax=uncultured marine group II/III euryarchaeote KM3_75_E04 TaxID=1456504 RepID=A0A075  ali  18  40.................................................................DCSGCDLSEVFLQGADLTEANLSDADLNAAILFAADLSGANLTWANLKDADLTKVDLSGANLKDADLSGATLTKANLTDADLTDADLTEADLKGADLSKVELRGATLYGANLIEANLTEANLTGANLIKANLTGANLTGANLTGVADLYGADLTD. 212
465 3.000e-38UniRef50_A0A0V7ZQD4 Uncharacterized protein n=2 Tax=Mastigocoleus testarum BC008 TaxID=371196 RepID=A0A0V7ZQD4_9CYAN  ali  18  122.................RNQALQDLNEDAVSLTRVNLSNTDLKSITLKYANLKEANFSATNLSNVNLRKADLRYANLRDANLSNANLCGVNLCSANLCGANLNCAKLYSTDLSGANLSDVNLVEADLTNANLSGTNLTKANLSSADLSNVDLSGTKLSNSDLIHANLAGANLRYANLAGANLRYANLKEADLIYADLREAKLTGADLRE-AKLTGADLSN. 375
466 3.000e-38UniRef50_A0A1Y4EVI2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1Y4EVI2_9FIRM  ali  65...GADLRDANLRDADLRGANLRGADLYGADLRGANLRDANLYGADLRDANLRDADLRGANLRGADLYGADLRGANLRVADLRGANLYGADLYGADLYGANLRDANLRGADLRGANLYGADLYGADLDFS........................................................................................... 191
467 3.000e-38UniRef50_A0A1U7IBC4 Uncharacterized protein n=2 Tax=Phormidium ambiguum TaxID=71191 RepID=A0A1U7IBC4_9CYAN  ali  23  239........................................................................NYIDLSGVDLSDAYLSKVYISHAKLRNADLSNCDLSSANLSYANLSGANLSGADLSGANLSGADLSGADLSDANLRGADLSSADLSSADLSSADLSNTNLSFANLRNANLRNANLSGADLSGANLSGADLSGADLSD-ANLIGANL... 424
468 4.000e-38UniRef50_A0A1Z3HIB4 Pentapeptide repeat-containing protein n=2 Tax=Halomicronema hongdechloris TaxID=1209493 RepID=A0A1Z3HIB4_9CYAN  ali  15  14......................................NRDFPEVSLNEQSLVEAELPQIVLRRASLKVTNLSNANLTQADLQDAIFNVSRLSGANLSGANLRHCQLNVTNLIRALLTEADLSGASLVRAEMLRADLSNAQLVAANLREVDLREAKLRWANLQGANLQQADIRNSILTGADLSGALLKQADLRHANLQQVKLNGANLQGWADLRGADLRN. 214
469 4.000e-38UniRef50_K9SER6 Pentapeptide repeat protein n=1 Tax=Pseudanabaena sp. PCC 7367 TaxID=82654 RepID=K9SER6_9CYAN  ali  14  209..SQAKLIGAKLIGASFRGANFSNAILRGTNLSSADLSRVNLRGADLSGANLSDANLLHADLNGAILHDTNLSEARLIEANLQGADLSGAKLIRTI----------LIGANLQAADLSRANLNRANFNKANLTGADVKSVNFEKANLQGANL..................................................................... 348
470 4.000e-38UniRef50_H3RM13 Uncharacterized protein n=1 Tax=Pantoea stewartii subsp. stewartii DC283 TaxID=660596 RepID=H3RM13_PANSE  ali  215..TNANLNQTDLPNVNLSGANLAHANLTMAYLSEADLSNANLSNADLKRADLSNANLSGADLTNANLNQTDLPNVNLSGANLAHANLTMAYLSEADLSNANLSNADLKRADLSDANLSDANLTNVDLKRADLSNAILKGANLLHINVEGTNMTGTK................................................................. 368
471 6.000e-38UniRef50_UPI000996C17B pentapeptide repeat-containing protein n=1 Tax=Streptomyces xiaopingdaonensis TaxID=1565415 RepID=UPI000996C17B  ali  13  310..SDADLLNANLRDANLSDANLRDADLLNANLRGTGLYNRNLRNADLSGTNLRDA----------GLSDADLRGALLLSADLSDADLSDAGLRDADLRDANLRDADLLNADLGDANLGDANLRDADLGNADLGDADLRNANLLNADLRDADLTDANLRDANLTDA........................................................ 462
472 8.000e-38UniRef50_A0A1Q6DKC8 Uncharacterized protein n=1 Tax=Desulfobulbaceae bacterium DB1 TaxID=1920419 RepID=A0A1Q6DKC8_9DELT  ali  16  495..TNCDLSKADLSLANLHQANLSNGILREAKLHKTSLKNAYLSNADLTNADLTSADLTSADLKGANLTGINLSAALLTDIRFTNANLTNAILAHADLRYVDFTNADLTRADLRQANLGGADFRWANLTDADLSEADVREALFSDADLNRADFKQVAFSGAVIHDANLDRA................................................... 679
473 8.000e-38UniRef50_V5A4F0 Uncharacterized protein n=1 Tax=uncultured archaeon A07HR60 TaxID=1412874 RepID=V5A4F0_9ARCH  ali  16  126..TGADLTGADLTGADFTD----------ADLSDIPLSDATFSEADLTGADLTDADLSDASLSGATLSEIDLSADDLSEATLDGADLSGVDLRGANLTGATLTHADLRQADLTAADLTRIDLCSADLRQAELNGADLSDADLHGADLSNADLRGADLTNAQFEDADL...................................................... 280
474 9.000e-38UniRef50_M0EYP0 Uncharacterized protein n=2 Tax=Halorubrum distributum TaxID=29283 RepID=M0EYP0_9EURY  ali  16  51..SGADLRNAKLLQADLRDSQLIGVSLRDADLSKAKLWDANLSKAKLTGADLSEAELSGTNLSEANLRGIDLSESLLIDANVSKSDLTVANLSGSDLQGSNFSNTTLVEADLSGAKLHKTNLTEANLRRANLS-----KADLFNANLSKADLGATDLSKAKLIGSDMSSVLLWDTSLSDALLSRNTI.................................. 250
475 2.000e-37UniRef50_U9W4Y5 Low-complexity protein n=2 Tax=Leptolyngbya sp. Heron Island J TaxID=1385935 RepID=U9W4Y5_9CYAN  ali  11  67..SEADLSRANLSRAQLSRAQLRGANLLGANLTEAQLRGAYLSGAYLSEANLFGADLSGAQLRGAQLRGAYLLGADLSGADLSEANLSRANLSRAQLSRAQLLGADLSGAELRGAELLGAELLGADLSEANLFGAYLT................................................................................... 202
476 2.000e-37UniRef50_UPI0009B5B822 hypothetical protein n=1 Tax=Halorubrum coriense TaxID=64713 RepID=UPI0009B5B822  ali  18  151....................................................................NADLRNVDLRDRELSAVNLSGADLRDADLRDANLHSANLSGADLRDADLRRATLEKVDLQGADLSDANLKKANLTNACLGQANFTNANLRQANLTDALLTYATFSGANLCDVNLRDADLRGVNLTNTDLRQVNISDADLRQ-ADLSDTDLRN. 311
477 3.000e-37UniRef50_A0A2X4WKK1 Effector protein PipB2 n=64 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2X4WKK1_SALDZ  ali  10  61...GANLCGANLRDANLCGANLRDANLCGANLRDADLCDANLCGADLCDANLCGADLRGADLYDANLCGANLCGANLRDANLCGANLRDANLCGANLRDADLCDANLCGADLCDANLCGANLRDADLCGANLRGADLPDLTL............................................................................... 199
478 1.000e-36UniRef50_A0A1Y0RRD8 Uncharacterized protein n=2 Tax=Nostocales cyanobacterium HT-58-2 TaxID=1940762 RepID=A0A1Y0RRD8_9CYAN  ali  11  750..SEADLRGANLSRADLRGADLRGADLSRANLSQANLIGANLIGANLIGADLSWANLIGADLSRANLSRANLSRANLRGADLSRANLSRADLRGADLSRANLSEANLKRTKREGANFAGTILEGKDLSY............................................................................................ 876
479 1.000e-36UniRef50_A0A2W4N4F6 Low-complexity protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2W4N4F6_9ACTN  ali  308ILTNSYLTGPNLTRASLTDANLSGSFLDTPNLARANLAHANLTGIEMTNANLTDADLMEANLTRARLTRGNLADANLSGAVLFDAYLAYSNLTRANLRGANLTGANLSGANLTDANLSEADLTDTDLSHANMRGADLRGADLTLAKLRHADLSGADLREVK............................................................ 478
480 1.000e-36UniRef50_Q8KDK2 Pentapeptide repeat family protein n=2 Tax=Chlorobaculum TaxID=256319 RepID=Q8KDK2_CHLTE  ali  23  45.........................................................EAVEFNKKDFSETDLSGANLSDASFKAANFS-----GASLSRVSFRDAKLNGADFAGADLRQSDLSNADLSGANLVMADMSEANLDGANLSMADLNHANLKGAILTQSRLNCANLNECDMREAHLSWADLSGVALSEADLHDTKLDEADLLGAADLHEADLRD. 216
481 2.000e-36UniRef50_UPI0009D7744C hypothetical protein n=1 Tax=Moorea bouillonii TaxID=207920 RepID=UPI0009D7744C  ali  16  70....................................................................GVSMRGLDVPNADLTDIDLANAILHQATLNDAELTGANLTEAELTGANLSQANLSKAKLGKALLIKAELSQTDLSNADLTGADIRNADLSGANLSGADLTTANLSGANLSGANLSGANLSGADLTTANLRNTNLSGANLRN-TNLSGANLRN. 222
482 2.000e-36UniRef50_A0A1Z4L3U8 Pentapeptide repeat-containing protein n=4 Tax=Nostocales TaxID=1161 RepID=A0A1Z4L3U8_NOSLI  ali  19  76.....................................EDEILQKYQAGERNFSGVDLREANLSGQNLTGVNLTGAILARAILQNADLSKANLDQADLSSARLVSAKLMYAELTEADLSETYLEKADMKWANLSSAILKGAKLDNANLRQADLTNAKLRKADLSDTDLSRVNLSRADLNHADLSRANLNNADLTNANLTKVNFSGANLSG-ANLSGANL... 305
483 3.000e-36UniRef50_UPI00034DA08A pentapeptide repeat-containing protein n=1 Tax=Oscillatoria sp. PCC 10802 TaxID=1173028 RepID=UPI00034DA08A  ali  12  214..TGADLSGAKLSGANLEAAKLENANLIGADLSQSFLADASLKGAALSNANLSGAKLDGADLSQCNLKSANLSYADLTGAKLRKADLTKAVLSVAKLAGADLTSAFLSNAYLYKANLQRANLTDAHLERANLTDANLAGANLTGSNLAGANLTNANLTDIRLRQ......................................................... 385
484 3.000e-36UniRef50_A0YP45 Uncharacterized protein n=3 Tax=Oscillatoriaceae TaxID=1892254 RepID=A0YP45_LYNSP  ali  20  30...........................................................................DLRGVDLSGADLSGANLWMADLWSADLWGADLRGTDLSDSNLWRADLRGTNLRNADLSGAYLWRADLRGADLTGVNLMGTNLSEADLWGANLQSANLSEANLWKADFRGVDLGEADLREANLWKADLSRANLIN-ADLWGTDLRE. 204
485 5.000e-36UniRef50_UPI0009B85FF3 pentapeptide repeat-containing protein n=2 Tax=Burkholderiales TaxID=80840 RepID=UPI0009B85FF3  ali  146....ANLRGADLGGANLRGADLGGANLRGADLRGANLRGADLRGANLRGADLGGANLRGADLRGADLGGANLRGADLRGANLRGADLRGANLRGADLGGANLRGADLRGADLGDANLTPIR.................................................................................................... 262
486 7.000e-36UniRef50_Q52118 Uncharacterized protein in mobD 3`region n=1 Tax=Pantoea stewartii subsp. stewartii TaxID=66271 RepID=YMO3_PANSE  ali  135..TNANLNQTDLPNVNLSGANLAHANLTMAYLSEADLSNANLSNADLKRADLSNANLSGADLTNANLNQTDLPNVNLSGANLAHANLTMAYLSEADLSNANLSNADLKRADLSDANLSDANLTNVDLKRADLSNAILKGANLLHINVEGTNMTGTK................................................................. 288
487 1.000e-35UniRef50_A0A1Z4LNK3 Uncharacterized protein n=2 Tax=Calothrix TaxID=1186 RepID=A0A1Z4LNK3_9CYAN  ali  12  360..SGANLCCVDLQDAELNEFNLNGVNLSRAELVDAQLVKIQLVDADLSGANLSGANLTGANLCDANLRDTDLSGANLSGANLIGCNLIDAKLDRANLNDADLSCTDLRGVNLYDADLNGTKLKHCNFDPSN-RGMYLIAINLINAQLNGADLSGANLYGADLDGANLYGANLYKTKLIKA......................................... 548
488 1.000e-35UniRef50_UPI0003613467 hypothetical protein n=1 Tax=Calothrix sp. PCC 7103 TaxID=32057 RepID=UPI0003613467  ali  14  529..KGANMKGADLKGADLSNTDLSNADLSNTNLSGANLSNAIFNDANLININLKGANLTGASLKGINLRGRDLSRADLSGINLRNADLRRTNLIEANLSSANLIETILIEANLSRADLSNAMLIEANLSGANLSHANLNRTYLIDANLSGADLSGANLSHANLIDTNLSGAKVINTRFRN.......................................... 746
489 2.000e-35UniRef50_B7KE22 Pentapeptide repeat protein n=34 Tax=Cyanobacteria TaxID=1117 RepID=B7KE22_CYAP7  ali  17  20.................................ERNFKSLVLPQANFKKASLNKINLSQGELQKADFSRGELIGANLTGVKLQQGNLYKTKLIETNLTQANLSEAILSEADLSGAMLSQTILKKADLSYSCLIASSLIGAELSKANLKEANLTGASLTKAILIGVNLTRAVLTRAILTEVNLTRAYLSRANLQNVNLAGANLSFADLRGVANLKGANLE.. 219
490 2.000e-35UniRef50_UPI0009FC8CA9 hypothetical protein n=1 Tax=Millisia brevis TaxID=264148 RepID=UPI0009FC8CA9  ali  17  243......................................DADISWAR-AHTDLAGADLRGVALTRCEMPGINLAAADLTGARLSGANLAGAQLSGTV----------LTGADLIGAHLSGARLRGCTLVRADLLEADLSAADLSLCDLTDAVLTGATLTDARLAGATLVGATLFGADLSRADLQRANLQEADLTEAKLLRANFFHANLAG-ARLVRANLE.. 421
491 3.000e-35UniRef50_A0A2V6UD28 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6UD28_9BACT  ali  22  64......................................................................SFRGSDLHGLNLTGLDLSRADLRGADLREAELRKARLEEADLRGARLGDADLLAANLDEADLREADLRGADLRGAKFMDADLRGARLRGANLIGARLSEANLSGADLQGANLSRANLRGADLGKADLRGADLSGADLRG-ADLTGADLR.. 236
492 4.000e-35UniRef50_Q3L959 Uncharacterized protein n=1 Tax=Rhodococcus erythropolis (strain PR4 / NBRC 100887) TaxID=234621 RepID=Q3L959_RHOE4  ali  15  211..........................................EGISPSTFDLRGARLRGASLGFADLRAANLQGADLQTAELSGATLRLANLKGAILREADLTGANLTDATLTEADLAEAKLQGAILVNVNLQNFDLSRLDLEKANLSGATLFEADLRSATLTGANLERANLAHANLAEANLTGAYMFGAALTEAVLTDATLTKAHLAQEATLEGADLED. 407
493 5.000e-35UniRef50_A0A1U7HA70 Uncharacterized protein n=1 Tax=Nostoc calcicola FACHB-389 TaxID=1357508 RepID=A0A1U7HA70_9NOSO  ali  11  146..TGANLINACLRDADLSDADLKNSDLSNANLVDANLTNADLSNANLTNADLSNANLPEANLSGANLKSSNFNNTNLINANFANANLSNANLAEADLSGANLENTDLSNANLAKADLTGANLKDTDLTNVVSIRDNLTNNRFKNTN........................................................................... 299
494 6.000e-35UniRef50_A0A1Z4U5B8 Uncharacterized protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4U5B8_9CYAN  ali  13  78..SGANFSQASGYQANLSRTNLNSANLTSVNFAETDFTQADFTNASLQNANLQKAKLRGVSLEKCNLSGVNFASANLIGAYLGHANLSKAVLQGANLERTSFVNANLMMANFDGANLKKANLTGANIYGASFKDADLTDAIM............................................................................... 217
495 1.000e-34UniRef50_UPI0002C00425 pentapeptide repeat-containing protein n=2 Tax=Bacteria TaxID=2 RepID=UPI0002C00425  ali  22  27.................................................................................................RCANLRDVDLRGVNLSGVNLRDADLRGVNLFGVNLRDVDLRGVNLSGANLRDVNLSRVDLRGANLSGVNLFGANLSGVNLSGVNLRGANLSDVNLSRVDLRGVNLSGVNLSGAVNLSGANLRD. 158
496 1.000e-34UniRef50_K9PYM0 Pentapeptide repeat protein n=1 Tax=Leptolyngbya sp. PCC 7376 TaxID=111781 RepID=K9PYM0_9CYAN  ali  15  42..SGVNLSGVNLSGADLSGADLSGADLSGAKLSGAYLYGAYLYGANLYGANLSKADLSEADLSEADLSEADLSEADLSGVSLSEADLSGVNLSGVNLSGVNLSGVNLSGVNLSGAKLCHTLCKLSTLVGASLKSADLTGACIQDWNISETDFEG................................................................... 229
497 1.000e-34UniRef50_A0A1Z4KDE7 Pentapeptide repeat protein n=1 Tax=Calothrix brevissima NIES-22 TaxID=1973478 RepID=A0A1Z4KDE7_9CYAN  ali  22  241...................................................................................................................NLSGVDLSDANLRDANLRGADLSDADLSDADLSDADLSDADLSNADLRGADLSGVNLRGADLSGADLSGVNLSGVNLSGVNLSGVNLSGVNLSG-ADLSGADLSDD 345
498 2.000e-34UniRef50_B0BYI2 Uncharacterized protein n=2 Tax=Acaryochloris TaxID=155977 RepID=B0BYI2_ACAM1  ali  19  186........................................................................SSLDFQDAYLIQANLIQGNFQGANFQGTYLIGTNLREADLREANLRNADLLSANLSEADLTQANLSSANLLGTNLNSANFQNADLTGANLRGAYLGSANLLGANLNSADLIGVYLSDANLSHAKLVGANLRTAKLIGAANFTGADLSD. 342
499 6.000e-34UniRef50_A0A162QZF5 Uncharacterized protein n=2 Tax=Leptolyngbya TaxID=47251 RepID=A0A162QZF5_9CYAN  ali  10  285..KRANLRKANLDGAELWKGNFEGANLEGVNLEGVDLEQANLEGVNLEQVNLKRAHLDETNLEGANLKNACLLGANLYKAKLKEANLAGANLQDAYLVEADLSKANLLQADLGGANLKGANLKDADLVGVSLWEVYLWEANLEGVNLQQANISACNWQKATFDEA........................................................ 454
500 9.000e-34UniRef50_A0A1W9RCH8 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium 4484_49 TaxID=1970784 RepID=A0A1W9RCH8_9BACT  ali  11  105..TRANLMWVNLTLADLTGAIFTETKLMQAILIETNFTRANLTEADLTRANLMRANLTLADLTGANLTEANLMQANLIETNLTRTNLTRTNLTGVELTRAIFMRANLTGAKFIGANLTETDFTMANLTKADFTGAKLIGADLTDINLQGANLMWA.................................................................. 262
501 1.000e-33UniRef50_A0A1H8SKH9 Uncharacterized protein YjbI, contains pentapeptide repeats n=1 Tax=Rhodospirillales bacterium URHD0017 TaxID=1380357 RepID=A0A1H  ali  119..SGAQLAGAQLVGAHLGGANLSEADISAANLSGADLLETNLSKATLIEANLSGANLNRANLREAKLTWANLSTSHLIGSDLSKANLTGANLSMANITGADLIEANLSKANLTKARLGGANLSAANLTASLLVETDLTNADLTGSRVHG........................................................................ 265
502 2.000e-33UniRef50_A0A1Z3HFX4 Pentapeptide repeats containing protein n=1 Tax=Halomicronema hongdechloris C2206 TaxID=1641165 RepID=A0A1Z3HFX4_9CYAN  ali  22  786...............................................................................TIFGDC----INLYSYDLSSADLSTANLSGADLSGADLSSANLSSANLSSANLSGADLSNANLSNANLYSSDLNEAGLYSANLSEADLSGADFNSANLSSADLHNAELYAAVLKNASLHDAKLNDANLS-YANLHSVDLRN. 921
503 3.000e-33UniRef50_B4W3F9 Pentapeptide repeat protein n=1 Tax=Coleofasciculus chthonoplastes PCC 7420 TaxID=118168 RepID=B4W3F9_9CYAN  ali  14  127..TQANLTKAQLNLANFNQAILCHAKLINAKLVGANFSQACLKNADLIGANLGCANLSGASFFRANLSEANLKGANLQGVDFRGAELSGANLSGANLSGANLSKADLSGANLSGANLSDAKLIRTQALAANFEEATLTGACIEDWNING----ETNL................................................................ 282
504 4.000e-33UniRef50_D7E4N9 Pentapeptide repeat protein n=3 Tax=Cyanobacteria TaxID=1117 RepID=D7E4N9_NOSA0  ali  102..TQANLSQVNLIGADLSEANLIGAAITGANLIGTDFRNANLKDADLAAAKLIRSNLSFANLVGANLITTDLSGANLYEANLYKANLTNSHLGRANLSEANLTNADLTCANLTGANLRGANLRGANLRGANLTGANLRGTNLTGAIM.......................................................................... 261
505 4.000e-33UniRef50_A0A1I0L9R0 Uncharacterized protein YjbI, contains pentapeptide repeats n=2 Tax=Nonomuraea wenchangensis TaxID=568860 RepID=A0A1I0L9R0_9ACTN  ali  244..TGANLSGAKLSGANLSGANLEGADLSGTDLTGADLIGTNLTGADLTGADLSGANLARADLARADLSGAKLSGANLARADLARADLSGAKLSGAKLINTRLRGTNLFRADLSGADLLGAQLTRAQYDMA........................................................................................... 391
506 8.000e-33UniRef50_I4C5X6 Putative low-complexity protein n=1 Tax=Desulfomonile tiedjei (strain ATCC 49306 / DSM 6799 / DCB-1) TaxID=706587 RepID=I4C5X6_DESTA  ali  144ILSGANLSKALLPFADLSGADLFGAKLKKAALSAVDFSRADLSGADLSGADLSGAILSGARLNGANLSRVDLSFTDLSGAHLSGANLSAANLTGAYLPGSDLSGADLSGANLQGADITDSDLSGANLNGANLDGTKLDGVK................................................................................ 284
507 8.000e-33UniRef50_A0A0Q6YM51 Uncharacterized protein n=1 Tax=Streptomyces sp. Root369 TaxID=1736523 RepID=A0A0Q6YM51_9ACTN  ali  12  102..TRANLHGANLHGADLTRAYLNGAYLHGAYLIRADLTGADLTGADLHGANLHGAYLFRADLHGANLHGADLTGAYLSGAYLIRADLHGANLHGADLIRADLSGANLTNTDLANADLTNANLMGAQFT----SGVNM.................................................................................... 232
508 1.000e-32UniRef50_A0A075H9Y2 Putative low-complexity protein n=2 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075H9Y2_9ARCH  ali  12  545ILTGADLTDANLSGANLSTTNIFGIVDGINILEKTKLKGANLTNANLTNINLIAVDISEAILNGADLTGAKLNNATIEDVDLSFKNLSKIRLIDSHLSRTIFSDANLSNAKLMGANLSDADLTDANLTYADLANANLTGAIFHMANLTGANLEGVIISETNLN.......................................................... 712
509 1.000e-32UniRef50_Q8DII6 Tlr1599 protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=Q8DII6_THEEB  ali  12  159...GADLTDAVLRESQLLQANLRGANLSATNLQQANLERAILIGANLRRARLEEANLREVAFKEANLRHACLDKANLVGADLRGVSLAQALLRGANLSSAILIGANLMGANLSGADLRGANLIEAILTGASLNGVDLSAVDMSEAILPDGYLS.................................................................... 308
510 1.000e-32UniRef50_A0A2E9R0C8 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9R0C8_9DELT  ali  12  996IGPKAVLVGAELVGADLEGVNLEGVNLEGVNLEGVNLEGVNLRRAKLEGANLEGARYDGAELVGVNLERADLEGADLKGVELCFSNLEGAKLEGASLKGANLVATRLHRADFEGADLEGANLEGANLRKANLHGTKLKGAKYNN............................................................................. 1163
511 2.000e-32UniRef50_K9VAI2 Pentapeptide repeat protein n=4 Tax=Cyanobacteria TaxID=1117 RepID=K9VAI2_9CYAN  ali  13  98..SGADLTGASLRGADMRDANLQGANLQGANLTEVKLCGINLSKANLTDANLTQADLSRANLTQANLSWANLTEANLEKADLKGADLSGANLSCANLHQADLSGVSLKGANLRGANLHQASLRGTNLDEANLREAMMPDGTISD............................................................................. 249
512 2.000e-32UniRef50_A0A1W9VJJ8 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_5.2 TaxID=1971725 RepID=A0A1W9VJJ8_9CHLR  ali  13  110..SGARLQNANLNQADLRNCDVEQCDFSGANLCGCDLRHANLERANLRKANLCETSLIGAHLEKAFLSYANLSKANLQNALLREANLEGANLSESRLQNANLESASLSKANLRWANLENAKLENAKLSRANLEQANLEAADLSNANFHYADLSGVNLKGV............................................................. 282
513 7.000e-32UniRef50_A0A2E5WLW6 Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E5WLW6_9BACT  ali  17  33..................GCEIDDRDFSNKDLSNLNFEDETFINCNFSNCNLAGLDLSNVTFKNCNFEFACFDDVTFG--KFISCDLLGCDFTDSTLLDVKFKNVNLKGADLSNLDLTRLNLSGVDLSTSDLRMADLSNVNLKQANLEGADLTRANLQGANLEGSNLTGAILKGVDLSNVNLKQANLEEADLSCVNLKQVNLEGSDLKG-ANLEGADLE.. 294
514 9.000e-32UniRef50_A0A2V4E5M6 Uncharacterized protein n=1 Tax=Gilliamella apicola TaxID=1196095 RepID=A0A2V4E5M6_9GAMM  ali  92..SRANLHGANLFSTNLFDANLSDANLLSADLHGCDLCNADLFKARLRGANLRDADLRRTNLREANLHGANLRGIDLREANLCGADLSNANLFKANLSGANLRGVNLYGANLRDTSLRGADLSDADLCGANFCNTNLFAISLRGAK........................................................................... 235
515 1.000e-31UniRef50_A0A2T5WKR9 Uncharacterized protein YjbI with pentapeptide repeats n=2 Tax=Mycobacterium sp. YR782 TaxID=2135747 RepID=A0A2T5WKR9_9MYCO  ali  17  134.....................................................NKDCSNVNLSGANLAGQNLTGYNFTGANLSGANLTKATLVGATLTGATLAGANLTSANLTGQNLQGFNIGGVTLVGANLTNVNLTGQNLQSRNLTSVTLVGATLTGAALSGANLTGANLTGQNLQGLDLSGVTLVGANLTNADLTGQNLRNRNLTAGATLTGATL... 302
516 2.000e-31UniRef50_M0P324 Pentapeptide repeat-containing protein n=1 Tax=Halorubrum litoreum JCM 13561 TaxID=1227483 RepID=M0P324_9EURY  ali  14  488....IDLTNASLREADLTGAHLEGVDLTGAHLEGIDLTSANLNQADLTSANLNQADLRGANLTDASLREANLSGADLTDTELSGADLSRTDLEKSDLHKTNLSGANLRGLNLSEQNLSSVNLSRADLRDVNLIGMS..................................................................................... 624
517 2.000e-31UniRef50_A0A1Z4SAE0 Pentapeptide repeat protein n=1 Tax=Nostoc sp. NIES-4103 TaxID=2005458 RepID=A0A1Z4SAE0_9NOSO  ali  10  165ILSGVILRGADLFGADLFGADLFGADLFGADLFGADLRNTKLRGADLRNTKLSHAYLNSADLRNTDLSHADLSNTNLNYADLLNANLSDADLSSANLSSVY----------LSYANLSRAILNNANLSDADLSHATLTDIRLETANISNANFSQA.................................................................. 310
518 3.000e-31UniRef50_A0A2T0SPH3 Uncharacterized protein YjbI with pentapeptide repeats n=2 Tax=Umezawaea tangerina TaxID=84725 RepID=A0A2T0SPH3_9PSEU  ali  16  215...........................................................................................LSRADLIGANLTRANLARADLTDADLTSARLGFADLTYASLGFANLTNAYLIDARLTGANLVRARLIGANLVRADLTGARLAGAHLTRADLTRANLTGANLTGADLVDANLTGANLAR-ADLTHADL... 344
519 3.000e-31UniRef50_UPI0009B5BD49 hypothetical protein n=1 Tax=Halorubrum aethiopicum TaxID=1758255 RepID=UPI0009B5BD49  ali  12  141..PRVNLSRTDLSGRNFRHVEFFDANLRYVDLTGASLEDTVFTSANLSGADLTDANLTGADLANANLENADLANANLQDADLTDANLEGANLTYANLESADVMISNLIEADLRHATLHRTALDGADLQNANLSRTDLRGVSLADTS........................................................................... 294
520 5.000e-31UniRef50_F4XI52 Uncharacterized protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=F4XI52_9CYAN  ali  14  389..SGANLSGANLSNAKLIDSNLRGTELSGANLSGANLRGASLYSANLSGANLRGASLYSANLSGANLSGANLSLANLSGTDFSAANLSGANLGGAYLYRADLKDANLTGADLSSANLNGADVKNARFGY............................................................................................ 525
521 6.000e-31UniRef50_K9SDX8 Tetratricopeptide TPR_1 repeat-containing protein n=1 Tax=Geitlerinema sp. PCC 7407 TaxID=1173025 RepID=K9SDX8_9CYAN  ali  14  132..SNSDLSYADLSGSDLDGANFWGANLFQANFDRTNLSNISLNGARLEGANLSNAYLSEYTLRSARLSGVNLRGANLSNFNLNGVDLSNADLSGANLAGANLRGANLRGTNIDGANLNGADLRGADVDF............................................................................................ 258
522 7.000e-31UniRef50_UPI00069D8D1C hypothetical protein n=1 Tax=Limnoraphis robusta TaxID=1118279 RepID=UPI00069D8D1C  ali  14  280ILSGADLSGADLSNADLSGADLSGADLSGANLVEANLSEANLSGANLSGANLSGADLNDANLRGVEIEELNLSGADLSGADLSGADLFRTNLFRTNLFRTNLFRTNLSGANFSEANLIRANLSEANLSEANLSGANLTNSRVRNARFS......................................................................... 448
523 9.000e-31UniRef50_A0A2T1E0G2 Uncharacterized protein n=1 Tax=Leptolyngbya frigida ULC18 TaxID=2107698 RepID=A0A2T1E0G2_9CYAN  ali  12  848..SEANLERARLSGASLERTGLIEANLIESWLEEAWLNGADLSEASLQGARLNKASLVEVNLNDAWLEGANLNGAKLNGSNLERAWLEGSNLSSASLEGANLNGAKLNGARLNEANLNGASLSGAILNGANLQSVVWKETRWDNSN........................................................................... 992
524 9.000e-31UniRef50_M0JML3 Uncharacterized protein n=4 Tax=Halobacteria TaxID=183963 RepID=M0JML3_9EURY