current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680762|ref|YP_210906.1| putative transmembrane conjugate transposon protein (BF1242) [Bacteroides fragilis NCTC 9343] (Range: 1-110), from B.fragilis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# E-value Template Links and tools%idFirst MADYPINRGIGKPVEFKGLKSQYLFIFAGGLLALFVLFIIMYMVGINQWVCIIFGVTSATLLVWLTFRLNEKYGTHGLMKLSARKSHPFHIINRKAISRLFTKNQKQASKLast
1 2.000e-24UniRef50_UPI00041E33DD DUF4133 domain-containing protein n=3 Tax=Algoriphagus TaxID=246875 RepID=UPI00041E33DD  ali  40  1MIRYKINKGVNKPIEFKGLKSQYIAYLAAGLCMTLVVFGFAYALGVSMLLCLGIAVSLGTLLCWIVFSLNARFGEHGLMKQMARRQIPASLTLRDRTVFTRLIK...... 104
2 5.000e-21UniRef50_A0A1M3HF77 Uncharacterized protein n=2 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HF77_9SPHI  ali  38  1MTTYIINRGIGKPIEFRGLKAQYILYAGATLIADFLLFVALYLCHINSWICVVLSFGSGAMGISLLYRRSRKYGEYGWARKSAGKNTPKALCCRSYKLFINLKTN..... 105
3 3.000e-19UniRef50_UPI000280A39F DUF4133 domain-containing protein n=2 Tax=Myroides TaxID=76831 RepID=UPI000280A39F  ali  54  1MKKYSINKGIGASAEFKGLKAQYLFYFAGGLLVDLIVIMVMYMAGVNNKVCLSFGLGLSGYLVYKVFSMNKKYGQYGLMKLQARKYFPRYIISRK............... 95
4 8.000e-19UniRef50_A0A139K483 Conjugative transposon protein TraF n=1131 Tax=root TaxID=1 RepID=A0A139K483_BACUN  ali  61  1MAEYPINKGIGRPVEFKGLKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIGFGAASSSLLVWQTFALNARYGEHGLMKLGAARSHPRYLINRRRITRLFKRQRKEERQ 110
5 2.000e-18UniRef50_A0A077KH54 Conjugative transposon protein TraF n=50 Tax=Bacteroidetes TaxID=976 RepID=A0A077KH54_9FLAO  ali  56  4MNTYHINKGIGRKVEFKGLKAQYXXXXXXXXXXXXXXXXXXXXXGVNTYLCLILGGISSGLLTWQTFALNRKYGEHGLMKLGAHKKHPKYIISRKNIYRYLKINRKRTN. 112
6 2.000e-17UniRef50_I9HY95 Uncharacterized protein n=60 Tax=Bacteroidetes TaxID=976 RepID=I9HY95_BACOV  ali  97  1MADYPINRGIGNTVEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIIFGVTSATLLVWLTFRLNEKYGTHGLMKLSARKSHPFHIINRKAISRLFTKNQKQASK 110
7 1.000e-16UniRef50_L0FY28 Uncharacterized protein n=52 Tax=root TaxID=1 RepID=L0FY28_ECHVK  ali  35  1MKAYRINKGINKPLEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXKYLCLAGALILGGALFYGVFHYSHTYGQHGLMKKMAYRQLPQSLRCRSRKPFLQLQKH..... 105
8 2.000e-16UniRef50_A0A077XX56 Conjugative transposon protein TraF n=65 Tax=Bacteria TaxID=2 RepID=A0A077XX56_9SPHI  ali  52  1MSIYNINKGIGRTVEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXNSYICLFLGAGGASLIIWQTFSLNRKYGEHGLMKVGARKRHPRYIICRKPVHRYLKFTSKST.. 108
9 3.000e-16UniRef50_A0A239LEM6 Uncharacterized protein n=2 Tax=Pontibacter ummariensis TaxID=1610492 RepID=A0A239LEM6_9BACT  ali  34  4.SVYRINKGINKPMEFKGLRAQXXXXXXXXXXXXXXXXXXXXXXXXDLLLCVTVVFLSGGALFTGVYHLDRTYGQYGLLKRFARRSVPRCVRVRSRKVFMHLKRKEE... 109
10 4.000e-16UniRef50_K1RMB7 Uncharacterized protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1RMB7_9ZZZZ  ali  50  1MAEYPINKGIGRPVEFKGLKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIGFGAASSSVLVWQTFALNARYGEHGLMKLGGGNKEPSPIPYQPAADHPIIQTETKGRK 110
11 5.000e-16UniRef50_L0FWF9 Uncharacterized protein n=35 Tax=cellular organisms TaxID=131567 RepID=L0FWF9_ECHVK  ali  36  1MNPYTINKGINAPLVFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXKYLCLGGALVLGGALFYGVFHYSGKYGQHGLMKATAYRQVPQSIRCRSRKPFLTLKDHT.... 106
12 6.000e-16UniRef50_A0A1I4ES98 Uncharacterized protein n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A1I4ES98_9PORP  ali  60  1MAEYNINKGIGKSVEFKSLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIGFGVIAASVLVWMTFHLNAKYGEYGLMKLLAKRQHPRYLINRKPAYRLFRQKRKEAS. 109
13 3.000e-15UniRef50_E1WKC2 Putative conjugative transposon protein traF n=32 Tax=Bacteroidales TaxID=171549 RepID=E1WKC2_BACF6  ali  58  1METYPINKGIGRSVEFQGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIGFGGTAASILVWQTFSLNRKYGEHGLMKRSALHSHPRYLINRRRIPRLLRHKGVPRRK 110
14 1.000e-14UniRef50_A0A1T3F3A3 Conjugal transfer protein TraF n=3 Tax=Elizabethkingia TaxID=308865 RepID=A0A1T3F3A3_9FLAO  ali  53  1MSEYNINKGIGRNAEFKGLESXXXXXXXXXXXXXXXXXXXXXXXXXNTYVCLILGFFGGSLVSWLTFSLNKKYGRHGLMKLRSRRKHPEYILSRKALSVYLKPNSKEIS. 109
15 2.000e-14UniRef50_A0A2X1AFX1 Conjugate transposon protein n=7 Tax=Bacteroides TaxID=816 RepID=A0A2X1AFX1_BACT4  ali  59  141..EYEINKGAGNPLEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGLLSGSLLVWLTFRLNARYGEHGLMKLLSGKRHPRYLIHRRRLFRLLTKRRKK... 245
16 5.000e-14UniRef50_A0A1Q3PBW7 Uncharacterized protein n=1 Tax=Dyadobacter sp. 50-39 TaxID=1895756 RepID=A0A1Q3PBW7_9BACT  ali  28  5..TYLINKGINRSIVFRGLKGXXXXXXXXXXXXXXXXXXXXXXCRVNTYLCLLIAVFMACILLTIVYQLSASFGEHGLTKALAARKIPDLIKARSRKQFIKGRQTASSN. 111
17 6.000e-14UniRef50_A0A1H7B8F7 Uncharacterized protein n=2 Tax=Dyadobacter koreensis TaxID=408657 RepID=A0A1H7B8F7_9BACT  ali  37  237.KQYPINKGINKSLVFKGLKAQYIGYMGLGLLIDLLFYAVLYTLKXXXXXXXXXXXXXXXXXXXXXXXXNAQYGEHGLIKAMAKRKTPKIIRSFSRRIFQ.......... 335
18 7.000e-14UniRef50_A0A1H6ZTG4 Uncharacterized protein n=4 Tax=Dyadobacter TaxID=120831 RepID=A0A1H6ZTG4_9BACT  ali  30  4.TSYPINKGINRSIVFRGLKGQXXXXXXXXXXXXXXXXXXXXXCGVNTYISLLLTVVLAAAGMTGVYHLSQTYGEHGLIKAMAARQLPKLVKSTSRAKFIK......... 103
19 9.000e-14UniRef50_UPI000D714B3B DUF4133 domain-containing protein n=1 Tax=Chitinophaga sp. S165 TaxID=2135462 RepID=UPI000D714B3B  ali  39  3.SIYEINKGINKPIEFRGFKGQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVSGFVLFSWVYRLSHKYGEHGLMVATAFRQVPPAIICNNRRLFVELLKREQ... 108
20 1.000e-13UniRef50_C6W384 Uncharacterized protein n=5 Tax=Dyadobacter TaxID=120831 RepID=C6W384_DYAFD  ali  29  5.SVYQINKGINTSIEFKGLKAXXXXXXXXXXXXXXXXXXXXXXXXXRSYICVGIVVCLGIPMIMGIYHLSSAYGEHGVTKMLARRNIPRYVKSNSRRIFK.......... 103
21 2.000e-13UniRef50_A0A1G7ISF3 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A1G7ISF3_9SPHI  ali  33  4.SIYHINKGINKSIEFKGLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLALTGGIAATGSARIFSLSHQYGEHGLMKALARRRIPRVIKSYSRRKFQQLSLKEEKK. 111
22 3.000e-13UniRef50_UPI000907E6D6 DUF4133 domain-containing protein n=2 Tax=Bacteroidia TaxID=200643 RepID=UPI000907E6D6  ali  61  2..EYPINKGAGNPIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGSLLVWLTFRLNARYGEHGLMKLLAERRHPRYLIHRRRLFRLLTKRRT.... 105
23 7.000e-13UniRef50_A0A1H6QCS8 Uncharacterized protein n=1 Tax=Dyadobacter koreensis TaxID=408657 RepID=A0A1H6QCS8_9BACT  ali  31  3.KSYEINKGINKSILFKGLQGQXXXXXXXXXXXXXXXXXXXXXXKVNTFLSLAVTVFLGGVCTLLIYHMNSTFGEHGLSKALAKRKIPHAVRSRSAVCFRRPKHQ..... 106
24 1.000e-12UniRef50_A0A126P4B3 Uncharacterized protein n=3 Tax=Cytophagales TaxID=768507 RepID=A0A126P4B3_9BACT  ali  37  1MGHYPLNKGINKPIELKGLGSRYXXXXXXXXXXXXXXXXXXXXXEANAYLSVALALGGGFAWVTRVFALSAKYGEHGAMKLRAKSRQPQRIVSRNARLFKDLKQS..... 106
25 2.000e-12UniRef50_A0A1H2U474 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1H2U474_9BACT  ali  46  4.SVYQINKGINQSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAGTFLVMKIYGMSHKYGEHGLMKTLARKQVPNVIKSRSRNVFMGTK....... 105
26 3.000e-12UniRef50_G5HBB4 Uncharacterized protein n=2 Tax=Alistipes TaxID=239759 RepID=G5HBB4_9BACT  ali  59  142..EYEINRGIGRDVEFRGLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCICTGITVATTVVYLTFRLNKKYGRWGLMKLVASKRHPRRIVHRKRIGRIFRCQKK.... 245
27 3.000e-12UniRef50_A0A015QJ10 Uncharacterized protein n=1 Tax=Bacteroides fragilis str. 3397 T10 TaxID=1339284 RepID=A0A015QJ10_BACFG  ali  51  1.................................MLLVVVILYIAGVNQWICVPFGLLSGSLLVWLTFRLNARYGEHGLMKLLSGKRHPRYLIHRRRLFRLLTKRRKK... 74
28 6.000e-12UniRef50_A0A1G5IDL7 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1G5IDL7_9FLAO  ali  36  4.SVYSINKGINQSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCGGLLVFNIYRMSNTYGEHGMMKAIASRQLPKCIKVYSRAVFVKI........ 104
29 1.000e-11UniRef50_K5CDJ9 Uncharacterized protein n=30 Tax=Bacteroidetes TaxID=976 RepID=K5CDJ9_9BACE  ali  60  2..EYNINKGIGRNVEFNGLQXXXXXXXXXXXXXXXXXXXXXXXXXXXRWFCIGFGVLSAFSLLFGVFHLNKKYGPNGLMKLAAVKYHPSYIINRKRISSLFKKR...... 103
30 2.000e-11UniRef50_A0A086AIR5 Uncharacterized protein n=23 Tax=Bacteroidetes TaxID=976 RepID=A0A086AIR5_FLAHY  ali  37  4.SVYQINKGINQSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTLWVLKIYKMSQKYGEHGMMKALAKRQIPKAVKSQSRKIFMMEK....... 105
31 5.000e-11UniRef50_D5BJS5 Uncharacterized protein n=14 Tax=Bacteroidetes TaxID=976 RepID=D5BJS5_ZUNPS  ali  46  4.SVYQVNKGINRSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTLLVMKIYRMSHQYGEHGLMKTLARKQVPKAIHSRSRRAFLKR........ 104
32 5.000e-11UniRef50_UPI0009DCE1EF DUF4133 domain-containing protein n=1 Tax=Chryseobacterium sp. YR477 TaxID=1500295 RepID=UPI0009DCE1EF  ali  55  1......................................MIMYMAGVNTYICLLLGGTTAGLLVWKTFSLNRKYGEHGLMKLGAKKKHPQYIISRKYIFRYIKVHSKKA.. 70
33 9.000e-11UniRef50_A0A1G8NMK8 Uncharacterized protein n=2 Tax=Mucilaginibacter gossypii TaxID=551996 RepID=A0A1G8NMK8_9SPHI  ali  34  52.SIYTINKSINKSIEFHGLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPAALFGAMKIFALSRRYGEHGLMKAMARKRVPRVLKSYGRRFFQQLTHKK.... 156
34 1.000e-10UniRef50_A0A085ZGY0 Uncharacterized protein n=44 Tax=Bacteria TaxID=2 RepID=A0A085ZGY0_FLAHY  ali  36  4.SVYSINKGINQSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAGGFLVFKIYRMSNTYGEYGMMKALAKKQIPKWIKVYSREVFMKL........ 104
35 2.000e-10UniRef50_UPI000C0BC116 DUF4133 domain-containing protein n=1 Tax=Sphingobacterium sp. 1.A.4 TaxID=2044603 RepID=UPI000C0BC116  ali  35  1MEKFRINKGINTPLEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSGGTMIWVTYRLSDRFGQYGLQKWAARRRWPKVIRIRSRAIFNDPSIKEHKN. 109
36 3.000e-10UniRef50_UPI00071688AB DUF4133 domain-containing protein n=1 Tax=Algoriphagus resistens TaxID=1750590 RepID=UPI00071688AB  ali  30  3...YRVYKGVDQDMEFKGLKSQYLVYMGVVLGGDXXXXXXXXXXXXXXXXXXXXXXGSGFYLSVWIAGLNKRLGKDGLMKKQSFSRLPYSIRIRNRGFVKSLRAKQR... 106
37 4.000e-10UniRef50_A0A1I1LIA8 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1I1LIA8_9FLAO  ali  41  4.SVYQINKGINKSIEFKGLKAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKIYRMSNKYGEHGMMKALAAKQVPKCIKTYSRAAFIKL........ 104
38 4.000e-10UniRef50_A0A2T0SNP7 Uncharacterized protein DUF4133 n=2 Tax=Spirosoma TaxID=107 RepID=A0A2T0SNP7_9BACT  ali  37  3....EVNKGIGNPVEFRGLKGXXXXXXXXXXXXXXXXXXXXXXXXXNVYLATAIVIASAGGGIWYCMRLSAKHGVSGLLKLEATRSQPKAIIISSAKPFAKLRETKRPR. 108
39 5.000e-10UniRef50_A0A2W7T7Y4 Uncharacterized protein DUF4133 n=2 Tax=Algoriphagus ratkowskyi TaxID=57028 RepID=A0A2W7T7Y4_9BACT  ali  40  1.............MEFKGLKAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXCMTVAVMLATADFMLVFHLSGTYGEHGLMKRMARNQVPDSVIIRNRKIFYSLIKR..... 92
40 7.000e-10UniRef50_A0A1N6KB64 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6KB64_9BACT  ali  30  3.TVYQVNKGINRSIEFKGIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCMAIIIPTAAIFYTVIQRISKKYGEHGLTNYFSRKRLPSSIQTKTRNIFFQL........ 103
41 8.000e-10UniRef50_H1YHX1 Uncharacterized protein n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=H1YHX1_9SPHI  ali  35  4.SIYHINKGINKSIEFQGLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTYMSIKIFAMSKKYGEHGLMKAMAKKQVPKVLKSYSRKFFQAMNK...... 106
42 9.000e-10UniRef50_A0A066WVI0 Uncharacterized protein n=15 Tax=Bacteroidetes TaxID=976 RepID=A0A066WVI0_9FLAO  ali  38  4.SVYKINKGINQSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGSLLVLKIYRMSHKFGEYGLMKALSKKQLPKAVRTYSRKVFMM......... 103
43 1.000e-09UniRef50_I3YK40 Uncharacterized protein n=8 Tax=Alistipes TaxID=239759 RepID=I3YK40_ALIFI  ali  41  2.........................LFVAGLLGVFVCFAGMYMSGVPQGLCILFALTAGLAVTGGTFYLNRRFGPHGLQKLMASRRHPRRIVHRRAVGRLLRFRRT.... 82
44 1.000e-09UniRef50_A0A1M4ZGT1 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1M4ZGT1_9BACT  ali  34  4.SVYTINKGINKPITFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVLVLGGGTGWFLYISRLSHRYGAHGMMKKIAAGKVPKVVKVRNRKVFYL......... 103
45 1.000e-09UniRef50_A0A235DZQ8 Uncharacterized protein n=2 Tax=Sphingobacterium cellulitidis TaxID=1768011 RepID=A0A235DZQ8_9SPHI  ali  28  4.SIYRIQRDINRPIEFFGLQSXXXXXXXXXXXXXXXXXXXXXXXXXSRIFSLSVMVVSGILWTVVVHGWNRRYGKYGFLKSYARRKLPSSLRIRDRRQFIYFKDRE.... 108
46 1.000e-09UniRef50_UPI000B8168ED DUF4133 domain-containing protein n=1 Tax=Sphingobacterium mizutaii TaxID=1010 RepID=UPI000B8168ED  ali  27  42.SIYRIHRDINRPIEFHGLQXXXXXXXXXXXXXXXXXXXXXXXXXXXRIMSLSGLVLIGLAWTAQVQKWSKRYGRHGLLKSYARRKLPSSVRLRDRRTFICIKP...... 144
47 2.000e-09UniRef50_A0A1C2GRL3 Uncharacterized protein n=11 Tax=Bacteroidetes TaxID=976 RepID=A0A1C2GRL3_9SPHI  ali  48  1MALYQINKGINKPIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFYQVFKLSHKYGEHGLMKKAAKRYLPNHLKFTTRNLFLKLKK...... 104
48 3.000e-09UniRef50_A0A1N6E4G9 Uncharacterized protein n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6E4G9_9BACT  ali  39  3.SVYTINKGINKSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGLVLKVYALSNKYGEFGMMKAMAKKMVPKVIKSYSRAVFRNLIVQNKK.. 109
49 4.000e-09UniRef50_A0A1K1T0J4 Uncharacterized protein n=2 Tax=Chitinophaga sancti TaxID=1004 RepID=A0A1K1T0J4_9BACT  ali  41  31.SVYLVNKGINRSIEFKGLKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFSVMKIYSMSNKYGEHGMMKVMARRSVPKHVIARSRKVF........... 128
50 6.000e-09UniRef50_S2DIQ2 Uncharacterized protein n=1 Tax=Indibacter alkaliphilus LW1 TaxID=1189612 RepID=S2DIQ2_9BACT  ali  37  4..TFKINKGVNAPMEFQGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAFGAWKIMEMNKTYGENGLMKLSARKRLPRVIRFRDRVFVKRLKTLNKLN. 110
51 7.000e-09UniRef50_U2AS79 Uncharacterized protein (Fragment) n=1 Tax=Capnocytophaga sp. oral taxon 863 str. F0517 TaxID=1227266 RepID=U2AS79_9FLAO  ali  40  1..............................................NSFVCLGVGVSMVSLVVWQTFSLNQKYGEHGLMKQAARKRHPKYLRHQRSPRQFIRYPKPKT.. 62
52 1.000e-08UniRef50_L0G5I3 Uncharacterized protein n=2 Tax=Echinicola TaxID=390846 RepID=L0G5I3_ECHVK  ali  31  1MKRYTVNKGVNRPISFKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGVACGFMGYLLVEGTFKMNRKYGRHGLKKRLVHRKVPLGIKVRDRDFVRTLNPTAHG.. 108
53 1.000e-08UniRef50_A0A249T1F6 Uncharacterized protein n=2 Tax=Chitinophagaceae TaxID=563835 RepID=A0A249T1F6_9BACT  ali  32  4.SVYKINKGVNNAIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGALTFFLFMKVYKLSNKYGEHGMMKKIASRGIPKVVKCNDRHIFK.......... 102
54 2.000e-08UniRef50_A0A2S7IEV8 Uncharacterized protein n=1 Tax=Siphonobacter curvatus TaxID=2094562 RepID=A0A2S7IEV8_9BACT  ali  27  5..SYATHQGINRPVELYGFKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVSLVGGLGGGWAYLLHRWSQRYGAQGLLKFWARRQLPSHLSLTSRTLFMPMNHEKRP.. 110
55 2.000e-08UniRef50_A0A173MAB1 Uncharacterized protein n=1 Tax=Filimonas lacunae TaxID=477680 RepID=A0A173MAB1_9BACT  ali  31  1MSVLEVNKGVNRPIVFKGFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAYMAYIQNLSKKYGQHGLMKNMANKILPDNITTNSANIFQQINTTYEIN. 109
56 6.000e-08UniRef50_A0A1F2KCU0 Uncharacterized protein n=3 Tax=Sphingobacteriales TaxID=200666 RepID=A0A1F2KCU0_9SPHI  ali  37  6..NYSINKGINRPIEFRGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGSGLFGMVYRFNAKYGQYGLMKARALRKVPAVIFSRNRKIFEQLKKSVR... 111
57 9.000e-08UniRef50_A0A1H4AC14 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1H4AC14_9BACT  ali  38  8..SYKINKGVNRSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLGLTLCLGAALFITVNKLNVRYGVHGLKKRLARRKFPVSIR.................. 97
58 1.000e-07UniRef50_A0A0A7LQT7 Uncharacterized protein n=4 Tax=Hymenobacter TaxID=89966 RepID=A0A0A7LQT7_9BACT  ali  46  1MPIYDLNRGINKPVEFKGLVGSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRRYGEHGLMKAAARRSSPRYITNRHSRLFQRLNEDPTSR. 109
59 1.000e-07UniRef50_A0A212ITB7 Uncharacterized protein n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A212ITB7_9BACT  ali  64  1........................................MYMIGISQVICIGFGVITAGTLVWATFHLNDKYGEHGLMKLQAIRNHP...................... 48
60 2.000e-07UniRef50_A0A096AE44 Conjugal transfer protein TraF (Fragment) n=2 Tax=Prevotella TaxID=838 RepID=A0A096AE44_9BACT  ali  41  21..................................................CLVIGIVGATLVVWQTFAMNRKYGQYGLMKKGAVRMHPRYLLNRRTVYHLIRNLQPKRKK 80
61 3.000e-07UniRef50_A0A0X7BFM1 Uncharacterized protein n=1 Tax=Flavobacterium sp. TAB 87 TaxID=1729581 RepID=A0A0X7BFM1_9FLAO  ali  40  4.SVYKINKGINQSIEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVSGVVLVLKVYKMSSKYGEYGLMKAIAYKQTPKRIKVKSRKIFRF......... 103
62 4.000e-07UniRef50_F4C121 Uncharacterized protein n=32 Tax=Bacteria TaxID=2 RepID=F4C121_SPHS2  ali  36  3.GIYSINKGVSQPIVFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLSHRFGTHGLMKYLAKRRLPHTIRFRSRRLFTSLNAHTHS.. 109
63 6.000e-07UniRef50_A0A1C4EWD3 Uncharacterized protein n=1 Tax=Chitinophaga costaii TaxID=1335309 RepID=A0A1C4EWD3_9BACT  ali  37  3.SVYQVNKGINAAFEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMVSKIYKMSNTYGAHGLTKRRAYRQVPVVIICRKRVSKILETTQRS... 108
64 1.000e-06UniRef50_UPI0009DD942E DUF4133 domain-containing protein n=1 Tax=Bacteroides nordii TaxID=291645 RepID=UPI0009DD942E  ali  62  1MAEYPINKGIGRPVEFKGLKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIGFGAASSSLLVWQTFALTPGTANTG................................. 77
65 4.000e-06UniRef50_A0A180FPL7 Uncharacterized protein n=1 Tax=Bacteroidales bacterium Barb7 TaxID=1633203 RepID=A0A180FPL7_9BACT  ali  60  1.................................................MCIAFGVVSALVLVYGTFYLNGKYGEHGLMKQQARRNHPPC.................... 41
66 5.000e-06UniRef50_A0A1X7IM74 Uncharacterized protein n=3 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A1X7IM74_9SPHI  ali  39  4..VYHVNKGVSRPIVFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRLSKRFGEHGLKKYLARSRLPKAIRYRSRKQFIHLKYRKQIR. 110
67 6.000e-06UniRef50_C2MEI7 Conjugative transposon protein TraF n=2 Tax=Porphyromonas uenonis TaxID=281920 RepID=C2MEI7_9PORP  ali  48  2..TYEVNKGIGATIEFKGLKSQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMNKKYGTHGLMKLRAVAKHPDYLIHRRTVRSMLRCATQRK.. 107
68 6.000e-06UniRef50_A0A017N758 Uncharacterized protein n=7 Tax=Bacteroidia TaxID=200643 RepID=A0A017N758_BACFG  ali  57  1............................................................MLVWLIFTLNRKYGSHGLMKLFAARQHPRRILSRKRITRLIKQQQ..... 45
69 8.000e-06UniRef50_UPI0004037A7D DUF4133 domain-containing protein n=2 Tax=Algoriphagus TaxID=246875 RepID=UPI0004037A7D  ali  33  6....RIHKGLDHEMEFKGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKILVWNRDMGPHGLMKRSAFRRVPSCIRIRSRGPIRSLKKSTSGR. 110
70 9.000e-06UniRef50_A0A0B0BTS1 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0B0BTS1_9BACT  ali  50  1MAAYNINKGVNARVEFHGLRAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGAAGAALVWGVFRLNSRYGQYGMMKLLAG.......................... 84
71 1.000e-05UniRef50_R5CRJ3 Conjugative transposon protein TraF n=1 Tax=Prevotella sp. CAG:255 TaxID=1262923 RepID=R5CRJ3_9BACT  ali  38  2..EYTVNKGAGKGVEFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSVFAYVVFRMNARFGEYGLIKRLARSHHPRYLISRKRILCMVQERRT.... 105
72 4.000e-05UniRef50_R6Y406 Uncharacterized protein n=3 Tax=Alistipes TaxID=239759 RepID=R6Y406_9BACT  ali  33  79............................................GVPQGFCILFALTAGLAVTGGTFYLSRRFGPYGLQKLMASRRYPRRIVHRRAVGRLLRFRRT.... 140
73 6.000e-05UniRef50_W4PP95 Conjugative transposon protein TraF n=1 Tax=Bacteroides pyogenes JCM 10003 TaxID=1235813 RepID=W4PP95_9BACE  ali  62  1..............................................................MYFTFMLNDKYGTHGLMKVTARRSHPRYIINRRAIPRLFTYKRQK... 45
74 3.000e-04UniRef50_A0A180FPF0 Uncharacterized protein n=1 Tax=Bacteroidales bacterium Barb7 TaxID=1633203 RepID=A0A180FPF0_9BACT  ali  85  1MADYPINKGIGKPAEFRGLKS......................................................................................... 21
75 1.000e-03UniRef50_UPI00088AC3B3 DUF4133 domain-containing protein n=2 Tax=Pedobacter TaxID=84567 RepID=UPI00088AC3B3  ali  38  4..IYQINKGIGKPIIFKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLSKKYGVYGLGKFIAKRGLPKYLKFKSRKVFTGLR....... 104
76 1.000e-03UniRef50_W6P418 Conjugative transposon protein TraF n=2 Tax=root TaxID=1 RepID=W6P418_9BACE  ali  80  1MAEYPINKGIGRPVEFKGLKA......................................................................................... 21
77 0.002UniRef50_A0A0A2F373 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A0A2F373_9PORP  ali  60  1MASWEINKGVGRTVEFRGLKAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLGATLVVWQTFAMNRKYG.................................... 74
78 0.004UniRef50_A0A2W7TT27 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A2W7TT27_9FLAO  ali  72  1MTNYNINKGIGKTVEFEGLKTQYIFIFAGGLLG............................................................................. 33

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.