current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60680875|ref|YP_211019.1| hypothetical protein (BF1359) [Bacteroides fragilis NCTC 9343] (Range: 1-245), from B.fragilis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# E-value Template Links and tools%idFirst MMCELGYFISSYRLNPYKFRFFPISNYRIHRSGMIFLLYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIRKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENYLast
1 3.000e-60UniRef50_UPI0003138761 RHS repeat protein n=1 Tax=Synechococcus sp. (strain ATCC 27167 / PCC 6312) TaxID=195253 RepID=UPI0003138761  ali  14  92..........RYTYDPVFNQTDELGRQTLYEIDPTGNRLSMTDVGGTTRYTYTAQGRVDLVTDPLGRIMNYDYDSLGRLIRLTLAQGRQQHFSYDAAGNLISINENGSRTEFRYDSLNRLTQVDPDGAVTSFSYDAAGNLIQTDPRNHPTQYAYDPLNRLARIDALGEETTYRYDPAGNLSVTDALGHRTQYRYDARNRLSETDPVGSRTTYRYDMADNLTVIDPLGNRTSYAYDARNRLIRET. 357
2 6.000e-56UniRef50_A0A2K9E5I6 tRNA nuclease WapA n=7 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9E5I6_9FIRM  ali  14  906VTDERG--TTYYEYDLMDRLINPDGTQITYTYDKAGNCTSVTVPSGTTYYTYDELNRLKSVTDPDGNTTTYTYDAIGNRKSVTYPNKTTTEYEYDYLSRLISRNEAGEIISYTLGPAGNRIRTENNGRVIKYTYDDTYKLIIENPDGDKTEYTYDAVGNRLSKSVNGVVTEYTYDENNRLITE----GQTVYTYDKNGNLSKKTNTGEEVTYTYDYNNRLTKVNITGATVEYAYDVDG....... 1157
3 9.000e-54UniRef50_A1TTQ3 YD repeat protein n=1 Tax=Acidovorax citrulli (strain AAC00-1) TaxID=397945 RepID=A1TTQ3_ACIAC  ali  13  12......................PLPHVSRTPFDANGHPEAAVDALGRETRTFDRRGNLTLHLDAAGHATRIEYGTEGRPVRVTDALGHTWTHEYDARGNRIRTDPLGRSTTTQYDARGLPVATDAAGRTRRLQWDASAQLIATDCSGRTSRYAYDALGHLASADALGHTTRYRHDAQGRLRVIEPTGATHRYEWDGEGQLLATDPLGGTTRYRYHGSGQPSRTDARGGVLRYHYDLGERLVALT. 245
4 1.000e-51UniRef50_Q64WF6 Uncharacterized protein n=59 Tax=Bacteroidaceae TaxID=815 RepID=Q64WF6_BACFR  ali  98  1.MCELGYFISSYRLSPYKFRFFPISNYRIHRSGMIFLFYFCCKPKKNIMKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIKKDIFGDTVIENNCGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIENY 244
5 2.000e-51UniRef50_A0A080K5C3 RHS repeat protein (Fragment) n=2 Tax=Snodgrassella alvi TaxID=1196083 RepID=A0A080K5C3_9NEIS  ali  13  608.MTDPQGGQWRYSYDEQGRETDPLGRTTQTQWLPHWLPTISVDPDGSSWYYYDERGNLLTVTDPLQQHTHYQYDRHGQVVCITDARGGNKHLRWNENGQLIQVDCSGSITHFYYNTAGNLTSITNAGNSSKYQYNAAGQLIATLADGRQEHYSVNAAGQLQSTDPAGHTTRYRRDQRGLVTRIDAAGRQLGFSYDAYGRLTATNENGEQYRFQYDAGDR.......................... 836
6 2.000e-50UniRef50_A0A2V8LFA9 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LFA9_9BACT  ali  13 2276....................TAEDG--TAYIIDQRTGLQSLADPNGNTLTIRDIVGRITSITDPNGNSMTYGYDPNGDLVSYTDNENNTSTYTYDSNHRLTIHDPRGQPIRNDYDPSGRLISTDGFGKVITYIHDIPNRTTVTDRLGHPTVFEYDERGNLRKTDARGGVTSFTYDANDNLTETNALGKTTTYTYDSNDHLTSTDPLNNVTQFTYNVLGKLSQTDPLGHVTTNTYNSAGELLTR.. 2520
7 1.000e-49UniRef50_A0A1V0TZX2 Uncharacterized protein n=1 Tax=Streptomyces gilvosporeus TaxID=553510 RepID=A0A1V0TZX2_9ACTN  ali  15  132..TDRLGQTTTFEYAPFAARTDPDGTRLTFSHDAHMQLVAVTNALGQTWYTYDPAGQLISESDFNGRTVGYQLDAAGQVVSRTNPLGQRIQYSYDVLGQLVAKNADGAITSYAYDSAGHQIRATSPDADVLRTVDALGNLISETVNGLTLTHTVDALGRTSRTTPSGHTSAWTYDRAGRRTSLATPGGRLDFAYDAAGRENERT-LGERLTLAWDAEGRLTVITPDGTRWRYLYDPFGRRIAK.. 379
8 7.000e-49UniRef50_K9R0F2 RHS repeat-associated core domain protein n=1 Tax=Nostoc sp. (strain ATCC 29411 / PCC 7524) TaxID=28072 RepID=K9R0F2_NOSS7  ali  5054.ITD-GRGTTTYSYDPRNRLTETDGRTLIYTYDSVGNRTSIQTPSGKTTYTYDALHRLQTVTDAGGNFTQYTYDAVGNLTRTILPNNLVETRQYDQLNRLI-----------------NLTQTRPDNTVIAYTLDAVGRVSVTEGNGRRVNYSYDALYRLTRETVGDRTISYTYDAVGNRLSRDSLEGNTTYTYDGNNRLLQAALGNQTTLYTYDNNGNLLRQTQGTNQTRYTWSPENRLLS... 5297
9 9.000e-49UniRef50_A0A1Y1RTX3 Uncharacterized protein (Fragment) n=1 Tax=Marispirochaeta aestuarii TaxID=1963862 RepID=A0A1Y1RTX3_9SPIO  ali  16  23....................................................DLTGNRTAVIDKNGNTTVFEYDALNRLIKQTDPLNTTIRYEYEPRGLVKRTDRNGGTVLFTYNSLGTVTATDPAGKTIETTYNETSQPTRKDRNGNTTTFEYDPLNRLIITDPYGHETRRSYNYLGLVAITDPLGNTRTFDHDPAGRLVVTDPLGGTKQYTYDPAGNLISQDEMERETGYTYDQLNRLKSTT. 221
10 1.000e-48UniRef50_A0A2V7UMD1 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7UMD1_9BACT  ali  13  71..............................................TTNITYTPEGKPEHITDPRNKTTILAYNPSGDLTSVKDPLNHETTFGYDDLGRRTVTDALNHTTSTLYDDRGHVTRITPDLTHTDFAYDAGGRRTVTDPLGRKTSYVYDTYGRLAVVDPAGGTTRYSYDLMGNLTSTDANSHTTSFEYDAYNRVKVTYPGGAYESFTYDSAGRLTRVDRKNVTTTYGYDVLSRLTSKTY 276
11 3.000e-48UniRef50_A0A2K9EBZ7 tRNA3(Ser)-specific nuclease WapA n=3 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9EBZ7_9FIRM  ali  22  871...............................YDPVNFKLVTQD---GTEYIINKNTGVKSITEPNGNTVTFTRDSEGRITEITDPMGNSIKYEYDAYGDLVVTDQEGNVTRFTYDDNGRLIIKDRLGNITVYEYDDDGNLTTIDALGNKTSFSYDDKGNKISVDALGNETKYTYDAYGNLTRTDALGNTISYTYDSKGRVLSTDAEGNISIYTYDSKGNRISESKNGKETVYKYDSRGNLISET. 1144
12 9.000e-48UniRef50_A0A259SUD7 Uncharacterized protein (Fragment) n=1 Tax=Microbacterium sp. 14-71-5 TaxID=1970400 RepID=A0A259SUD7_9MICO  ali  13  412.VTRPDGAVWSFAYDQLTSITDPLGHAATYGYDDKKRMSTVTAADGVTTNTYDDQGRVVKQTDTTGAKTTFTRDDQGRVTKVVTPLNNTISTGYSNWDTSSKTDGNGKKTSYSYDAQGRPVQVNPDGTSTKVAYSSSGDVSKTTADGAVTTYAVDAKGRVTVTGPDDAVWASTFDDAGNLTSTDPNGNVTSYTYDGHGNLTGIDAAGGVTALAYDAASRLVSTDPTGAVSTLSYDTVGNLTSRT. 683
13 1.000e-46UniRef50_UPI00031C15A5 VWA domain-containing protein n=1 Tax=Calothrix sp. PCC 7103 TaxID=32057 RepID=UPI00031C15A5  ali  14 2635.VTD-SRGVTSYTYNERDQLTTVDGVTIGYTYDIAGNRTSLTTPAGTVGYTYDALNRMQTVSDRSGGVTRYVYDAVGNLVRTELPNNTVETRRYDSLDRLVSVEASGIIAGYEYTAGNRLAVTEANGRQVNYAYDQLYRLVQETAGNRTIGYTYDAVGNRLSRNDSGGVTTYSYDDNDRLLREILNGQTTEYTYDDNGSLTVKVNGTDQVNYRWDDQGRLIIVTPQGQRIEYGYDPDGNRVAV.. 2895
14 4.000e-46UniRef50_E9I3M9 Uncharacterized protein (Fragment) n=1 Tax=Daphnia pulex TaxID=6669 RepID=E9I3M9_DAPPU  ali  17  2.............................................................TDANLHATTYAYDALNRLAKETDALGNFITYDYDKVGNRSKTDKNGHENTFIYDNANRLTQTDGAGQLTSHAYDAVGNRITTDANKNSTSFDYDANNRLTQTNALGQVTSIVYDAVGNRSVTDANGHATSYAYDADDRLISTDALGKVSTY---------VLDAEGNRTKFT-DANGHATSYTY 181
15 6.000e-46UniRef50_A0A2V7I021 Uncharacterized protein (Fragment) n=2 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7I021_9BACT  ali  11  137.IVDAGGGVSTFTYNAKGNLLDARGHTTTYTYDDMDRRLTRTDALGRTTFTYDPNGNVIRTVDANGQTTHHEYDALNRRIRTAHADGSTVEYFYDAIGRLIRTDTEGGTILMTYDAQDRLTEEITAQGLIGYAHDVLGRRRSVSVDGRISTYDYDRNSRLTRTLPNRFSTRYEYDDTGRVTRLDMAGRRTTMTYDRNGNVTSVLGPDGFATLVWDARDRLRGATRVDAIWTFDYDGLGRRSRR.. 455
16 8.000e-46UniRef50_A0A2N2DAW4 Uncharacterized protein (Fragment) n=1 Tax=Firmicutes bacterium HGW-Firmicutes-14 TaxID=2013775 RepID=A0A2N2DAW4_9FIRM  ali  17 1715.........................NKTTLDFDTEGKITKITDKNGNTTFTYDSNKRLIKVTEAAGRTLTFDYDSNGHITKVTDPLNRQHIYGYTGGNLTTCTDPGGGTTTYIYDADHRITQEDARGNVTSFGYDFTARKTTITEGGKTKTQEFDGYYRLVKTDPLGYTTIYTYDGLGNRTITNANGNVTSYDYDLNGNLTRTDPLGSTIENYYNNDSDLIRKDPNGNITRFDYDSKGNLLTT.. 1960
17 1.000e-45UniRef50_A0A2K9E2Z9 tRNA(Glu)-specific nuclease WapA n=2 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9E2Z9_9FIRM  ali  22  2.......................................................GNKISETDANGNKTEYIYDSMNRLIGMIDGNGKSIRIEYNAAGQQSAIDKTGNRTEYEYDAFGNLIVRYADGTTEKSTYDAEGRTSSTDRLGRTTRYEYDKLGRLIKTNPDGSCVENEYDPLGRIIVKDERGNVTKYKYDEVGNTTVIDALGNVTKYEYDKNGNRTKIDANGNVITFEYDSDNNPVRTIF 224
18 6.000e-43UniRef50_A0A1H4XZH0 RHS repeat-associated core domain-containing protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1H4XZH0_9ACTN  ali  13  540.ISDRNGNRITFDYDEAGAPTDADGRITRYGY-IQGNLTEVTNSSGLLRFAYDDRGRVVSWTDTNDRRYDYHYDEQDRTTTVTDTDGHVTRYLIDKRLQVVEVDPLGHTTRTERDQFGRPTVTDPVARATSFTYDEAGRLTVTRPDGSQSSTVYNYMGAVTITAPDGATWHQEYDVRGNRIVTDPSGAITRFTYDHRGCLTVTDALGSVTEIRCDDAGLLAVTDPLGNTTYYHRDAFGRVSSIT. 846
19 2.000e-42UniRef50_A0A2K9E0K3 tRNA3(Ser)-specific nuclease WapA n=3 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9E0K3_9FIRM  ali  19  862...................LTEPDG--TVYIINQHTGLESITDIYGNTVFDRDSEGRITSITDPMGNKVTYEYDYYGDLVSVTDQEGNTTKFTYDDDGRLIRVDAEGNRIEYSRDIENRQIVEDRMGNITVYNYDEKGNIIEVDPMGNKTTFTFDSNNNLSETDALGNTIYFTYDSENRVTSKTPNGNVIVNTFDDKGNLVVSDSSGKKTIYNYDNSGNLVSIDAEGNITRYTYDSNGLKTSET. 1150
20 5.000e-42UniRef50_A0A0F2SBH7 Uncharacterized protein (Fragment) n=1 Tax=Peptococcaceae bacterium BRH_c23 TaxID=1629714 RepID=A0A0F2SBH7_9FIRM  ali  13  342...DPLGNKTTYEYDPVGNLTDSLGVSRNFQYDLLDNLVKSIDPAGNTTYEYDPLGRKTKQTDTLGRSTLYNYDFAGRLTGVTEPREGKTNYQYDPAGNLSITNALGKTWKKTYTPLDQLLSETPSGKETKYSYDVNGRLKETDPMGQVSAFEYDELGNITKAGYPNGSEEYTHDALNRITKVMSNGKTMDLAYDPVGNLTQTDPEARIT................................... 578
21 3.000e-41UniRef50_UPI000C6D5DFF RHS repeat protein n=1 Tax=Herbivorax saccincola TaxID=1677857 RepID=UPI000C6D5DFF  ali  20  364...............................................VVFDRDSEGRITSITDPMGNKVTYEYDYYGDLVSVTDQEGNTTKFTYDDDGRLIRVDAEGNRIEYSRDIENRQIVEDRMGNITVYNYDEKGNIIEVDPMGNKTTFTFDSNNNLSETDALGNTIYFTYDSENRVTSKTPNGNVIVNTFDDKGNLVVSDSSGKKTIYNYDNSGNLVSIDAEGNITRYTYDSNGLKTSET. 610
22 3.000e-41UniRef50_K7W2J0 YD repeat-containing protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=K7W2J0_9NOST  ali  13 2639.VTD-NRGVTSYVYDERDRLISPDSRKIQYTYDNAGNILTLIVPSSTTTYTYDKINRIDTVKDADNGVTDYDYDAVGNLIKTEFGNGVIENQQYDLLNRLTYLENRNQTYTYTLDAMGRLKVEENDGRIVEYSYDDIYRLTTTDSGNKTIQYQFDAVGRLQKIDSVEGTTSYSYDDNDRLLQETLGGKVTNYQYDNEGNLKAKVENGTTAEYEWNAKGELTAVTENGETIEFEYDHNG....... 2894
23 5.000e-41UniRef50_A0A2N3G782 Uncharacterized protein (Fragment) n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G782_9ACTN  ali  18 1613................................................SKSFDQTGLLTTVRDSNQNTLSFTRDTSGKATSVTDATGQSASVTYEGDRITKITDPAGRELLYSYDSRGNLESARNLGDFTRYTYDDQHRVSQEDAHGHVVNFTYDAAGNVTRTDKLGNKTTSTYDENGNLTETDPLSHTTTYTYDSRGNLTTTDPLGNISTSAYDARNNLISTDPLGNTTTYTYDAQGRQLTTT. 1878
24 1.000e-40UniRef50_A0A1E2ZD14 tRNA(Glu)-specific nuclease WapA n=1 Tax=Candidatus Thiodiazotropha endolucinida TaxID=1655433 RepID=A0A1E2ZD14_9GAMM  ali  12 2817.VTDAAG-ITSYGYDAVGNRTSPNGSSEVYVYDSLNRLTRTYDGASTLIRAYDATGRRIGIDEQSGRSTAYGYDDLYRLTSITDSQNGSASYQYDGVGNRIYSTIDGVQTAYTYDANDRLTQQ----GGTSYTYDNNGNTLSETLDTDTTTYSYNAKNELISVELGGITTQYRYNPNGIRTSKTESGVTTRYIVDENRQVLIEDDGASQVSYTY--GDDLISQDRSGEIHYYHYDGLG....... 3062
25 3.000e-40UniRef50_U2RRB4 YD repeat protein n=1 Tax=Leifsonia aquatica ATCC 14665 TaxID=1358026 RepID=U2RRB4_LEIAQ  ali  16  592..............DGIGNLVDAEGRTTTLSYGPFYPLASITDSSGQTIQVSDALGRVTGFTRPGGDRWSLSYDGAGNLTTITLPDGRTKQFTYDDAGQTTYTDNLGRTSVYSYDADNNLSSTDENGAKTKYAYDAAGNLTTTAADGIVTKYTYTPTGLVTKTDTGGRTWSYDYDGSGHLVAVQPDGTTIANEYDAGGNLVKTTPSGAATTFGYDSAGNVTSTDAIGRTTRYAYDAAGRMTAQT. 918
26 4.000e-40UniRef50_A0A1C6FQC5 Cell wall-associated polypeptide CWBP200 n=1 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C6FQC5_9FIRM  ali  11  203.VTDSTG-TTMFTYDLMDGLTYPDGNYVAYGYDNACRLTAVTTPFGATAYEYDLLDRLTRVVDRNGYATVYEYDANGNRTAVHYANGFTTTYEYDLLNRLITIDSKDNVVQYTYTAAGERKSVTELDRTVEYTYDSLYRLTSITEGEKVTTYAYDNVSNRILKTENGEETVYTYNALNQLVS----DSETSYEYDLNGNLVRIIGSAQSALYEYNAENKLVRATVQNGVLSYTYDYEGNRTSKT. 457
27 5.000e-40UniRef50_A0A1W9N250 Uncharacterized protein (Fragment) n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9N250_9DELT  ali  15  400.........TVYKFNSAGKLINTKNQSLTFAYDASGKLIRITEPISGVNYAYNAQGLLSIVSDPLNRQIKLGYDANRNLTTITDPKSKITTFTYNASGQTTITDRSGNVRKFTFDKNYQMEKQDELGNVSKYTYDDKGNRISTDGNAHATQFGYDAGGQMIVTNAAGNISRMTYNSNGNLISTDALGKQSTFAYDSQNNLTATDPQGNITRYTYNANGQLTVTSPAGNITTYEYDAAGRLTR... 714
28 3.000e-39UniRef50_A0A1I4LJL8 Intein C-terminal splicing region/intein N-terminal splicing region/RHS repeat-associated core domain-containing protein n=2 Tax=  ali  12 3320....PDGSVLSYGYDQAGNRTDDQTRSTSYSFDKLNRLATVNGGLGETVYSYDKVGNRASVSYPNGNVTSYSYDALNRLVALTDPNGRSTGYSYDELYRLTVTDPDGVHTAYSYDANDRLTQQ---GGV-SYSYDANGNTLTETEDGQVTRYTYDARNMLVETTRPGYNASYGYNADGIRTRRTENGASTQFSYTYGDDLLVQQRSGATSYYLYDGHGSTRALADEGSTVTYHYDAFGVLLAR.. 3636
29 4.000e-39UniRef50_C3QND5 Uncharacterized protein n=15 Tax=Bacteroides TaxID=816 RepID=C3QND5_9BACE  ali  63  1................................................MKKILFILFATQFILAPYIIKSYGANLIEDNYGYSGVNQERKTVEKDIFGNIIIRDDKGNRKTIEKDIFGNITIRDDKGNRKTIEEDIFGNITIRDDKGNRKTIEEDIFGNTIIRDDKGNRKTIKKDIFGNTIIEDDKGNRTTIKKDIFGNEIIESSDGHRKIIKKDIFGNTVIEDY.................... 177
30 7.000e-39UniRef50_A0A1Y1Q1V2 Uncharacterized protein (Fragment) n=1 Tax=Thiotrichaceae bacterium IS1 TaxID=1934244 RepID=A0A1Y1Q1V2_9GAMM  ali  17  1........................................................................YDALNRLVEVQDPLKRVTKFNYDALNRLTSVDALSGNSRQGFDKDGQRDSTDPNGNQTRFQFDQNGRLVKETDTGDKVSYTYNARDLLAVTNARGQPRQLEYDAAERLVVTDPDG-TVSFSYDKNGNVLTVSDSQGTITRTYDALNRVTSTDVNGNTLHYEYDEVGNLVALTY 178
31 2.000e-38UniRef50_W7V1U7 Uncharacterized protein n=1 Tax=Ruminococcus flavefaciens 007c TaxID=1341157 RepID=W7V1U7_RUMFL  ali  11 2535.VVDRNGFVTQYEYDANGNRTYANGIEVTYSYDEVNRLVSVIDSNGETVAQYDAAGERTKVA-ELDRTVEYTYDELYRLTKITSSDGKVTTYTYDAVSNRISKTENGKETVYSYNALNQLIQENN----TVYTYDDAGNLISTDSGVKSSTYVYNASNKLLRATDEAYAEEYTYNYDGRLSKKTIKGAETSVRYDKDGNLISMERDGQTYIYLYDGHG--TVINADGELTTYNYDAFGNMLERT. 2817
32 2.000e-38UniRef50_A0A261GHG9 Uncharacterized protein n=1 Tax=Hahella sp. CCB-MM4 TaxID=1926491 RepID=A0A261GHG9_9GAMM  ali  14 2517..TDFNGQVTTYSYDINNRVIDGLGNTTTYAYDRMNRLVQEVQPSGTTTYLYDELNRLTTVIDPTGGRTLYIYDAVGNRETVSLANNQATSYEYDNLNRLTRTDYRGRTSTYTYDDLYRLTITDPINGNYEYQYDKVGNRTYSIIDGVHTAYSYDDNDRLTQQDANGNTLTYTYNAKNQLTAATQGGNRTTYGYNVDGIRTQKTDNGNQSYYVYDGLGSRSLTDTTGAETTYQYDAFGILLAST. 2899
33 3.000e-38UniRef50_UPI000D7BD92E LysM peptidoglycan-binding domain-containing protein n=1 Tax=Herpetosiphon sp. CA052B TaxID=2094568 RepID=UPI000D7BD92E  ali  15  911....................................RVTELRCPQATQLYRYDGAGNLVEVLNQANQSTSYQYDQNHRITRITDGAGRTTTYSYDDRGRLIRVDALNNREQYSYDDQNRLTSRTNALNTWHYRYDVQGNLSTTDPLGSVWRSEYDANNKLRDTDPLGATTIFTYDELGHLSETDALGAQTRYEYNAAGQVAMIDALGNRVAYAYDPQRRLTSIYPDGSTQTFVYDPMGNLVAET. 1209
34 3.000e-38UniRef50_A0A1I0M0Z2 RHS repeat-associated core domain-containing protein n=5 Tax=unclassified Ruminococcaceae TaxID=552397 RepID=A0A1I0M0Z2_9FIRM  ali  14 1862.VTNAAGEVISYTYDDAGMVVTVDDQTISYGYDNMGRLETVTDSEGTTTYTYDALGNRETTEYPNGVTTTYGYNENNVLISETDENGTVSSYEYDNNERLTCT-ELNRTVEYEYDELERLVSETDDVSVTTYSYDANSNRVSMDKDGVVTTYEYNELNQLVRADNAGNVATYTYDSYNRMVSASVNSGSQSYTYDYLGNRTSKTTDGETTYYVTD.............................. 2108
35 4.000e-38UniRef50_A0A2V2CT12 Uncharacterized protein (Fragment) n=1 Tax=Collinsella tanakaei TaxID=626935 RepID=A0A2V2CT12_9ACTN  ali  18  760...................VTDPQGRVTQLAYDSAFALSSITLPGGQLSIVTDSQNRITEIGLPSGAALKYAYDDAGNLISYTNGNGEATTYSYDGSHQISWFDANGTAVTNTYDGEGRVVKQDGEGHAAELRY-EDGKTTATDENGNVTVYHYDGQYRTTRIDPDGISESFEYDAGNRSAFVDGLGNRTAYEYDAAGNLVKQTRDGASQSYTWNAQNKPTSTDYDGATTLYEYSAAGDLVKTTY 992
36 7.000e-38UniRef50_A0A143C0Y0 Uncharacterized protein n=1 Tax=Streptomyces sp. S10(2016) TaxID=1783515 RepID=A0A143C0Y0_9ACTN  ali  106.VTDPLGKATAYTYDAVDNVTDALGKSVSSVYDKNNRLASTTNQLGKTTTAYDADGNLLSRTSPLGNKETWTYDGDGRQATTVDP-----------RGNVTGADPAQYTTTNGYDAAGNLTVTDPLGGVARTEYDAAGNVTKTDANNHATAYGYDAARHLTVTDPLDRVTSYAYDAEGNLTKKTTPRGSTSYASTPAG............................................... 298
37 7.000e-38UniRef50_A0A2K9E428 Deoxyribonuclease RhsC n=2 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9E428_9FIRM  ali  22  332..............................................................................LESVTDINGNTITYTYDYYGDLVVTDQEGHVTRFTYDAEGNRIVTDRMGNVTVFSYDEKGNLKKVDAMGNTTSYTYDENGNLTETEPLGNTITYTYDENNNVTSTDAMGNKTEYTYNAKGQLTETDPMGNTKINEYDSKGNLIVTNPLGNTTFFEYDSKGNLTKMT. 583
38 7.000e-38UniRef50_A0A0S7BI99 Protein containg RHS repeat-associated core domain n=1 Tax=Longilinea arvoryzae TaxID=360412 RepID=A0A0S7BI99_9CHLR  ali  14 1240.................GNLYEPTG----YTY---------TDPYGR---QYDADGSLHSITDMNGNVLTFSRDGEGRITQIIDPEGNAYAYGYDDQGNLAAVTAPGVATSLVYDPRGNPLIVDALGNVFHYTYDASTRTTVTNPDGGTVVSVYDANGKLLRTDPLGHTTSYTYDANQNLTQTDPLGHTTSYTYDANGNQTSVNALNQTYSTTYNQYGGVTKTDALGNVQTIHYDARYMPTSIT. 1498
39 9.000e-38UniRef50_D6KDU9 Rhs protein (Fragment) n=2 Tax=Streptomyces sp. e14 TaxID=645465 RepID=D6KDU9_9ACTN  ali  13  745......GLKWSYSYDAAGNLIDFDGRTVAYEYDPMGRPVARTTPLGRITSEYDVMSRVVAKEVA-GRRTHYTYDAAGRVASVTSPTSG-ISLERDVIGRVVAETVDGRTTRFAYDAAGRRTARTPTGAVARSAYDEVGNRTALRSDGHTLTFAHDAMGRLTSQDRALRARAYGYDPVGRPLRVTAENWTESYAYDAAGNEIRADWPDGRIRYEYDAAGRRLSKKPD--TWRYTWDEENR...... 1057
40 1.000e-37UniRef50_A0A0U5LFV2 Putative deoxyribonuclease RhsC n=43 Tax=Actinobacteria TaxID=201174 RepID=A0A0U5LFV2_STRRE  ali  17  467.................................................YAYDSSGNLTEVIDSSGEPLRFAYDTEGRVTRWTDRNGTWFAYVYDDRGRVTYTDSRGHTSVHRYNAEGMVVETDELGHVTRTEWDEYGPVAVTDPLGHTTRYAYDDAGNLTVIEPGGALWRHTYDDRGNLLTTDPTGAETRYTNDAAGLPTVTDALGHTRTAAYDPAGLPVATDELGHTTTVRRDSFGRVIEVT. 712
41 1.000e-37UniRef50_UPI000A19FC58 hypothetical protein n=1 Tax=unicellular cyanobacterium SU2 TaxID=1981054 RepID=UPI000A19FC58  ali  13 3816.VTDPDNGITQYSYDEVGNLIFPNGVVETKQYNLLNRLTFLKDANGVVLSSYDPVGNRLSIEEEDGRRADYIYDDLDRLISITDAGGRTISYVYDAVGNLERIDSVDGTTTYFYDDNDRLLTETTNGETISYSYDEEGNLLTRDADNQIT-YEWNPEGELVTENGETGRIELLYDADGIRVSINVDGEETRFEYNPDDDLISQEREGDRTFYQVDGLGRLL-TDIDGNITEYIYDAYGQLL.... 4100
42 2.000e-37UniRef50_UPI0008329810 type IV secretion protein Rhs n=5 Tax=Streptomyces TaxID=1883 RepID=UPI0008329810  ali  19  617.....................................................................TYGYDAFGHLTTVTKPSDRPLRFTYDDAGRITSTDTNGSSYTYAYDEADRVATTDPTGATTRTTRDTKHRLSSTDPLGRTTHFAYDDAGRPVATLPDGTTSTTTYDSHGNRTVTGPDGATWTHTYDAHGRVATTDPAGATTTYTHDPRGNLAVTDPLGHTTHYARDAFGRTTSVT. 868
43 4.000e-37UniRef50_A0A1A5PDV4 Type IV secretion protein Rhs n=105 Tax=Actinobacteria TaxID=201174 RepID=A0A1A5PDV4_9ACTN  ali  15  539................................DGTAWLASVTDRNGH-TFTVDDDGLPTALTHSAGHQVKYGYDQEGNLTAVTRPSGATTTFLYDDRRRVTAIDSNHSRYDYAYDDRDRLTYTDPDGHTTRHRIDHRCRVTTTDPLGHTTHYAYDTHGNLTRTDPLGRTIAHTYDHDGRLTMIRPDGSELRITRDPSGLPTEVVPDGARTGYAYDERGNRIVTEPAGHATHYTYDDAGRLTSVT. 812
44 5.000e-37UniRef50_A0A1G6MGN8 RHS repeat-associated core domain-containing protein n=11 Tax=Streptomyces TaxID=1883 RepID=A0A1G6MGN8_9ACTN  ali  12  936.VTGPQGLIWTYEYDAVGNITDFDGRTLAYRLDAAGQLTARTDALGGTSFERDRLGRVLRK-NVDGQVTTYTYDKAGRLLEAIGPDGHVTSYAYDSDGRLTTHDATGRELTRAYDEAGRLAATTAEARPVTYTYRADGRLTSVDRLSGTRTFALDPMGRVTTVHAPGWTERYAYDDAGNQTSATATGGRTRFEHDALGRVTSRKPE--TWRYAWDTENRLTVTTPDGTRWRYRYDPLGRRTAK.. 1274
45 9.000e-37UniRef50_A0A136PWZ1 Uncharacterized protein (Fragment) n=1 Tax=Micromonospora rosaria TaxID=47874 RepID=A0A136PWZ1_9ACTN  ali  12  601...........FGYDDRRRLVNSSGDPVRLDYDTDGRIVRWEDRNGEWTYTYDEAGRLTVVTDSLGGVRRFELNDRLQVVAETDALGATTRHEWDDTYRLSRTDPLGRTTRYEYGADRRPTVIRPDGSRSTTTYDGLGRATSTDFDGSTVSREFDTDGRLAEINASGEVVRFDRDAARQVISTTTGNGDTHYGYDALGRVVVIENENGSTEWHYDGEGNLVSIDAAGRAVRFEYDEAGNRTEYTY 913
46 1.000e-36UniRef50_A0A066YR04 Uncharacterized protein n=2 Tax=Kitasatospora cheerisanensis KCTC 2395 TaxID=1348663 RepID=A0A066YR04_9ACTN  ali  13  213VTDPATGLVRTFTPTPAGDVRDRHGRHYTLEYDEDGVPLSLTHSGGRITRYSYTDGHLTAVYNSSGKAMRFTNDAAGRLTSWTDRNNSQYRYTYDAHDRVTETNALGHTTSYINDHAQVVAVTDPLGHTTAYERDDHDRLAETDPLGRTTRYEYDGAGDLIITEAGGATWRQTYDPTGLRTSTDPLGATTHYTYDERGHLASTDALGHRTSIRCDDAGLPIVTDAAGATTRYRRDGFGRVTTVT. 545
47 1.000e-36UniRef50_UPI000A19F703 hypothetical protein n=1 Tax=unicellular cyanobacterium SU2 TaxID=1981054 RepID=UPI000A19F703  ali  15 5090...DTNGGVTTYFYNDNSNLIRPNGTVETREYDTLNRLTATTDINGEIIYELDAEGHRTQVTEQDGRLVKYYYDDLDRLTKETDAT-RTIEYTYDAVGNLSRFDSGEGTTLYTYDNNDRLLTETTDGVVTTYSYDNNGNTVSKSTNGVTVTYEWNAENRLADTDGDGTVVTNEYDADGIRVAQTVNGEKTRFLVDVNGQVLEEYTPGGIIKVSYDGLGSRALSDENGLLTNYIYDAFGQVLTK.. 5373
48 3.000e-36UniRef50_K9RAV3 RHS repeat-associated core domain protein n=1 Tax=Rivularia sp. PCC 7116 TaxID=373994 RepID=K9RAV3_9CYAN  ali  19 5076.........................................................VIYEIDGNSGDTKTVSDRNGNKLTFTDASGQQITFERNSQGQITAIDPSGQRIEYEYNTTGDLISVTDEGNVTRFEYDDQGRLTVKDQLGNETVFEYDNRGNVIQIDALGGLTERTYDENNNLTETDPLGNTTTFIYDNRGNLTETDALGSVTRFTYDSFGNLTATDSQGNTTSNTYDRNGNLTSI.. 5318
49 4.000e-36UniRef50_UPI000DE91A91 type IV secretion protein Rhs n=1 Tax=Geodermatophilus sp. TF02-6 TaxID=2250575 RepID=UPI000DE91A91  ali  15  877.VTNPQGLMWRYEYDAAGNLIDFNGRVLRYAYDAGGQLVEVRDPLGNVVFSYDPAGRVVRATNAD-ADVRFERDPLGRVLSET-CNGRSVESTYDVLGRRVRRTPSGAESLWEYDANDRPVALHTAGHRLDFSYDAAGRVIAQDADGYITRFDLDPVGRITAVTGAGWTERYAYDSAGNITSSDAQGGAVRYEHDSQGRVVIRSAKPRTWRYTWDGDDRLVAETPQGERWQYRYDSFGRRTAK.. 1229
50 4.000e-36UniRef50_A0A2L1UCJ5 Cell wall-associated polypeptide n=3 Tax=Paenibacillus larvae TaxID=1464 RepID=A0A2L1UCJ5_9BACL  ali  13 2431..TDEAGNVT-YTYDASGNVTDEKGNTLKRTYDALNRVETYTDQDGNQIYEYDQAGNLKALIYPDKKKVQYTYDANHRLKEVTDPAGRKTTYTYDKHGNLEQTRPDGSKETRTYDAAGQLLTRAADGSSITFTYDANGNVSTEDADGNQITFKYDARNRLIQA----GQTAYAYNSENNRISVTKGNSVTTYHYDRRGSTVALTASTGEVTYVYGPYGELLRKTGD................... 2764
51 4.000e-36UniRef50_UPI000989BA4A PASTA domain-containing protein n=2 Tax=Methylocaldum TaxID=73778 RepID=UPI000989BA4A  ali  13 1891.VTDTQGRVTRYSYDNVGNRTYPNGSKANYGYDALNRLTSHVTSDGSVLFEYDAVGNRTAATEEGGVRTDYSYDKLYRLTQEITESGKVVSYTYDGVGNRLSKTTDGEVINYVYDDNDRMISE----GVVTYSYDANGNLIERSNGGSASQFEFDYENRMVKATEPGNVTEYIYDDDGVRIGTVRNGVTSSYERDSANGLIVVYQRGTEIRYHYDGLGRLLTDFGAGITDRYAYDAFGNLL.... 2164
52 1.000e-35UniRef50_UPI00099C2316 type IV secretion protein Rhs n=12 Tax=Streptomyces TaxID=1883 RepID=UPI00099C2316  ali  13  506.......................................TVTDPESGHVRHFTADGLLTQLDDRNGAWIAFEYDDAGHLTRVTNSSGRPLRFGYDDLGRITSTDTNGRHFDYVYDERHRTTYTDSLGHETRYLVDDRAQVTETDPAGATTHYTHDAYDRLTRTDPLGHTTRYVYDEQGRLTSLRPDGREVRAEYDALGMLAVVRPDGRVTRMTYDAHGNRTSATAPGATHHFAYDTRGHLASVT. 778
53 1.000e-35UniRef50_A0A257VAE9 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A257VAE9_9BACT  ali  13 1092.MTYPGGNVVTYAYDAAGRLTDWRGNQTAFQYDGANRVAQATLPNGTVTYTYDAAGRTVARVHQTSGGTTCVYDTAGHVTSVTEPLDSTAAYAYDPINRVLTATVDGAATSYAFDLRGNLTSKVSGAATTTYAYDSLNRLATVSDGTNTTTYAYDGAGSRVAKTFNGSTTRYVR-EGGTIYCTDGAGGVQSYNIYGGSLLYTLDPSGAVTVYHGDERGSVVATDAAGGVVSYSYDAYGKVLS... 1350
54 2.000e-35UniRef50_A0A1I0M4V7 RHS repeat-associated core domain-containing protein n=1 Tax=Ruminococcaceae bacterium KH2T8 TaxID=1855400 RepID=A0A1I0M4V7_9FIRM  ali  14 2178.VTNASGEVISYTYDEAGQIASMDGQTISYGYDNMGRLVTVTDSEGTTSYTYDAVGNRASTEYPNGVTTTYGYNENNVLVSETDSAGTVASYEYTANNERITCTELNRTVEYEYDELERLVSETDTVSVTTYTYDANSNRVSMDKDGDVTTYEYNELNQLVRADNAGNVATYTYDSYNRMVSVNSSNGTLEYTYDYLGNRTSKTTDGVTTYYVTDLDGGMSVTDETGTLTTYVFDAFGNEVART. 2496
55 3.000e-35UniRef50_C7MZM5 Rhs family protein n=5 Tax=Pseudonocardiaceae TaxID=2070 RepID=C7MZM5_SACVD  ali  12  622.VTNEQGLVWRYDYDAAGNLTDFNGRVLTYQHDAAGQLIARTNGAGETTFARDVFGNVIER--RSGAVTTFTYDPLGRLVEAMDSDTQVT-FRRDPLGRVLAETVNGRTVASVYDALGRRIRRTPSGAETVWEYDANDQPVALHTGGHTLRFDYDRAGRQAVTGAAGQRISYTYDRIGRITAVTGTGWAERYAYDAAGNLTHASWPAGKVRYEHDAQGRIIVLTPNGARWRYRYDPLGRRVAK.. 962
56 3.000e-35UniRef50_D9WCY0 Paar n=32 Tax=Streptomycetaceae TaxID=2062 RepID=D9WCY0_9ACTN  ali  15  207VTDPEAGLIRTFTYDGTAALLDRNGNRITFTHDASGAPVEVTSENGRITGLYYTDGHLTETTGSSGLPLRFVYDRAGRITSWTDTNNRWFSYAYDAFDRVTATSPDGAVTRYLVDEAHQVVEIDAAGAISRTAYDQVGRTVETDPLGRTTGFRYDEHGHLTITGPGGAVWRQTFDAAGNRTSTDPLDATTRYLYDARGLLAVTDALGATTRVRCDGAGLPVITDPLGATTRYQRDTLGRAVAET. 532
57 6.000e-35UniRef50_UPI000A389197 PrsW family intramembrane metalloprotease n=1 Tax=Streptomyces castelarensis TaxID=260811 RepID=UPI000A389197  ali  14  681VTDPEAGLVRTFAYDEALALVDRNGNRVTFTYDASGTPLEILHSGGRVRGYGYTDGHLTETTGSSGLPLRFVYDRAGRITSWIDTNNRWYSYAYDEQDRVIATSPDGAVTRYLIDEAHQVVEIDAAGAVSRTMYDEAGRTVETDPLGRTTGFRYDEHGHLTITDPGGAVWRQTFDTAGNRTTTDPLAATTRYLYDERGLLAVTDPLGATTRVRCDGAGLPAITDPLGATTCYQRDAFGRVVAET. 1006
58 7.000e-35UniRef50_A0A0A1VXF5 Rhs family protein n=2 Tax=Microcystis aeruginosa TaxID=1126 RepID=A0A0A1VXF5_MICAE  ali  15 2865...DADNGVTDYNYDAVGNLIFPNGVIENQQYDLLNRLTYLENPNDTYTYTLDAMGNRVKVVENDGRTVEYTYDNLYRLTKITDAGNKTITYSFDAVGNLEKVDLVEGKTTYNYDKNDRLLKEILGGNVTQYQYDEKGNLLAKVENGATTTYEWNAKGELTTENGETGRIEFEYDHNGIRVAIDVDGEVTRFTYTHGWDLISQDDGANRIYYQVDGLGRLMTGNNGSVVVEYDYDAYGNLTRK.. 3148
59 7.000e-35UniRef50_A0A0C1UQL8 Uncharacterized protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1UQL8_9CYAN  ali  18 3009VTDDRG--TTTYQYDERNRRIDPDGTTIAYTYDAAGNRTSVQIPSGTTEYGFDAQNRLKTVTDSEAGITTYTYNPVGNLERTEFPNGTVEIREYDDLNRLVYIDDTGNRTAYEYDDLYRLTITDPGGRTIEYIYDAVGRLSRTDTGAGTTLYTYDDNDRLLTATTDGVATTYTYDNNGNTTSTDGDGEIVVNQYNENGIRVSQTVNGEETRFLIDANGNLISQNREGTTDQYIYDAFGQVIR... 3353
60 2.000e-34UniRef50_UPI0005633E9D hypothetical protein n=3 Tax=Streptomyces TaxID=1883 RepID=UPI0005633E9D  ali  12  21VTDPLTGHTRTFARDADGQISDRNGHTLTFTYDDDGAPTGITTDAGRITFGYDPGGNLTEDINSSGLPLVFTYDDRLRATSWTDRNGHRYDYTYDDRDRTAEIDALGHTTRTSYDEHHNLTATDPLGQRFAYTYDADGGLRVTAPDGATWVQSFDAAGRLSVADPSGATTRYHYDDRGRLAVTDALDHTVAIENNAAGLPVETDPLGGTTRYEYDAFGRRAVTDPLGHTTRATWNTEGLLTSYT. 375
61 3.000e-34UniRef50_A0A2G7F522 RHS repeat-associated protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A2G7F522_9ACTN  ali  12  219.VTNPQGLTWSYAYDPAGRLTDFDDRTVTYEHDAAGQLTTGTTASGQTIRERDVLGRVVSK-DPAGTVTTYAYDTTGGLACATSPDGATSTWTYDAAGNRTELTTRGHTLTFTHDAAGRELSRDPLGRLTRHSYRADGNLTAIDDLGGTRHFDLDAAGRVTAVHAANWTESYVYDTAGNQTRITRAG-TVRYEHDESGRITQKTRLSRTSRYTWDAEDRLTVVTPDGTTWRYRYDPLGRRIAK.. 558
62 3.000e-34UniRef50_UPI0006D56C22 hypothetical protein n=1 Tax=Numidum massiliense TaxID=1522315 RepID=UPI0006D56C22  ali  15  362.............................YTFDPAGQLTQVTDA----------AGRVTEVTTPCG-TLQFTYNASGLITRVSDDAGRQVSYTYRQHDLVAFTDVAGQTIRYDYDENHRMTKVIPNGGVTKLTYDEAKRTVVKDAHGHETTYVYDERFRLVKVNPLGEKERYTYNDYNDLVRTDRRGYTTTYDYDREGNCIARDALGHVTKMTYTSQNKLASLTADGATYTFSYDDSGNMIQE.. 603
63 4.000e-34UniRef50_A0A015VGB8 Uncharacterized protein n=2 Tax=Bacteroides fragilis TaxID=817 RepID=A0A015VGB8_BACFG  ali  89  1................................................MKKILFILFTVQFILIPRITGSYGANSIGNNHGHSVTNQGKKTIKKDIFGDTVIEDNHGNRKTIKKDIFGDTVIEDNRGNRKTIKKDIFGDTVIEDNRGNRKSIKKDIFGNTVIENNKGYKKTIKTDIFGNKIIEDNHGKKQIIKKDIFGNVIIEN......................................... 156
64 6.000e-34UniRef50_A0A212R2S4 RHS repeat-associated core domain-containing protein n=1 Tax=Thermoflexus hugenholtzii JAD2 TaxID=877466 RepID=A0A212R2S4_9CHLR :  ali  14 1501..TDPLGNTWRYGYDPAGNRIDPEGHVTTYTYDADNLLVRITDTLGVSRWVYDPLNRVVEVTDSLGRRLGYGYDANNRLRGVTDPEGRRTLFERDGEGNLRRQNPNGTVTEASYDRANRLRSRNPPVVTERYTYDPLRRLVVSDSEGFQAIYEYDAAGNRTRTTPDGFEVTSTYDAADQLLQALRVGQAFVYAYDANGNRVNLNPPGPNTQYVYDRENRLIAVQARGQVTRLYYDGLGRRLVKEY 1855
65 7.000e-34UniRef50_A0A2N2DJW4 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-14 TaxID=2013775 RepID=A0A2N2DJW4_9FIRM  ali  13  858MIQDPEGRQVDYDYDSWGRLIDPNGGATNYEY-------GYWDEYGNT----YQNLLVTKVTDPMGNVVSNEYDDQGRVIRQTDAGGYSVSMDY-GNGSTTYTDGNGNEFVYEFDSEYRVTSITGDGAVYEFT-DARGLITTASPNNVVTTYHYDERGNRRVTDAMGNVTLYGYDNRNNLTSINAEGKQTTYDYDDNNNVTGIDAAGNETQLEYDGSGNLLVTDAEGNTTTYTYDPAGKTVSYTY 1151
66 7.000e-34UniRef50_UPI0009DFA655 hypothetical protein n=1 Tax=Lechevalieria aerocolonigenes TaxID=68170 RepID=UPI0009DFA655  ali  13  151..........SWTFDTSGKLVAAEGERTSLGRDGEGRLTSVAHSGGRLTFTYDA-GRLTKVESGDGRAVKYDYSPEGRLAAATSPEGAVARYEYTPAGRLSAVDAEGRVVANVYDERDRVVSSTGNGARAVYQHSNAGRLVATDPAGKSVSQSFDDNGRLVEVVARGGTTSFSYDDRDRLTSTDAGQGTTRYEYDPNGATTRVDPAGGKTTFGYDAGRRLTVTDGLGQATKFGYDAAGRRTTTT. 457
67 8.000e-34UniRef50_A0A1D2RDB6 Uncharacterized protein n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_79 TaxID=1849365 RepID=A0A1D2RDB6_9EURY  ali  18  176........................................................RVTKMQDPNGNVLNFTYNSDMLLTTITDASGRSVQFQYDVNNNLISIDPLGNTMNYGYDSDHYLTITDALGNTRSFSYDGNGTTTMTDTLNQTTHFVYDSEGRITVEDPLGNYSTMVWDENNNLIATDEDSNTTAYTYDSMGNLTVTDAENHTTTYTYGGAFNMSITNANGDITTYDYDSHGNLVKATY 417
68 2.000e-33UniRef50_A0A1M7N2B1 RHS repeat-associated core domain-containing protein n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1M7N2B1_9ACTN  ali  14  560...................VTDRNGNSYAITHDADGVPAEILHSGGYHLTLSSDSGRITALDEPATLVRKYGYDAVGNLTGLTNSSGLPHQFSYDAASRITSTDRNDTTYAYTYDQRGRCVATTDGFLSSTFAYDDATRTTTTNSVGHRSTYTHNAAYRLISTDPLGHTTRREWDTANRRLVTDPLNHTIRYSYDSDGNLVSVRPDGAFATAEYNVFGLPLRIEPGGAIWTHTYDDFGALLSTT. 801
69 3.000e-33UniRef50_A0A1F2U1W4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F2U1W4_9BACT  ali  17  641.......................................................GGVLSIVDRNGNQTTIARDSAGNTTKITSPGGRWVEFTYDASNRITQKDTIGRVVTYEYDATGRLIVTDPNGGITEYTYDASSRLTLKDARGIVYTNEYDATGKVTVTDPRGKVSRRTLNLAGQLLSVDPLGRTTSYTYDSLGNTTSVTRLSGTTSFTYEPFNQLASTDPLSHTTTYNYDPKGNLTSI.. 891
70 4.000e-33UniRef50_A0A0M8TTL5 Type IV secretion protein Rhs (Fragment) n=3 Tax=Streptomyces TaxID=1883 RepID=A0A0M8TTL5_9ACTN  ali  11  113.VTNPQGLTWTYDYDEAGRLTDFDDRALTYTYDAADRLASRANVLGVVTFERDELGRVVRK-DAAGQVTTYAYDMTDQLAQSTGPDGTTLSLLRDRYGRVRSETVDGRELTYTYDEAGRRTGMVASGRPIDFTYDVAGRETVTDELGRLTTYTYRADGNLTGIDDLSGTRRFDLDATGRVTAVHAANWTETYAYDSAGNQTSADALGRITRYEWDAEDRLSVTTPDGTRWRYTYDPLSRRTAK.. 453
71 4.000e-33UniRef50_A0A1V5BM19 tRNA nuclease WapA n=1 Tax=Pelotomaculum sp. PtaU1.Bin035 TaxID=1811695 RepID=A0A1V5BM19_9FIRM  ali  12  133.VTDALGHTTSYTYDNNSNMTTAKNQTFTAAYDALNRLVRETDPLGNTSRTYDPAGNLSSMTKPDGSEINYTYNTNNRLTNITYPNNTGISYTYDANGNTTMVDPAG-TTGYSYDSLNRLTSVARDVYSVDYEYDQAGNITATYPGGLRVSYTYNSLNLPVSVSDSVYSASISYDEAGNRLQE.............................................................. 319
72 7.000e-33UniRef50_D9SWJ8 Uncharacterized protein n=1 Tax=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) TaxID=573061 RepID=D9SWJ8_CLO  ali  13 2087..TKPDGTKTNYDYDKLNRLVDSKGATVSYEYDISGNRTKLKGPEGDTNYSYDKMGRLTSVSFSTGEKVKYSFDSLGRKSKITYPDGKFVRYNYDELDRLIFVEPNGTKVIYSYDEADRITKLENHGKVISYQYDKARNIVKEDGSNEIISYSYDKAGNRIVKDNHGTETTYNYNAADELISEKTEGTNIKYQYDKNGNRIKKIYPGQKTEYQYDLEDRLIQTNPNGEVLTFGYDSDGNRLFSTY 2406
73 7.000e-33UniRef50_A0A1S6F395 Uncharacterized protein n=5 Tax=Janthinobacterium TaxID=29580 RepID=A0A1S6F395_9BURK  ali  17  885...DAGGLQTRYRYNGQGERTDAIGQTVQYRYDAALQLTELINAKGESYRAYHAEGWLASETGFDGKHTQYSYDQAGNLTATRDALGGVVRYAYDALGRLTAVDALGQLTTHAYDKLGNRIQTVPNGRRITRQYDPQSRLTQTLARGRERRFEYDAQGNLTTIFQAGATTSYTYDPVGQLLAAVQPGLAERFAFDPAGNLVDKAPAGNVTEYAYDEQGNATGKRPPGRESTWSYDAENRL..... 1258
74 8.000e-33UniRef50_UPI000D6E72CA hypothetical protein n=1 Tax=Leucothrix sp. IMCC9719 TaxID=1481894 RepID=UPI000D6E72CA  ali  17  8..................................................TYDARRNQLSETDAVGNVTSYTYNNHSKPLTITNPDGSVISSEYDAQDKLTSTNALGETTTLSYDAVGQLTSTDANGVKTTYSYDAMGRKISTDASGVTTRYEYDAKGRVIKTDPLGRVTQTEYTVFGKASMIDAAGRRTEYRYNARGLMSQTYPDGTTSQMDYDPEGNKVSTDRAGRITLMEYDAANCLIKTTY 243
75 9.000e-33UniRef50_A0A222ST26 Type IV secretion protein Rhs n=1 Tax=Streptomyces sp. 11-1-2 TaxID=1851167 RepID=A0A222ST26_9ACTN  ali  10  962.....NGHTTTYAYDAVGNRTTSAGIRSAWTYDAASRPVSLTTADNSLRFGYDAAGRETSRTFGADVTLTQAWDDLNRMTGQTNALIQHRAYGYRPDDHLTEIRELSGTRRFDLDPVGRVTAVHAHGWTETYAYDAAGNLTTAEADSNRTTYEHDAQGTRRLLNGQRHTWTYTWNAEDRLTAITPDGARWRYAYDPLGRRTAKDTVAERIDFTWDGTRLAEQTTADGHTTTWDY........... 1232
76 1.000e-32UniRef50_UPI00098BAB5E hypothetical protein n=1 Tax=Methylocaldum sp. 14B TaxID=1912213 RepID=UPI00098BAB5E  ali  16 1155..TDANGKVTQYTYDAVGNLTDPLGG-TAFTYDELNRLVQQTDPYAQTVYEYDAAGNRVAVVYPDGKRVTYVYDALNRMQSVTDWLGGVTTYVYDAAGRLTAVNPNSTEATYAYDAADRLTTLDPVGNRLSYSYDDANRLTRHDENGNLATFEFDIENRLIRVNDVAAAT-YRYDGLGHRLRVAPNGEARYYHYDPIGSTVALTDLNGTDTYTYDPFGQV......................... 1488
77 2.000e-32UniRef50_A0A1W9LS56 Uncharacterized protein (Fragment) n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9LS56_9DELT  ali  16  406.............................YKFNADGQLVERGNQQGQSLYAYDSAGRLSKITEPSGVFLSYAYNAEGLLESVTDPMNRKVKLGYDANQNLTITDVAGNVTTYTYNAIGQLTGVSAEGKQLKNTYDDEGRVATQDDDSNQLNYTYDEDGKITATNRNGDKRIYVYDAASYQTLKDELGKTVAYEYDEYGNRISTDANGNTTSFAYDAMGHVTAVT----------DAAGNVTRMTY 628
78 2.000e-32UniRef50_A0A2G6G4R9 Uncharacterized protein n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2G6G4R9_9FIRM  ali  15 2293...................KIYRDGKIVSYAFDTSLQITEQTTAR-SLTLNYDENGYIKTVVDQSGRSIALLYDDRHNLIKIVKPDGAVLSYAYDEQNRLTVTDYLGNQKTYTFDTANILSVQDSAGYINRYTYDERGRTSRTNALGNVIYYQYDANGNLISIDGNGNVTKSQYDTNNYLANIDIAGANVTTHYDHLGQLQSVTADGREITFTYDDMGMLTSTDENGATTRFEYDIMSRVITIT. 2611
79 4.000e-32UniRef50_A0A1G1MWU3 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium GWF2_43_52 TaxID=1801847 RepID=A0A1G1MWU3_9BACT  ali  12  954.LTDPQSKVTTYTYDAIGNLIYPNGTQALYTFDKLNRLIMLVNKNGSTTYTYNVSGMRTRVTFANGEYTGYTYDKLNRLLKENNPSKKSIVYTYDPLGNIAITDPLNSSLTYNYNSNNQLISLNAAGRTVNYTYDANGNSIQQNDSQAITNYAYDFENRLTSVLGPTVNASYVYDGEGSRISQTEGGLTTKFFYDGIGGMIASYNAGNTTQYLYDGLGSVTAMDAAGQVQAYSYDAFGNIIS... 1258
80 5.000e-32UniRef50_A0A1V4BW36 Uncharacterized protein n=2 Tax=Microcystis aeruginosa TaxID=1126 RepID=A0A1V4BW36_MICAE  ali  12 3580.VTDFSNGVTNYTYDLAGNLTLPNGTIETREYDLLNRLLYLQNSNNSFRYTLDKVGNRLAVVEQDGRKVNYEYDDIYRLLEVIDGTTRTISYTYDAVNRLTRNDSGEGNTTYEYDQNDRLLKEVTNGVTTTYTYDNNGNTLSKTTGTDKVNYQWNAENRLIGLDNNGNDVTNKYDSDGIRISQTVNGDETRF..................................................... 3784
81 5.000e-32UniRef50_A0A1H5BTA4 RHS repeat-associated core domain-containing protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A1H5BTA4_9ACTN  ali  11  969.....NGRTSTYTYDAMGRRTSPAGVRSDWSYDPAGRPTGLSRGDGALAFAYDAAGRETERRIGDATTLTHAWDKGNRLIAQTDRLLQQRTYAYRPDGYLTEIRELTGTRRFSLDPIGRVTDVQAHGWSERYSYDRTGNQTHADARAGRTTYEHDAAGRLIRRTRNGRTWTYTWNGENRLTRTTPSGEEWTYAYDPLGRRVSKTPDGAVLAFTWDGTALAEQSAPDDTTTTWDY........... 1234
82 5.000e-32UniRef50_K9Y1Y6 RHS repeat-associated core domain protein n=1 Tax=Stanieria cyanosphaera (strain ATCC 29371 / PCC 7437) TaxID=111780 RepID=K9Y1Y6_STA  ali  13  298.VTNAEGNTVTTEYDSVGNVTDELDRTTNFTYDERNLQTSISDPLGHTTTEYDGVGNAIALLDPLGNKTNYAYDPLYRLTSQTDAQNRTTNYSYDPLGNLLSTDPEENTTNYTYDENGN---RTNPGYVTNYEYDGEGNVVTKDGSGNVIKYTYDVFDRRISVDVDGNVERFVYDGDGNQKVVDGDGTVVNHTYDSFGKVTSETDSNVDFRFGY............................... 604
83 5.000e-32UniRef50_A0A2M7S4R8 Uncharacterized protein n=1 Tax=Candidatus Desantisbacteria bacterium CG_4_10_14_0_8_um_filter_48_22 TaxID=1974543 RepID=A0A2M7S4  ali  15  493..TQRGNDGTQYYYTVQGRLSDRNNNQVLFGYNANDLLTSITDSAGRLITLDYSDGKLYSLTDFAGRVTYYQYDDKGDL-SYVFGSEYTAQYSYDKQHNLTVKNPKGYTNSFVYDSFGRVVETDANDKQTIHSYDAYNNTRTTDANAHPTDYTYDPKGNLSIKDAYNNLTSFEYDGNGNLLRTDLLGNATSYTYDGYGQRLSTDPRGKTTTFSYDQYGNLSVTDPLGNATQYAYDTLGRCTSKT. 814
84 6.000e-32UniRef50_A0A2N6HVK3 Uncharacterized protein n=1 Tax=Nitrospira sp. CG24A TaxID=1985133 RepID=A0A2N6HVK3_9BACT  ali  17  2...............................................TTFSYNGS-RLATMTDPAGRVTQLTHDSAGNLITVDAADQTQQRFAYDAQHRLTRTDARNQVYAYQCDHAGRLTYKDAKGQTTTFETDAIGRLTITRPNGAVTTMTYDAKGNLLITDPKGNQTNITYDVKGNLTITDADNKVTQFFYNTQGLLTETYPANPATTFTYDALGRLTTTDPLNRTTTLTYDNAGNVTTST. 295
85 6.000e-32UniRef50_A0A257SUW8 Uncharacterized protein (Fragment) n=1 Tax=Deltaproteobacteria bacterium 21-66-5 TaxID=1970506 RepID=A0A257SUW8_9DELT  ali  13  783.MTYPGGNVVTYAYDAAGRLTDWRGNQTAFQYDGANRVAQATLPNGTVTYTYDAAGRTVARVHQTSGGTTCVYDTAGHVTSVTEPLDSTAAYAYDPINRVLTATVDGAATSYAFDLRGNLTSKVSGAATTTYAYDSLNRLATVSDGTNTTTYAYDGAGSRVAKTFNGSTTRYVR-EGGTIYCTDGAGGVQSYNIYGGSLLYTLDPSGAVTVYHGDERGSVVATDAAGGVVSYSYDAYGKVLS... 1041
86 9.000e-32UniRef50_M9LCU5 Rhs family protein (Fragment) n=1 Tax=Paenibacillus popilliae ATCC 14706 TaxID=1212764 RepID=M9LCU5_PAEPP  ali  12 2328VSDAEGQLIYTYEYDANGNVTDTRGHTIGYTYDAAGNITKLTYPDGKVSYTYNANGELLTVTDWAGRRTRYTYDANHRLVTTTRADGSVETRTYDAAGQLTVRDADGTVWVFTYDMVGNVTQEGAN----RYQYDANHRL--MEAAGR--QYGYDAAGNLLTVTGDGQPITMTYGSNNQLL--TFNGQTIM--YDADGNMVLGPLNGQFSTYRYDANNRLIQA----GDVYYTYDA......... 2603
87 2.000e-31UniRef50_A0A2H3KIU8 Uncharacterized protein n=1 Tax=Candidatus Chloroploca asiatica TaxID=1506545 RepID=A0A2H3KIU8_9CHLR  ali  12 2110...DALRNRTTYGYDQLQRVDYHDGTFVAYAYDENNNVLTVGNELGTTTRSYDALNRLIEEQDVHERRTAFGYDPVGNRLSLTYPDGRIVTSSYLKNNWLASTDPEGRSTRYIRDGVGQVVRENPNSTVTTQVYDKANRLLSVENQGANTVYRYDVVGQRVSRNPSVVTSNYSYDPLRRLVREDSQGIWTAYTFDAVGRLTLTTNDSSTTNRPFDS-----------KTLHYSYNAINQLLSV.. 2360
88 2.000e-31UniRef50_UPI000380FA7E hypothetical protein n=2 Tax=Paenibacillus massiliensis TaxID=225917 RepID=UPI000380FA7E  ali  15 1683...............................................TTLRFAADGLPMSIEDRGGMKLQLDYSAARQLIAVTEPTGQGLTFAYNSAGDVTVADTAGREVGFAYDRSGRLSITDAAGRETTYTYNADHRVTQSDAEGATTTFAYDRNGRLQVLDALGRTTSYAYDDRGNRTVTNTRGQTVIYTYDAKDNLKSVDHTGQTITLSYDERDNLTVTGPDGKQVKYTYDGQDRLLSV.. 1930
89 3.000e-31UniRef50_A0A147DNP5 Uncharacterized protein n=2 Tax=Curtobacterium TaxID=2034 RepID=A0A147DNP5_9MICO  ali  15  259............EYDRRGLLVRTDGRETRWTYDADGLRTSVHAPDGSVTRERDPAGRTGTVEHTAFGAVHHEYDGAGRLTAVTDADSSTTRLTRDRDGRLVRIERPGTTTVYEHDAAMQLVRADTDGVETTWSYDAAGRLVVERIGGSTRTYEYDDAGQLVAVTGPEGRTSHEYDARGQRVSTAPDGTATRYSWDGRGWLRLIASGSSSTSTHVDALGDLVDVD..................... 496
90 4.000e-31UniRef50_A0A1I3PY03 RHS repeat-associated core domain-containing protein n=1 Tax=Jannaschia pohangensis TaxID=390807 RepID=A0A1I3PY03_9RHOB  ali  13 2462VLTRENGQVETATYDGLSRRTTPD-NTLTYGYDPVGNLIAAADGDSRLTMAYDVRDRLVAMTT-DGTTLTYTYDALSRRTSMSDSLGGTTTYAYDPESRLTLTAPWGTAFSFGYDGEGRRTSTSTSGRVSTMGY-TNGLLSSLTADGKLTTLSYDSLDRLVQVDADGSVEDYAYDEEGNLTVSKADGVVESYGYDSQNRLVSYTDGVTTATYAYDALDRRIAKTVDGSVEAYVLDA......... 2781
91 4.000e-31UniRef50_A0A1I3KKT3 RHS repeat-associated core domain-containing protein n=9 Tax=Amycolatopsis TaxID=1813 RepID=A0A1I3KKT3_9PSEU  ali  13  861.MTNEQGFVWRYHYDPAGNLTDFNGRTLRYRYDAAGRLVESTNGAGETTVERDAMGRVVRRVTGN-DVTTFTYDVAGKMVAARNAD-AEVTFTHDAVGRVVAETINGRPVRSAYDALGRRIARTPSGAESRFEYDPAGRERVRRFAGTELRQAWSPAGELTQTVVAGSRTEYAYDRTGRVRAVTGPGGRLRFAYDPEGRATRRGPDGPHWQFGWNADSRLTVVTPNGERWRYRYDALGRRVAK.. 1191
92 5.000e-31UniRef50_A0A2U3LJD8 Uncharacterized protein n=1 Tax=Candidatus Sulfopaludibacter sp. SbA4 TaxID=2043165 RepID=A0A2U3LJD8_9BACT  ali  17  1....................................................................................................................MGQLTSKDPLGRTTHYSYDTQGNLTVIDPLGNKTTYAYDAVGRRTSTDANGSATATAYDANDNVSVTDPLGNRTLYSYDANNNRTTTDPRDKSTSYTYDGNNKLTVTDQRGNTTRYSYDSENRLTGVT. 155
93 7.000e-31UniRef50_A0A1T4KJW6 RHS repeat-associated core domain-containing protein n=2 Tax=Eubacterium ruminantium TaxID=42322 RepID=A0A1T4KJW6_9FIRM  ali  13 2231....PNNYTSRYTYDKFGEKTYDNGQKVSYGYDKFGRIVSVNTKKLTTKYEYDAMDRLVRVISHDGKATVYTYDENGNRSTAKYANGITITYTYDECNRLKVTDKNQKLISYRYTEKGERTKVDSDGKETVYKYDECSRLVKKSGEEDVTQYTYDSVGSRISKTVNGLKTEYSYNELNQLISKTSNTNDTVYRYDKNGNLIETVSKDKKCTYTYDLFNRMTGYTDGVVNYTYTYDAEGRRTKTCY 2528
94 7.000e-31UniRef50_A0A2V6WEY1 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6WEY1_9BACT  ali  17  628.....................................................GLNLLIEQRDRHGNTLTITRDVNGRLTQVRDALGRTVQYAYDPTSRRSVIDAAGGETRYTYDGDGRILSIRDQNGVTRNDYDAQGRVSVTDPRGHTTIYRMDALGQSTRTDALGRAAHIEYDAALRPTITDPLGNVTHFEYDAVGNLTRINPDGDRLDFRYDAGGAPTVTDALGHTSTYAYDAAGNVTSI.. 921
95 8.000e-31UniRef50_A0A1I5G9C6 RHS repeat-associated core domain-containing protein n=1 Tax=Pseudobutyrivibrio sp. JW11 TaxID=1855302 RepID=A0A1I5G9C6_9FIRM  ali  17 1911.MTD-GEGVTNYSYDLAGRITNAKGNITAYKYDSWGNLESLEYPD-HTVYKYDSLDRITSMTERSGVKVDYTYDANSNLLTESRSDGIVKTNKYDELDRVTATDDTLSAFKYGYDEAGRMTTEDSLGTVTKYTYNDAGKLIATTPL-KSIEYSYDLYGNRTEENGVKSTVKYKYDLSDRLQSKTTDGKQTSYEYDADGNLVSKTEDGVKTDYTYTVDNRIASVTVDGVKDAIKYDGNG....... 2172
96 8.000e-31UniRef50_A0A2V7U818 Uncharacterized protein n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7U818_9BACT  ali  13  821..............DRLGNRLTITRGPTTR------RIQRIVSPNGRVEFTHDPADRVTQIKDNSGRTVSYEYDTESRLSRVTNPAGGMTDYTYDGNGKVIQTDPRGYVRRVTFNAAGYLTDTHAYGQTTTYVRDSANRVTSTDALGRTTTYGYDVNSLLTVTDAPNHTTTYGYDAVGNLTSTNPLGKQITFTYNTSGQPITVTTPAGTMTFTYDALGRLVVTDPLGRKTRYTYDPLNQISQIT. 1156
97 9.000e-31UniRef50_UPI00034C9EA2 hypothetical protein n=2 Tax=Synechococcus sp. PCC 7336 TaxID=195250 RepID=UPI00034C9EA2  ali  13  353..........TYRYDAAGRLTRSDNTGTAYTYDAVGNRLSVTDSTGVERFTYDSLDRVIDIT-QTGARVSYTYDAASQLIGVEDLAGTQTTHSFDAAGRLTHTDAGGTVYTYSFDAANRITAIQSLDGLSSFSYDASGQQLSFDATGNRTTYAYDAEGNRTQRTATGEVTQYEYDHRNRLTSADSSGNETEYTYDALDRRIGRTVEGQTERYLYDGSDIALVTYESGEVTQ.............. 641
98 1.000e-30UniRef50_A0A1I4XI44 RHS repeat-associated core domain-containing protein n=2 Tax=Saccharopolyspora antimicrobica TaxID=455193 RepID=A0A1I4XI44_9PSEU  ali  18  494....................................................DEILRLTGITDRHRNLVHFEYDEAGRLTSVINASGQALKFDYDAAGRITWTDRNGIWYRYTFDGAGRCVRTEGAGDVTHYT-DSLGHTRTVDPLGNETVFEWDAHDRLSRTDPLGRTVKYDYDEAGEVTITRPDGSRQLIEYDDR-RLTVVDPDGAVSRREYDENGNLTVTDPAGAVTVYAYDERGVLVSIT. 758
99 2.000e-30UniRef50_F2JRQ0 RHS repeat-associated core domain protein n=1 Tax=Cellulosilyticum lentocellum (strain ATCC 49066 / DSM 5427 / NCIMB 11756 / RHM5) Ta  ali  14 1614...........HTYNKQGRLVNKIGQVLSLDYNEDGQVCLITDSIGESIILDYSNKKLTTVSDTKGRHVSLRYNNEGLLEAITNAIGNTTTFTYNNKGLISQTYPEGYTEKYAYEKEGDLTTTDDVGNTSYRTVDQDGQLVEVDALGNTYYFTYNENHRKIATDGNGHTSRFEYNDYGDTTVIDALGNTTIYTYDDRRNLTTTDAKGNVTANTYRADNQLTTTLPTGAITSYVYDGNGFLTKEDY 1889
100 2.000e-30UniRef50_A0A0X3V8T9 Uncharacterized protein n=2 Tax=Actinoplanes awajinensis TaxID=135946 RepID=A0A0X3V8T9_9ACTN  ali  15  135....LSGDIWAFGADGRGTSRSSQGVRITFGYDAQGRLLTATQSSGSVVYAYD-NGFLTSVTGPTGVIANYTYDSAGRVTRQEYGSGGDATFVYDDAGTTVVTATDGAKATYHHDTTGHLTSIDPGGGSITQTFDASGRITTVTAGGLDIALAYDARGNVLSRSIADSVTRYEYDTLDRVTATDAAGAVTRYAYDAGRHLIETDPAGGITRYGYDQVGRPTVTTPLGLTTRYAYDGSGRVTAAT. 463
101 3.000e-30UniRef50_A0A1V3IGH6 Type IV secretion protein Rhs (Fragment) n=2 Tax=Rodentibacter TaxID=1960084 RepID=A0A1V3IGH6_9PAST  ali  16  967......................................................................YRYNAEGDLIEVKDAAGLVSTYEYDPSGKVIVTDVLGRTEEYHFDEHRELIKVAANGQATLQERDKLGRLSQTDPSGQTRYFEYNPQGQMTKTRPDNVMLYFMYDNDGRLTQTDALGNMTRYRYDERGNLIERDALNQKTQYAYNDKGLLTSTDPLGNDTLFAYDDNSQLSQVT. 1190
102 3.000e-30UniRef50_D7BUW6 RHS/YD repeat-containing protein n=5 Tax=Streptomyces TaxID=1883 RepID=D7BUW6_STRBB  ali  12  885.VTNPQGMTWGYTYDTVGRLTDFDGRTLSYEYDATGRLISRTNPLGQTTFSYDPAGRLTEAVGPDGRVLTHAYDALGRPVRRTTPSGAKSTFSYDAAGRRTTLATCGQTLDFTYDAAGRETARDPAGQHRAYTYDDAGRVTAVRAQGWTETYAYDEAGNQTHATWPDGRVRYEHDAAGRLTLTTPDGTLWRYLYDPLGRRTAK.......................................... 1224
103 3.000e-30UniRef50_A0A117MM80 Uncharacterized protein n=1 Tax=Actinoplanes awajinensis subsp. mycoplanecinus TaxID=135947 RepID=A0A117MM80_9ACTN  ali  17  7................................................VYVHDDRGRLLSVTDAHGQTLRRTYDEWGHPVAVTDRNGTVVTMSWDDRGHLLRRDG----FSYRYDDAGRVVEVAFGDAAVRYRYDGANRTPIVDGEGGVTRLE--VRGDLVIVDPDGVTVDFGFDDAGRLVTTDADGNTARLERDGLGRVTAITPLGRRTTFEYGPGGHLVATDPDGARWQCEYSRAGRATAR.. 202
104 3.000e-30UniRef50_E5CCS1 Uncharacterized protein n=11 Tax=Bacteroides TaxID=816 RepID=E5CCS1_9BACE  ali  45  32.......................................YEYSGVDQGRETVEKDILGNIIIRDDNGNRKTIEKDILGNIIIRDDKGNRKTIEKDILGNIIIRDDRGNRTTIEEDILGNFIVRDDKGNRKTIEEDILGNTIIRDDKGNRKTIEKDILGNTIIRDDKGNRKTITKDIFGNTIIEDDKGNRTTIKKDIFGNEIIEYGNGHGKIIKKDIFGNTVIEEY.................... 217
105 4.000e-30UniRef50_A0A0F7VXS6 Wall-associated protein n=49 Tax=Streptomyces TaxID=1883 RepID=A0A0F7VXS6_9ACTN  ali  12 1098..DDAGRLTARFVYDAVGNLTKTRGFA--YTYDAAGQMLTRKYSDGNTTYTYDADGRTATMA-ADGKTTTYGWDPAGNLVTSALPNTETETRTYDRAGRITAVTATKAGTTVTRTALSRVDVTRAGVGTGGYGYDAAGRLAVTGPAGRTTSYTYDKVGNRLTSTLGATSTTYAYDAADQLTSATTGTTTTAYDHDAEGNRTKAGGD----TYGYDLAGQISAATVGGTAYTYDHDASGNQVAT.. 1359
106 5.000e-30UniRef50_A0A1Q4XAL7 Uncharacterized protein n=2 Tax=Streptomyces sp. CB03911 TaxID=1804758 RepID=A0A1Q4XAL7_9ACTN  ali  16  541................................DTEGR-YRATDPLSGLTRTYDDAGAPVSIAGPDGGDTRYGY-TDGHLTQVTNSSGLPQRFDYDAAGRMTATDRNGSRYAYAYDHLDRCVDQGGAEGHLRYHYDYDQRTAATDSLGHTWRYLIDGGSRIVETDPLGATTQYTYDRHGRLSVTDPLGATVTLTYDEAGNLAVMEPDGTTWRQSYDAAGNRTTTDPTGATTRFGFDASGNASQIT. 838
107 5.000e-30UniRef50_A0A2M7KY95 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KY95_9BACT  ali  17  367.....................................................GDGRLLSVSDRNGNATTLTYDGNGRLTTITSPDGGVESLSYNESGDLTYTDGTGHTYSFIADNDGRVTTTGPAGNTLTISYDGYD-ITVTDANGNVWTYHFDGRGRISVTDPLGYVYGYSHDGDHHLTQTAPVGAATGYQYDASGNATSIAQGALTTTLTYDALNQVVSTDPGGASTWYMYDGKGNVLTVT. 612
108 6.000e-30UniRef50_A0A011MVG7 Cell wall-associated polypeptide CWBP200 n=1 Tax=Candidatus Accumulibacter sp. SK-12 TaxID=1454001 RepID=A0A011MVG7_9PROT  ali  11 3591.VTDAEGRVTTYSYDAVGNLLYPNGVQTTYTYNPLNRLTNVTGARGGTTYTYTPSGNRTAVTEASGRRVDYTYDDLYRLRSETDPAGGAIAYTYDRVGNRVSTVAGIADQSFNYDFNDRL---DGEG------YDNNGNTLT---SGGRT-FGYDFENHLTSAD---GGVSFVYNGDGIRVAKTVGGVTTGFLVDERNKLISQKQASGVSFYGFDGHGSVRYTDASGSVTKYSYEAFGNSVGQT. 3859
109 7.000e-30UniRef50_UPI00068FCBF4 RHS repeat protein n=1 Tax=Streptomyces mirabilis TaxID=68239 RepID=UPI00068FCBF4  ali  15  391...................ITDAAGRVVTVRLQSDGLVKSVALPDGRTVGYAYAGGRLGSVTDATGAVWRYTYDADGLLAKVYDPKGRVQTNAY-GGGRVVRTDITGAVTSFSWDPRGNILIVDAKGSQYVQAYDRSGNVTSATPFNATATNTYDAHNNLTSTDALGNKAVFGYTAFDELTVTDPGENRTVFTVDDRGLVTAKDPRGKVTKMAYDAAGNLVRTTPLDEKSTYGYDRTGRLTSST. 665
110 7.000e-30UniRef50_I4IJT9 Uncharacterized protein n=1 Tax=Microcystis sp. T1-4 TaxID=1160279 RepID=I4IJT9_9CHRO  ali  15 1565...DADNGVTDYDYDTVGNLIFPNGVIENQQYDLLNRLTYLENRNSTYTYTLDAMGNRVKVVENDGRTVEYTYDNLYRLTKITDAGNKTITYSFDAVGNLEKVDSVAGKTTYNYDKNDRLLKEILGGNITQYQYDDKGNLLAKVEDGATTTYEWNAKGELTTENGETGRIEFEYDHNGIRVAIDVDGEVTRFLIDNNAQVIEEYQTNGTVNTTYDGANRRLMTGNNGSVIEYDYDAYGNLTRK.. 1848
111 9.000e-30UniRef50_C8W2H9 YD repeat protein n=1 Tax=Desulfotomaculum acetoxidans (strain ATCC 49208 / DSM 771 / VKM B-1644) TaxID=485916 RepID=C8W2H9_DESAS  ali  13  714.......YTATFTYDELGNIIGPNGITVSYQYDDNGRLTSLQHVNGDTVYTLDNVGNRLSVTDENGQTTSYTYDNLNQLTKVKYLDDNPVTYTYDPVGNRLS---AGGV-NYTYDSVNRLIQK----GGIPYGYNANGNLVSV---GESVYYDYDYEDRLVRFNDGNNTYRYTYDGDGNRLTQTVSGVVYSYIYDNAGLLVEKDSEGNTNNYLYDGLGSVSVVDVYGEELRYTYDPFGNPLTV.. 973
112 1.000e-29UniRef50_UPI000B43EC44 Rhs family protein n=1 Tax=Bacillus solisilvae TaxID=1516104 RepID=UPI000B43EC44  ali  14  787.............................YTYDSNNKITWKIEDREQKVYEFDSYGILVSVTDKRGYKTKINYDENYTLKDIISPSGRVFKFTTDEQGRVSSILPNGGTLQYNFDADGNLTFIDTLGKTVRYVYDDNGNMTEYDQNNRVVKNTYDADGRVTQINPNNEVVKLAY-STGKTVTTDAEGNVNKYQYDETYRTTKEQPDGQIIIKEYNDKNQETTIDELGNKTEYTYDENGNILTET. 1013
113 2.000e-29UniRef50_R9IFM0 YD repeat (Two copies) n=1 Tax=Lachnospiraceae bacterium A4 TaxID=397291 RepID=R9IFM0_9FIRM  ali  13  251......................AAGKDMEYTFDKQGRLLTRKDRNGNTRFVYNSSGQLCEARGANGGILYYRYNKEGNLQQYINPSGQTYTYQYNENLRLSVTTPRGIEVRNVYDGANRVVSQTPDGGTAEFLYDDEGKRTARDQNGYITSYESDDKFRNIRTLYKDGEERYAYNDNDQRTYVDKNGNKTQYSYDEQGNLIKIDALGIVKNFTYNTEGKLLTASIEGQLLENIYDKDGHLIKTT. 500
114 3.000e-29UniRef50_A0A1Z4S1D0 YD repeat protein n=1 Tax=Nostoc sp. NIES-4103 TaxID=2005458 RepID=A0A1Z4S1D0_9NOSO  ali  12 6344.VTDTAGSVTQYTYNKIGQVTYGNGVIENRSYDTQGRLQFITSLLSSYTYTRDQVGNILKLEENTGRIVEYTYDNAYRLTQEKYTDDSTVRYTYDAVGNRIQRDSLEGVTTYTYDASDRLKTSVLNGVTTTYIYDANGALTEIDAT-HYTTYEWDRNNYLIGVQAVSHTIQYRYDDDGNRVAQVVDGVETRFEYDSNGNLISASRNGQISYYHGDNLGRLLTNDSGVATDSYEYDAYGRILS... 6629
115 3.000e-29UniRef50_V4L286 Uncharacterized protein n=1 Tax=uncultured Thiohalocapsa sp. PB-PSB1 TaxID=1385625 RepID=V4L286_9GAMM  ali  12  742...........YSYDAADRMTRPGRFAFSYTYDDNDRLISGTAPSGTLSLEYDADDRLTRKVMPNGVSVNYGYDSVDRTTSVTAPDGTTVAYEYTDTSLTSATESDGTRTEYAYDGFYRLVVKESDGGTTTYTYDGNGNRLTKTVDGVTTEYAYNEVDELLSE----GNETFTYDENGNLIAAETASATVIYTYDDLDRLTSVSGGDAAATFSYDAEGRRVGRVVAGEEQRF............. 975
116 5.000e-29UniRef50_UPI000D6C8668 hypothetical protein n=1 Tax=Gammaproteobacteria bacterium ESL0073 TaxID=2070539 RepID=UPI000D6C8668  ali  12 2227.ITAMDGSVTRFEYDKVGNRTRSNGTQSVMTYNKANQLTSITHQKGSTVYTLDQNGRRTQVIDGVQRNVSYQYDATGKLLTEILQAGQRSSYTYDAMGNRLTKVANGITTNYSYNSNDQLISETTVGITTTYAWDSNGNLIKKTSPEGEISYSWSSSNKLLSIDDNQRQVSYQYDGQDNRIGKTVNGQAIETQYDGLGDLLTQDQTGQVNHLYQDAQGSRLVTDKQGSTSTFDYDAFGN...... 2516
117 6.000e-29UniRef50_A0A2V9LUA7 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9LUA7_9BACT  ali  15  353...............................................TQRLFNAQDLLSSIVDRNANQAVLTYDGSNRLTQVTDAAGRTLTFTYGNSNLTSAQDSVGAVATYGYDGNGNLTRVYPDASAVNFSYDATSNLSVTDALGKVESHTYDGQNRLTSTDSMGNATTYTYDSLGNTSSTDALGRTTNFTYDSNGNLTATDPLGNTTTNTYDASGNLLSTTTAGSTTSFAYDAKGELTQVT. 643
118 6.000e-29UniRef50_A0A1G2PEQ2 Uncharacterized protein n=1 Tax=Candidatus Terrybacteria bacterium RIFCSPHIGHO2_01_FULL_43_35 TaxID=1802361 RepID=A0A1G2PEQ2_9BAC  ali  12  972...DANNRLTTYTYDANGNVTSAANVAYSYTYDALDRLTYIYDLNGNKTYAYDVLNRLTSITDKASRVYSFTYDSASRRTNLSYPNNTAISYAYDAADRLTNTDSQSNVSIYTYDQIGNRLSNSNEKKLSAYAYDALSRVTSEHPNFQTTQYSYDAVGNRLTGPVLGN---YTYNAA-NEALTAP---SMLLTYDANGNISTKIASPLAWAYTYDPENRLTKTDPIDNRTEYKYDPFGRRIE... 1262
119 7.000e-29UniRef50_A0A229UIP3 Uncharacterized protein n=1 Tax=Paenibacillus rigui TaxID=554312 RepID=A0A229UIP3_9BACL  ali  15  505...................ITDTNGNSILLQY--QGTILEATTAGAEFTFTYGDSGKLVQVTDQTGRSVKYEYDGLNHLVKMILPDQAVIGFTYDEKHRMTEIHNPNQTGTNEYDDQDRVVRQQDFSGVWEMQYDEK-KTVVKDQLGRIKTFHYDERYRKTLEYPDGTTESFTYDGNDNTTSTDRNGHKAQFKYDVFSNMTQIDAAGQVTNIEYNAWNKPTVTNPLNQKTVLGYDNQGNLISVT. 737
120 8.000e-29UniRef50_A0A2E8EVQ1 Uncharacterized protein (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8EVQ1_9GAMM  ali  10 1767.TTDALNNVTTNTYDAAGNLISPLGNATTFTYDTAGNLLSVSDAEGKTTYEYDITNNLTEITDANANVTTFNYNEIGQLTTITDPNGQTTNYQYDSSDQLTQKDLPDNIVKYTYNSSGSLTSVEDTDSLVIMDYDLQNRLVLENALGG------DP-GNVTITTDL............................................................................... 1982
121 8.000e-29UniRef50_UPI00037DB326 hypothetical protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI00037DB326  ali  15 1150...........YAYDSAGHRTFPDGATTTYTYDADGRQKTQTANGATITYGYDEAGNLTTTTLPSGNTDTRTYDRTGRLASITTADGASWTLKRDAAGQPTQLDADGSRQYYGYDDAGRLTETTPEGSAVEYTYDKVGNRATMAKKGRPTTYTYDAADELTRATTGLIRQVYTYDADGNYT---GNGSTSTITYDAHNQPIAAIQAGKNYTFVNDDQGNRVSTSTDGTLTR.............. 1391
122 1.000e-28UniRef50_A0A1I0PE10 RHS repeat-associated core domain-containing protein (Fragment) n=2 Tax=Ruminococcaceae bacterium KH2T8 TaxID=1855400 RepID=A0A1I  ali  15  442.VTNASGEVISYTYDEAGQIASMDGQTISYGYDNMGRLVNVTDSEGTTSYTYDAVGNRASTEYPNGVTTTYGYNENNVLVSETDSTGTVASYEYTNNERLTCT-ELNRTVEYEYDELERLVSETDTVSVTTYTYDANSNRVSMDKDGDITTYEYNELNQLVRADNAGNVATYTYDSYNRMVSASVNGNGTEYTYDYLGNRTSKTTDGVTTYYVTDLDGGMSVTDEAGTLTTYVFDAFGNEVGRT. 760
123 2.000e-28UniRef50_A0A286DZD4 RHS repeat-associated core domain-containing protein (Fragment) n=1 Tax=Streptomyces zhaozhouensis TaxID=1300267 RepID=A0A286DZD4  ali  19  267.........................................................LTAVSDRNGNRVSYGYDADGNLSEIVNSSGLPQRYSYDAHGRMTWEDRNGLAYRYDYDADGRCVTGTDRALEWSYAYDTRRRTTVVDSLGNTTVHAFDCLQRIAETDPLGNTTRVTWDRYDRLTVTDPLGHTTRHVHDAFGRLTMEDADGSRWHQSYDEAGNRTALDPLGNRTAFAYDGRGALVAVT. 527
124 3.000e-28UniRef50_A0A2V7EWS4 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7EWS4_9BACT  ali  17  304.....................................................GLNLLIEQRDRHGNTLTITRDVNGRLTQVRDALGRTVQYAYDPTSRRSVVDAAGGETRYTYDGDGRILSIRDQKGVTRNDYDAQGRVSVTDPRGHTTIYRMDALGQSTRTDALGRAAHIEYDAALRPTITDPLGNVTHFEYDAVGNLTRINPDGDRLDFRYDAGGAPTVTDALGHTSTYAYDAAGNVTSI.. 597
125 4.000e-28UniRef50_UPI00037502A5 tandem-95 repeat protein n=1 Tax=Hahella ganghwensis TaxID=286420 RepID=UPI00037502A5  ali  12 3281.VTQANSQVTTYTYDSLNRLTR---LTTE---DRVGNLITDY------RYTLHSTGRRTQIEEHSGRTSSYTYDDLYRLTKINDPVNGVAEYQYDKVGNRTYSIIDGVHTAYSYDDNDRLTRQ---GGVT-YVYDANGNTLTETEDGVVKRYTYSAKNKLIEVEQGGDSTVYGYNVDGQVLQERVNGTETRYTY--GDDLLSQARNGNASYYVYDGLGSRSLTDRTGTETSYQYDAFGILLAST. 3536
126 6.000e-28UniRef50_UPI000BFEC9F4 tandem-95 repeat protein n=1 Tax=Marinicella litoralis TaxID=644220 RepID=UPI000BFEC9F4  ali  11 3866.VTEING-TTGYSYDAQDRLTYPTGNYIEYQYDLNGNRTQVKTPNQTVDYTFDAVGNRETQTNANGTVATYTYDDLNRLTSLTEGTGRYVEYDYDDLYRLTVTDPINHFSQWAYDAVGNRLQQEIDGTITLYTYNYNDHLLTETKNSIVTRYDYDDNGNLTKTVDTVIDTTYSYSKDNRMLSQTVNGQTINYVYTYGDDLISQTNAQGVYTFGYDGLGSRILTDVNGAVQSYGYQAFGEL..... 4203
127 9.000e-28UniRef50_A0A0C5VTP6 Rhs family protein n=1 Tax=Gynuella sunshinyii YC6258 TaxID=1445510 RepID=A0A0C5VTP6_9GAMM  ali  12 2155.....NDGTTTYGYDDVGNRTSPNGTSQVYNYDSLNRLTETYNGNGTLVEQYDKTGRRIKIEELDGRSTEYSYDTLYRLTTITDAINGTATYQYDKVGNRTYETVDGVQTAYTYDANDRLTES----GGISYTYDDNGNTLTQTEDGVTTSYQYNAKNELIGVSKDDGSTTYQYNIDGIRNQKTESGSTTSYAYDGLGSTRSLSDSNGDITDTYD.............................. 2417
128 1.000e-27UniRef50_A0A2H6FCV7 Putative deoxyribonuclease RhsB n=1 Tax=bacterium BMS3Abin07 TaxID=2005715 RepID=A0A2H6FCV7_9BACT  ali  13  762.LTDPESSTTQFGYDARGTRTDPLGFQTTYTYEDAGRLTSRTNDLSTVAFSYDIIDRVTQMQDSLG-ITTYVYDDVNHTVTVTDPHGFVVVHTYDVAGNLTLTYPGNKTVTYTYDELNRLKTVTNLSQTATYYYDPAGRLYIENFNGTITNYGYDIANRLTSIDAIGNVTNFTYDNEGQVQSKDVDTYAFDYEYDGKGNRLQAERNGVITRYIYDTGGNLLAEADATNTI............... 1083
129 1.000e-27UniRef50_A0A2X0I7Z2 Type IV secretion protein Rhs (Fragment) n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2X0I7Z2_9ACTN  ali  13  220..................RVRDRSGRSYTLEYDRDGTPLRVTVADGRITRYGYTGGHLTQVWNSSGLPMVFANDAAGRITSWTDRNGSHYRYVYDERGRVVDEGGADGSLRFQFDPATGLTETNALGHTTQYHVNARSQVAIVDPLGNTTRYERDEFNRLLVTDPLGAVTRYEYDEVGDLIVTGPDGAQMTAAYDDAAPVVLAEPGGAVWQQTWDEAGRRTVTDPLGATTRYEYDERGHLASVT. 486
130 1.000e-27UniRef50_UPI00082D1E49 hypothetical protein n=1 Tax=Nocardia yamanashiensis TaxID=209247 RepID=UPI00082D1E49  ali  11 1392.VTNPNGQTWHYEYSLAGRLTDYQGATTRYTHDHVGRTATITPANGITRHEYDILGRLTSITRPLTATTRFEYDQYGRRISRVTPSGGETCWSYDYLGRPSSLSVDGNGVDFTYDSSGRLTRWQADELAVDHIRDPVGRLLRQESDGYITSYDYDPVGRIALVTHNGAVERYAYDELGNITSSASDGRR-RYEYDDAGRLVRISGDSDEWSYRYNGFDQLTILTPEGQHWNYTYDALGRRVSK.. 1770
131 1.000e-27UniRef50_I4ACK9 RHS repeat-associated core domain protein n=2 Tax=Desulfitobacterium TaxID=36853 RepID=I4ACK9_DESDJ  ali  14  831..............................................QTTFSFARSGLLTGIEDPRGNKTFLTYDEEDFLTLITSPSGKDFPVSMDPEGRITSITPNRSTLSYTYDPAGNLVTQDADGEQTHYHYDEQGRLSFTDPNGNVIHNSYDEDNRITQTDANGQKSRIIYHEGYNETI-DNNGNKTTYTYDEHYRTSQIKPDGTREAYTYDEDNNLK---------TYQ-DPLGRITTYSY 1024
132 1.000e-27UniRef50_A0A0K1F228 Uncharacterized protein n=1 Tax=Olsenella sp. oral taxon 807 TaxID=712411 RepID=A0A0K1F228_9ACTN  ali  13  864.LTYPDGTVARWSWDAAGRLVDDDGRATSYAYDAAGRLASTRTPDGREDWAYDAAGRVTTTADGGRHEASWAYDAAGRLTSRRDP-GASGDYAYDACGRLVASDASGERT-YAWDAAGRLARERSGAGETSYSWDAAGRLASREGPGGREDYSYDGRGDMVLKDGRVGFTSWSYDGLGR.................................................................. 1058
133 1.000e-27UniRef50_A0A0B7MBS3 Uncharacterized protein n=1 Tax=Syntrophaceticus schinkii TaxID=499207 RepID=A0A0B7MBS3_9FIRM  ali  15  881.LTDQTG-VTTYTYDANGNLTDTQGNTIAYAYDQAGNLITLTYPGGRVHYTYDPGSRLTGVTDWAGRTTAYQYDQNNRLTATTRPDGSQLTLTYDDAGQLLQTASGGSVISYTYDNTGNPLTEDPDGNMTTFTYDARNRLTE----AGTTTYSYDAENNLIKTDAQGNKTYYVY-GLGLLGQEDPAGNYRSYHFDRRGSTIATDQNGAATTFQYAPYGELV........................ 1195
134 1.000e-27UniRef50_A0A014L372 Type IV secretion protein Rhs n=8 Tax=Streptomyces TaxID=1883 RepID=A0A014L372_9ACTN  ali  1195.....NGRVLTHTYDPLGRRTTPTGAVTTYAYDTAGNRTALTDAAGRETTRWDPLGRLTSLTGASGGIHHRTYDADDHLIAVDDHLTGRRTFDLDTTGRVTAVHADNWTETYAYDEAGNQTSTQPAQEATSYT----G--TRITGAGSV-RYEHDDAGRLTQKTRLSRTWRYTWDAEDRLIVTTPDGTVWRYLYDPFGRRTAK.......................................... 1427
135 2.000e-27UniRef50_A0A0U2XC35 Uncharacterized protein n=7 Tax=Enterococcus TaxID=1350 RepID=A0A0U2XC35_9ENTE  ali  11 2233..TDEKGENLTYSYDALGRKTSPSERKITYEYDKKNQLTVVADGDQKTVYEHDGAGQIKKISYPNGTITQYDYLATGEISSAETANGAKMTYAYDENDNLQKETKLTLEKTYEYDAEDQLTKVIEVEGKIEYYYDDAGNRITKVNDKEKTFYEYNNMNQVTEITSEKGA-KFEYDANGNVAKKIAMGEVTTYLYDVEDRLIQETSSNGVYTYGYDALGNRVI---KGTATEH-----GRRIKTD. 2488
136 2.000e-27UniRef50_A0A2G9YA61 Uncharacterized protein (Fragment) n=1 Tax=bacterium (Candidatus Ratteibacteria) CG23_combo_of_CG06-09_8_20_14_all_48_7 TaxID=201  ali  23  186......................................................................YHFNTAGQLIRIEGRNGNTQIFDYTDDNLTEITDSSGRSTTLAY-ADGKLTITDPAGNTTTLQYTADSLTKVIDPGINTTTCTYDSNNRLISTDPNGNTITYTYDEKSRVTVTDSKGNVSTYTYDPDLNTKTEDSQGNVTTYTFDEHRNLISTDQAGNTSTYTYDTNGNLLALT. 385
137 2.000e-27UniRef50_A0A2G6JUZ1 Uncharacterized protein n=1 Tax=Micrococcales bacterium TaxID=2026762 RepID=A0A2G6JUZ1_9MICO  ali  12  743................................................VFVFDTEGQLTQVQDRNGNAITLSYNDAGDLATVSDGKGASLTVTW-AGGRVSVTDHSGRSISYAY-TNGNLTTVTADGTKSQYTYDSSRRITTTDAAGRDVVNEYDTEDRVTVTAADGLVTRYDYDA-DRLVKTTDLEAVTTYEYDATNSLTVVDPLGRSMSMVNDAKGHPVVTDPTGTVTTATYDPAGRMATVT. 966
138 2.000e-27UniRef50_A0A1Q6QIA9 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG_194_44_15 TaxID=1897037 RepID=A0A1Q6QIA9_9FIRM  ali  16 2927.....................DTNGQVISYERTEEALTIRTTDE--TVTLFYDTNGRLVNAGDSHGRSVSFAYDENDCLTGYRNEEGNLTTYTYDEKGRLTVVSPMGTVVENSYDEAGRVIRTDENGAETSYVYEKGKLVKKIEPDGKATAYTYDTDGNLTKETATGQQAQISYDTDGNPVNINPDGGTESYTYDTYGNRTSTDRLGNCTKYAYDQYGNLIRTDALGNTSECEYDQMGRVISQT. 3244
139 2.000e-27UniRef50_A0A0L6W4D5 Putative deoxyribonuclease RhsB n=2 Tax=Thermincola ferriacetica TaxID=281456 RepID=A0A0L6W4D5_9FIRM  ali  11 1617.VTDRLNKVTSYEYDQVGRRTKPNGVVTSYGYNTANQLTSMINADQKLLYTYDLAGNLIQTVEGSVYTTEYFYDPLNQLEKVINPDGSRVAYEYDPVGNRIKTKVEGNTTKYYYNAANELTKFNNDGPFTEFRYDNNGNRIAIEPGNKVTSYTWDYENRLTEVRHQGKWVGFEYDGDGNRITK.............................................................. 1817
140 4.000e-27UniRef50_K9QZ75 RHS repeat-associated core domain protein n=1 Tax=Nostoc sp. (strain ATCC 29411 / PCC 7524) TaxID=28072 RepID=K9QZ75_NOSS7  ali  13 6346..TDPDGVKIAYTYDAAGNRTAVTSGTTTYTFDAQNRLKTVLDPNGETKYIYDLAGNIIRTELPNGTVEIREYDSLNRLIKHTNANGRTISYTYDAVNRQTRNDSQEGNTTYEYDQNDRLLKEVTNGVTTNYIYDNNGNTLSKTTGTDKVTYEWDDENRLIGVDTNGDDITNHYDSDGIRIVQTVNGEVTHF..................................................... 6594
141 4.000e-27UniRef50_A0A1I6LH38 YD repeat-containing protein n=1 Tax=[Clostridium] populeti TaxID=37658 RepID=A0A1I6LH38_9FIRM  ali  18 3490.........................NRDVFQFNQDGKLTKITDAQNRVLFE--QLEQQTIVTEPSGKRLIMNYNSQGLITEVSDDYGRKTSFAYTDQYLTSITNPLGETTTYTYDESGRVLTQDDAGSTSYFQYDWNGNLVSKDGEGNTTYYEYDSENRRTVVDAFLKETHMSYDSNGNVIVTDQLGLQTQFKYNENGQLLEKDYLGNETTYTYDDFGNVTVKDKEGNRTEYTYDTLNRVIEE.. 3823
142 6.000e-27UniRef50_UPI00093E652C hypothetical protein n=1 Tax=Paenibacillus ihumii TaxID=687436 RepID=UPI00093E652C  ali  12  223....PNNVITSYAYDPNDRVTTRQGNPYSYTYDAAGNITSMSDHRGTSTYTYDGNNRLIRTTSANGTQVDYRYDGVGNRLAESTQLKQIRLYSYNALNQLIGLDDENKNTAYTYDLNGNLLE----DGKYLYSYDSLNRLITTDAVYGQIFYEYNGDGLRIGSIIDGQRINYYWD-QDQISETDAAGQIIAHIY-GLQRLARILGPGNRFYYLYDGHGDVRMIDPSGKLLTYDYDPWGNVTSQT. 492
143 6.000e-27UniRef50_A0A1F8NF55 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F8NF55_9CHLR  ali  11 1540.LTDWESRAITFVYDEDGNRTSPNDVDTAYGYDDAGRLTSVTGPGGSFSYTLDAKGNRTEVT-SEGGTETYTLDDLNRITNAVYPNDDTVSYTYDASGNRLTETVNGVTTYYTYDGADQLLS----DGSTDYTYDENGNLVAADGD----TFTWDYADRLIDATVGGIDTSYAYDGNGTRVSKTVDELSTIY..................................................... 1729
144 7.000e-27UniRef50_A0A2K8RAU5 Deoxyribonuclease RhsC n=11 Tax=Streptomyces TaxID=1883 RepID=A0A2K8RAU5_9ACTN  ali  900.....NGRTTTYAYDAMGRRTERTGLRSVWTYDESGRPTARTGTAGALAFTYDTAGRETERRIGESVTLTQTWDSSDHLTTQTIAEGQHRSYAYRPDGYVTEIRELSGTRRFDLDPVGRVTAVHAHGWTETYAYDTAGNLTVIHRAGHTT-YEHDTQGRLIRRTGQTRTWTYTWNAEDRLTATTPDGDHWHYTYDPLGRRISKTPEGNHTTWDY............................... 1171
145 7.000e-27UniRef50_I3BYW5 RHS repeat-associated core domain-containing protein n=1 Tax=Thiothrix nivea (strain ATCC 35100 / DSM 5205 / JP2) TaxID=870187 RepID=  ali  16  445....PGSKTVSFGYDDVGNLTDSLG-TTTHAYDANNRRTSTHDPFGNVSYGYDGNGNRITLGYPGGKVVSYGYDKLNQLAAVTDWLNHKTQYSYDVTGRLTGINANGTTTSYNYDNANRLANKKADGTVISYTLDEVGNHTQEDANGNMTTYRYDVENRLVQSNIDGVVTAYQYDGFGNRYSRTPDNSMSTFHYDSRGSTIAMTNSTETSSYAYDPFGLVV........................ 756
146 9.000e-27UniRef50_R8B058 Rhs family protein n=2 Tax=Marinobacter lipolyticus TaxID=209639 RepID=R8B058_9ALTE  ali  13 3219....PDGSVLSYGYDAAGNRTSAGGSTTSTSYDALNRLEVVTASQGQTLYTYDAVGNRESVSYPSGNVTLYDYDALNRLTTTTDAAGRTTSYSYDELYRLTGEDKVGNRTSYSYDANGNTLTETEDGQVTHYRYDARDKLIEVEKPGLTARYGYNADGIRTRKTENGITTHYSYTYGDDVVSQTRAGSTDSYDYDAFGVLLSTGDTENVYRYT................................ 3546
147 1.000e-26UniRef50_UPI000996B493 hypothetical protein n=1 Tax=Streptomyces sp. URHA0041 TaxID=1380346 RepID=UPI000996B493  ali  11 1150.....NGRTTRYTYDLAGHRTTPSGHTSTWTYDPAGRPTGLESLAGALTFAYDAGGRETERRIGDGLRLTQSWDTGSRLTGTTDHLLHHRTYTYREDGYLTEIDPTGRVTTYAYDSAGNLTSQTPRGARTTYEHDAHGRLTRTNGQKRVRTYTWNTEDRLISTTSGDTTWRYRYDALGRRTAKAPDGSVTDFTWDST-QLTEQTTADTATTWEY............................... 1418
148 2.000e-26UniRef50_A0A2T1LVR0 Uncharacterized protein n=1 Tax=Aphanothece hegewaldii CCALA 016 TaxID=2107694 RepID=A0A2T1LVR0_9CHRO  ali  11 5754.VTAPNGGIISYTYDKAGNLIQPNNTVETRQYDDLNRLVKQVGAEIISSYRYDSVGNRLKVEENNTRQVNYTYDALYRLLKITDAAGNRIDYTYDASGNLTRNDSAEGLTTYTYDNNDRLLNETLNGQVTSYTYDHNGNTLTRTNSISQTVYNWDYENRLIEATSTGTTQRYQYNSEGIRIAATVNGQETRYEYNPNGDLISQTRNGVTSSYNYDAYGQQIQSTGN................... 6041
149 2.000e-26UniRef50_A0A1E3C450 Uncharacterized protein n=1 Tax=Clostridium sp. Bc-iso-3 TaxID=1848158 RepID=A0A1E3C450_9CLOT  ali  13 3373.VTYPNKNITIYEYDSLNRLTNIVNK------DSDGIVIS--------SFEYTPVGNCLEVVENTGRIVEYRYDDTYKLLKITLPDGSEVSYKYDGVGNRIEKNDNGIITKYGYDNNNRMITE----GEKTYKYDANGNVVSVDPVGMSISYSYDYNDRLQAIDGTENVL-YEYSVEGIRVSKTVNGQKIYYEWDAEGNLISQNRKGIISYYIYDGRNSRILTDSTGKVTTYTYNAFGELLQNT. 3628
150 2.000e-26UniRef50_A0A2K8UJ15 Uncharacterized protein n=1 Tax=Candidatus Thiodictyon syntrophicum TaxID=1166950 RepID=A0A2K8UJ15_9GAMM  ali  899..DDPSGQ-TRFTYDARGNVLTESGRTYAYTYNGADRLTTLTYPSGAVTYTYDAQGRVRSITDGSGLAHTETFDTDYRPTAITVGTVQDLAYGYDAADNITWTDALDRTQRFDYDALDRLTDADGPYGAVAFSYDLVGNRLSKTVGAAQTLYSYTDSHRLQLTTGADSV-DYRYDAAGNLIQ----DSRFTYVYNQANRLAEVKQGGATLTYTYNAEGQRVAKTVGGQTSHFVYGPDGQL..... 1164
151 3.000e-26UniRef50_UPI00068A49E0 type IV secretion protein Rhs n=1 Tax=Streptomyces seoulensis TaxID=73044 RepID=UPI00068A49E0  ali  12  904.VTDPRGLTWTYDYDPAGHLTDFDGRTLRYDYDAVGQLTARTNALGQTTYEYDHFDELASATGPDGRTLRWSYDTSGRLVRRTTPSGVVTERGYDEAGRLARTDPLGRRRNYSYRADGHLTLRTPDGDH-DFTLDETGRVIAVSAPGWVEAYAYDQAGNQLEATQPGAATRYEYDAQGRLTLTTPDGTVWKYLYDPLGRRVAKTAAGEVTTFAWD.............................. 1260
152 3.000e-26UniRef50_UPI0009F9CC7F hypothetical protein n=1 Tax=Holdemania sp. Marseille-P2844 TaxID=1852366 RepID=UPI0009F9CC7F  ali  12 2209...DAAGNTTQYEYDAYGNRTYPDNTSITYQYDLSGRMTKTYDALGRITKSYDNNGNLLTQLTKLGTRTTYVYNDINSVIQETEILNGTTTYSYNENDELIKTVKKQGTTTTEYTLTGNKTEVTEGQVTYRATYDDFNRIKTYYDGTYHITYAYDANGNRIREGRDDNTVEYTYNKLNQLVVKDFDGTVTTYAYDGAGNRIRQTAD....................................... 2457
153 3.000e-26UniRef50_V8C3T8 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=V8C3T8_9FIRM  ali  1232.VTDGNGNTVSFAFDGMGNKIKADGGTYSYTYDAVGNQTSLTDAEGNTTYTYNVRGNKLTETDAAGDTITYTYDALGNILTQTDENGNTTSYTYDYAQNQVVTDAAGEQVSYTF................................................................................................................................... 1350
154 3.000e-26UniRef50_A0A1T4XVL2 RHS repeat-associated core domain-containing protein n=1 Tax=Thiothrix eikelboomii TaxID=92487 RepID=A0A1T4XVL2_9GAMM  ali  2410.ITEATGRVSTYTYDTLYRVTSETDHSSGYQYDPVGNRVYQTVKGVPTAYTYDANDRLLS----AGGVV-YTYDAQGNPLSQTDEHGQLETYTYNSRHQLTSHTVNGHTTTYAYNPEGLRTQQTTPSQSTAYNRDYAQVLAEYDSTGLKTSYRY--GDDLISQTQGSVTHYYHYDGLGSRALSDHAGTLTTYAYTAFGDLLQQT---GTTENAY............................... 2625
155 4.000e-26UniRef50_UPI000B3E1EEB hypothetical protein n=1 Tax=unicellular cyanobacterium SU3 TaxID=1982589 RepID=UPI000B3E1EEB  ali  13 1705LMTASG--VTVYTYDALNRVTDADGGVTDYDYDGVGNLIQTTLANGIITYTLDAVGNRLKIEGEDGRITEYEYDLLYRLTSITDPNGNLTEYVYDAVGNLQKIDSISGITTYIYDNNDRLISETINGITTQYQYDHAGNLITTITDGETTEFEYDYSDIRVAINVDGEETRFEYQADGELIKTDSNGNTTEYVYDAYGNLL............................................ 2008
156 4.000e-26UniRef50_V6KEU4 Uncharacterized protein n=17 Tax=Actinobacteria TaxID=201174 RepID=V6KEU4_STRRC  ali  13  890...DAHGLVTTYAYDTSGRLVQATGASMHRRFDIGGNLAAET-VNGRTRYTYDEGGRRRSRITPTGAVTTYTHDAADNLVQLSDGVGRTLTSAYDAVGRLTSVTGLGGRVEYCYDVIGRVTEIQADGWTERYAYDETGNQTSAHP-GHEATREY--VGNRI---ARAGRVRYEHDCLGRITQKTRLSRTWRYSWDAEDRLTVVTPDGTLWRYLYDPLGRRIAEDATTAVVDFTWDA......... 1185
157 4.000e-26UniRef50_A0A2N7BA00 Uncharacterized protein n=1 Tax=Siphonobacter sp. BAB-5405 TaxID=1864825 RepID=A0A2N7BA00_9BACT  ali  12  878...DAKGNATSYTYDARNQVTYADGSTKRFAYDAAGRLIEKTTGNGTIQYTYDALGRMTERQYPANAIITLSYDAAGRLLKE-DNNGKATTYTHNPSGKTTITYPGGTKIEWTYDGADRLMKKTQNGTSASYSYDKMNNLTATPASQLNLRYQYDAADQRTLTERVHKPTRYTYDALGNRTVYDRNGNLLTYTYDFENRVTSIQKGTDRITYAYDALGRRISRTQNGMTTQYYYD-LDQVIEE.. 1233
158 4.000e-26UniRef50_UPI0006919BE5 hypothetical protein n=1 Tax=Streptacidiphilus oryzae TaxID=348818 RepID=UPI0006919BE5  ali  19  349...................................................................VVRFGYDARGRLKQVVNSSGLPLVYEHDEQDRITWTDRNGHWYAYSYDAQGRVVVTDGRGHRIEYHYDEYGRLLSTDPLGHATRLTYDDRHRPVVRTPEGLTWRQSFDERGNRTRTDRSGAVYRFEHDRTGSLTATDPLGNTTTARYDGRGLLLSVDPVGGRVRYEYDAFGRTVAET. 596
159 5.000e-26UniRef50_A0A2P8A7D5 Putative deoxyribonuclease RhsC n=2 Tax=Streptomyces TaxID=1883 RepID=A0A2P8A7D5_9ACTN  ali  17  479..........................................................................AELRLTGVTDRNGNSIRYRYDQHGNLSEIDRNGTEYRYEYDAHGRCVRTDSLGHATTFRYNRDLRITEINALGNSTATEWDEDGRLTETDALGRTTRYTYDAQDNLTVIRPDGHVTSFEYDTAGNLLSTDPANATARYTYGESGRLLATNALGAEEAYAYDSFGRVVS... 762
160 7.000e-26UniRef50_A0A255PRX9 Uncharacterized protein n=1 Tax=Streptomyces sp. FBKL.4005 TaxID=2015515 RepID=A0A255PRX9_9ACTN  ali  11  782.VTNPQGLAWSYTYDEAGRLTDFNGRTLTYTHDGNGRLAARTDPLGRTTFAYDALGRVLSET-VNGRTTTHVHDAAGRRTRVTDPAGRVLEFAHDAAGRETRRSADGYVTRFDLDGMGRVGGVRAHGWSETYAYDPAGNLVATSPDAGRTSYEHDAEGRLVRRDGRTRVWSYTWNAEDRLTVIDPDGRHWRYAYDPLGRRVSKHDDGSVTDFVWDDLSLAEQIAPDGWVTTWDYAPDGRPVAQTH 1167
161 1.000e-25UniRef50_UPI00099EF3D3 type IV secretion protein Rhs n=1 Tax=Streptomyces flocculus TaxID=67300 RepID=UPI00099EF3D3  ali  16  59.........................................................LSAITDRAGNRVSYAYDAAGDLAQIINSTGDPLRFRYDDQHRITSHDRNGTAFGYVYDHRGRVLRTVGPDGTFRFRYDEAARTTRTDSLGHESVYVYNEAYKVVSTDNLGHTTRTEWDGTNRVAVTDPLGRTTRYSYDDLGNPVRRDPDGGVWRHTYDDRGNRTSTDPTGAVTRYSYDDAGHLTGIT. 325
162 1.000e-25UniRef50_A0A1I2RTC7 RHS repeat-associated core domain-containing protein n=1 Tax=Duganella sp. CF458 TaxID=1884368 RepID=A0A1I2RTC7_9BURK  ali  12  963..TGFDGKVTTFTYSAAGNLMASNGIATDFARDALGRLLAKSSPDGAVRYAYDALGRLTAAATAQ-AEHRFGYDAAGQLIEERYAPGFTMTHAYDELGNRIQTVPNGRTERRSYDPQSRLNSTLDKGRERRYEYDAASNLVYIDDKGGSIRYAYDPLGQLLSAVQPDLTETFAFDPAGNLLDTGPLAKVTSYEYDVQGRMTTRANDEGILEFKYNSENRLTTATNSRQVARYSYDAFGRRIAK.. 1319
163 1.000e-25UniRef50_A0A1Z4UAR2 YD repeat protein n=2 Tax=Nostocales TaxID=1161 RepID=A0A1Z4UAR2_9CYAN  ali  15 2767...DRNAGITDYTYDAVGNLVSPNGVTETRTYNAVNRLVSLTGAIAGYSYNYDPTGRRTRVEEIDGQVTEYSFDSLYRLTKITIPSNRSISYTYDVVGNLTRNDSANGISTYVYDANNRLQSLSSNGVATTYSYDNNGNTLVTTANGDIVQYQYDADGNRVAEIINGIETRFTYDAQGTVTLTDNLGNITAIAYDAFGRILNQAGTTSITHYSYTENNPVNGTDPSGNST............... 3118
164 2.000e-25UniRef50_A0A1Y0BE62 D58 n=2 Tax=uncultured bacterium TaxID=77133 RepID=A0A1Y0BE62_9BACT  ali  16 2620.MVDASG-TTTYTYDDRDRLITADGISVDYTYDNVSRLEKVIDQAGATNYTYDAVGNLKSDLRPNGVRADYTYNVVNRLTALIVGKSGATQYTLDRTGRLSVAEFGGRTTNYTYNDIYQLTRENPAGNSATSNYDANNRLTSYDANGNTRTYAYDFENR--IKSANNGAVRITYDGDGNLAAKAVGGVTTRYLIDDLNQVVEEIVEGNVQRYTY---GNTIITDATGTVTTYTYDAFGKVIAST. 2959
165 2.000e-25UniRef50_K9RH87 RHS repeat-associated core domain protein n=1 Tax=Rivularia sp. PCC 7116 TaxID=373994 RepID=K9RH87_9CYAN  ali  12 2400.VTDRQNNLTTYSYDLVGNLIFANGIIETRQYDLLNRPIVITNSDGNIISSYDNVGNRLVLEENTGRRVEYSYDDLYRLTSVTDANGNETTYVYDNIGNRSRTSTTNGTTTYTYDDNDRLLTETNDGIVTNYSYDDAGNLITTATNGETQTYTWNSKGELSVVNENGQTIEFQYNTDGIRVATTVDGETTNF..................................................... 2609
166 2.000e-25UniRef50_R9IDU7 YD repeat (Two copies) n=2 Tax=Lachnospiraceae bacterium A4 TaxID=397291 RepID=R9IDU7_9FIRM  ali  452.ITDAALGTTAYDYDKVGNLIKAVGNTVAYTYDKNNRPVSLSRQFGETIRTYDALGRITSETPEYARSRSYMYDALGRLTAYSDGE-NTETYLYDALGNRTAKHLNGSAAAYQYNAFSQLTAVTQGEDVYSYHYDRRGNLTEERHGDHVKNYVYDAANRMISGTNLGRKSEYTYNGLLARVKKTSDAIVSTY..................................................... 657
167 4.000e-25UniRef50_K0K3W0 Uncharacterized protein n=1 Tax=Saccharothrix espanaensis (strain ATCC 51144 / DSM 44229 / JCM 9112 / NBRC 15066 / NRRL 15764) TaxID=  ali  17  536........................................................LLSAVSDANGRRIEFGRDAHGRLTEVVNSSGTPLTFEYDDQERIVREDRNGMWYRYSYDSANRCVRTNSLGHTTVYHVDERYRVVETDPLGNATLFAWNEHHQLSRTDPLGRKTSYAYDERGNLVVTYPDGTRSLGEYNEFGRLVSVDPDGAVWRREYSPAGALTAVDPMGGRTVYGYDELGNLRTVT. 796
168 5.000e-25UniRef50_G7TE94 RhsD protein n=22 Tax=Xanthomonas TaxID=338 RepID=G7TE94_XANOB  ali  13  342.LTSPDTGVTRYTYDSAGNRTDARGNTTAYSYDALNRLTKVTYPTSNVTYTYDSIGRLTKMQDG-GAITQYCYNRFGQLQRMTYPDGAVVDYVRNAQGQTTQTYGNGRTLARRYDLDYRPRATRPGGLEVGFGFDPAGNLTALTPAGNSTGLGYDALGRLTLKDGRTGTLIYSYDATGNRLSVGAATQIYTYTYDKTGNTLTI--GGKAREFFYDASGRMSMAKRAGAVMNYRYNGKGEQVQR.. 676
169 5.000e-25UniRef50_U2W7N6 RHS repeat-associated core domain protein n=1 Tax=Oribacterium sp. oral taxon 078 str. F0263 TaxID=1321782 RepID=U2W7N6_9FIRM  ali  14 1087....AEGDTLSYYYDEKERKRSPDGTEAVYRYDSLGRLVSLSSGTEKIEYHYGKEGRLSEKRYGDGMRSSYRYDRLGRLTELLDRLGNRSSYRYDALGRLCCVEKDGVCLRYRYDSFGNRTEKTEAGRRTAYQYNALDQLISREEDGGATDYFYDHRGKLTEIRRQGRQKRYRYDGFGRMSAEDADGSSISYCYNSLGQRIRKLPSGQRRSSSY............................... 1341
170 6.000e-25UniRef50_A0A2V1NYS2 Uncharacterized protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A2V1NYS2_9ACTN  ali  13 1056...........YTYDAAGQLLTADGSTIGYAYDNDGRTSSMTADGATTTYTWDAADHLTRSTLPNTETEDRAYDRAGRLTAVTSAKSGTTVTTYDAAGRLTVTGAATRTTSYTYDKVGNRLTSTLGTTATNYSYDAADQLTSTDGEGNQTTYTYDLAGQISAATVAGGNYTYDHDASGNQIATAKDGTVTSYRYDPLGQPAATTAAGALFSYHHDTQGSPVDVTSSTGTLRWAYDPFG....... 1368
171 7.000e-25UniRef50_A0A0A6PDX3 Uncharacterized protein n=3 Tax=Candidatus Thiomargarita nelsonii TaxID=1003181 RepID=A0A0A6PDX3_9GAMM  ali  14  5.................................................................................................................................TTFTYEANGNLSSTDANSDTTNFGYNSNGDLTVTDPLSHTLSYTYDDVGNLTQTDANSHTTSLAYDQLNRLTSTNALSQQTTFGYDANGNLTSTDAESNTTTNSYDALNRLSRVT. 124
172 7.000e-25UniRef50_A0A1E5L8P8 Uncharacterized protein n=1 Tax=Desulfuribacillus stibiiarsenatis TaxID=1390249 RepID=A0A1E5L8P8_9BACL  ali  12  639........TTQITYDQTGNRISPNGTNITYSYDLGGRLTAVEHIYNNETYTLDNIGNRLTVTDQNVDTTNYTYDELYQLIKVEYPDGQIEEYTYDPVGNRTHK----NNTTYQYNQANRLIQVDANGNLISYQYDYENRLVTYTDTNSTTQYSYDGDGNLVETDNTGSHNNYTY--AGRVLSRYGPEGQIYYHQDGLGSIVLITDETSQNQYEYDAFGSRTVTESVYNPVMFTYDANGLL..... 919
173 8.000e-25UniRef50_A0A0G3US88 Type IV secretion protein Rhs n=7 Tax=Streptomyces TaxID=1883 RepID=A0A0G3US88_9ACTN  ali  14  947..TNAAGEATTYEHNALGQVIDAAGLTTSYAYDTFDALASAASAESTITWLRDDAGRLLSET-VDGRTLTYGYDALGRRTGRTTPGGSESLWTYDAAGRRTALTTADRTLTFGRDAAGQLTRTDDMGRRTTFTLDAASRVTAVETASWSERYAYDEAGNQTSASWPGGSVRYEHDALGRVTVTTPDGTRWRYRYDPLGRRTAKSESGSVTLFAWDSAGRVTVT...................... 1276
174 9.000e-25UniRef50_A0A2G1XFX9 Uncharacterized protein n=28 Tax=Actinobacteria TaxID=201174 RepID=A0A2G1XFX9_STRCJ  ali  18  454.......................................................................................................TPGGGTVRYGYDDAGNLTVVNSSGKPLRFTYDAEGRVTSTDRNGTSYGYVYDERGRVVRTEGLSGTLEYE-DGSRTTTVTDALGRRSVFQYDADALVVSTDPLGHVTLTEWDARGELSVTDAGGRTTHYAYDDSGNLTKVT. 604
175 9.000e-25UniRef50_H1GFK8 RHS repeat-associated core domain protein n=17 Tax=Listeria TaxID=1637 RepID=H1GFK8_LISIO  ali  18  878.....................................................ANGLLLKVTSKDGNVTNYTYNADGELVKMVTGSGKVLQYTWDADGHLKEIVPDGGKLAYSYDDDGNLTKVDQTGKVITYQYDSEHHMTSKDHNGKLIKNTFDADGRVTQTDGEGNTATLKY-EEGKTTTTDFNGNKKVVYFNERFQTTKEYADDTTTENKYDDKHQLVSIDQLGNTTTFENDANGNLTKTVY 1075
176 9.000e-25UniRef50_A0A239ITD3 YD repeat-containing protein n=2 Tax=Micrococcales bacterium KH10 TaxID=1945885 RepID=A0A239ITD3_9MICO  ali  11  403...........................TSFRFDSSGRLVSIADRNSNELGFTYVADKLTEIENDSGQSITVTW--SGDLIEVTDHSGRSVQYAYNAQNELTVITFPDETSSFDYDSRHRVIKEDQLGGVTTNTYDTDGRVISENPLGGVTSFSYTAEELTTVTHPDGSTTEFSY-LLGQLSRTEAPGATTLYEFGYTGQITVTDPMGRITIHEYDDQGNRTETV----------DPLGRVTSATY 621
177 1.000e-24UniRef50_S3B6N2 YD repeat (Two copies) n=7 Tax=Streptomyces TaxID=1883 RepID=S3B6N2_9ACTN  ali  11  558.....NGRTVSCTYDAAGRRTSPSGHTSTWEYDAADRPLSLTTDGGALSFTHDAAGRLSQSWDANGRLTTYAYDAVGRVTGVQ-AHGWTERYAYDQAGNQTSAQAPGHRTHYEHDAAGRLIRKTGQTRTWTYTWNAENRLVSTNPQGEEWHYTYDPLGRVTKTGPEGHGVTFTWDGT-RVTEQTADGSTTTWDY................................................... 819
178 1.000e-24UniRef50_A0A124HMN3 Uncharacterized protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A124HMN3_STRAT  ali  14  473.......................................TVSDPLGHTRRFMPPSGLLERISDRNGHTITFDYNEQGNLTEVINSSGLPLKFTYDGRLRVTSTDTNRRSYSYTYDEQDRTTLTTAEGAASRFVINEACQVVEIDACGGVTRTTYDIHHHVVSTDALGHTTAYTNDVTGRPTVAHPDGTVTRIAYNDLGLPTALTPDGSSRRFGYDERGNRTTTDASGATTRFTYDAAGRLTSV.. 762
179 1.000e-24UniRef50_A0A1F8ZNI3 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium GWF2_42_12 TaxID=1797824 RepID=A0A1F8ZNI3_9DELT  ali  16  873.ITDTNNKTISYQYDAFGNKISAQDGITTYAYDANNRLIQIIGSASTFTFIYDNLNRRTKLNYPNVTNTNYTYDTLSRQTNITFKNNTTITYTYDKVGNLTASDQGGNTTTYTYDSVGNRLTTYNNGNSTVFTYDNNGNMTTKTDTCGITTYTYDFENRLININSFTPVTAYKYDPFGRRIQKTINGTTTKYEYDGNNNITKRDQLGSVATYKYDSFGNITAT...................... 1194
180 1.000e-24UniRef50_A0A178K193 Uncharacterized protein n=3 Tax=Vibrionaceae TaxID=641 RepID=A0A178K193_9GAMM  ali  12 3049..........SYQYDTNGNKLSLTTNTTTYTYDAVNRLSTVTDNEGGITYSYTALGMADVIYHPNGISTHHVYDNLNRLTQSTSGAGQRTRYQYDVLGNRTKETLDGVVSLYNYDANDRLVTKD----LTQYSYDANGNLLAERTSGAIERYFYNTKNRLTSFDDGTQFAVYEYNPNGIRTSASINGVITHYIIDENRNLLSFNAQGTNSYFVYDGLGSRALVDETGSVTTYDYDGYGTVLKQT. 3360
181 2.000e-24UniRef50_A0A177M788 Uncharacterized protein n=2 Tax=Methylomonas methanica TaxID=421 RepID=A0A177M788_METMH  ali  12  819.VTDANNHSTAYSYNGLGDLLSPNAGVTQYAYDSAGNLAQKTDARGQTLYLYDSAGRLSSITDGDGRTTAYAYNADDALVHTQYPTGRQLDIAYDANGRATSTNGVNGTQTYRYDLTDNIIGINNAANDKTYAYDALSRLS--HALGATTDYTLDAVGNRTAITRNNQTDSYVYNANDQLQSTDAVGNVTQYHYNDHNRLSAVSNSGNVAEYTYNAFGERLKKTTPSATTHYHYNQEGQLIAET. 1181
182 2.000e-24UniRef50_A0A221P0V0 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A221P0V0_9ACTN  ali  13  312...........................................................TVTDQDHSASVF--DSGGRLTALRDASGNGLTLTYTSGRLASVTDAAGRSTAFTVGSDGLLSKVAPDDTTVGYGYTSGQLTSVTDPAGKTTTYGYDSAQHLTVTDPTGAKIVNTYDANGRVSQTDPNGKKTTFTWDGNSTSNTTDADGGVWSDQY--AGNVLSIDPYGNEVSYDYDKLGNTTTMTY 508
183 2.000e-24UniRef50_UPI00099B7B82 hypothetical protein n=2 Tax=Streptomyces sp. NRRL S-237 TaxID=1463895 RepID=UPI00099B7B82  ali  11 1245....PDGRATSYAYDADGRMTTQNGRTTAYGWDTAGNLISTTTPAITETRTYDQAGRMASISEGAG-TRQFVRDGSGRVTTETYKDATTTRYDYDAAGRLTRADKVGNRLSAVFDAADQMTSSTTGTAVTDLTYDTDGNLT-KDGAG---TYSYDALGRAKTTTIGADTFTFVYDADGNRTTTKKNGAPIRYHYGPLGEPQAVDTGAASFYYLHDRQNSVTSVRDLSGVENYKY........... 1535
184 3.000e-24UniRef50_G2NJ07 YD repeat protein n=4 Tax=Streptomyces TaxID=1883 RepID=G2NJ07_STREK  ali  1057.IVDASG-TRTFTYDKDDRLTGPTGKAFAYKYDDAGQLTERTYPDGQLTYTYTADGLPLAITYPNGYTETRSYDRAFRLTDIVDGNGRSAHYTYDASGRLTQTTSDAPTTSYTYDQVGNRLTQTSPDSTTTYKYNEADELLQRTNGTATTGYTYDADGNQT-TDGIDGATSYTYDADGNLTSKSKGTLTTAYTWDINNGLPQL-AMVGSSDFTYNELGQVASTRQAAGTFYYHHDLIGSITDLT. 1375
185 3.000e-24UniRef50_Q64AY8 Rhs family protein n=1 Tax=uncultured archaeon GZfos28G7 TaxID=285381 RepID=Q64AY8_9ARCH  ali  12  517.TTDALGNTETYAYDAVGNRIDKNGNTTTYTYDALNRLASTTDALGNETHAYDAVGNRVRFTDKNGHTTAYAYDALNRLVSITDALGGVTAYAYDAVGNRNRRDG............................................................................................................................................ 624
186 3.000e-24UniRef50_UPI000DE3A4EE type IV secretion protein Rhs n=1 Tax=Amycolatopsis albispora TaxID=1804986 RepID=UPI000DE3A4EE  ali  22  452............................................................................GRLEAVEDRNGNVVRYEYDDRGRLAKVDSEGRLVRYRYDARGRTVFTDSLGNRTTYRYDEARNVVLTDPLGNVTRQEWNDRDELVVTDPLGRVTRFTYDDNGNLTVTRPDGSQGLAEYNEFGQVTQVDPGGAVWRYDYDQRGNLLTTDPTGAVTRYLRDERGNLVGKT. 712
187 3.000e-24UniRef50_A0A139KM77 Uncharacterized protein n=11 Tax=Bacteroides TaxID=816 RepID=A0A139KM77_9BACE  ali  50  31......................................SYEYSIVNQEKKTVKKDILGNTIIEDDNGNKITIKKDILGNTIIEDNNGNKKTIKEDILGNTIIEDNNGNRKTVKKDILGNTIIEDNNGHKKTIKEDIFGNTIIEDNNGHKKTIKEDIFGNTIIEDDNGNKKTIKKDIFGNTIIEDNKGHKQIIKKDIFGSSTIED......................................... 196
188 4.000e-24UniRef50_A0A2B8APL8 Uncharacterized protein n=1 Tax=Streptomyces sp. Ru87 TaxID=2044307 RepID=A0A2B8APL8_9ACTN  ali  13  394..............................TFDGGGRLTSWKDDAGIGLSFAYTDGDLSSVTDGAGNTIRFTVDASHLLTDVELPGGRSIAYGYTSGQLTSVKGTDGGTVVYGY-EAGRLASTDAAGHVMETSYDGSGRVTQTDAAGKTTKYTR-ATLETSYEDGNGGIWTDLYHGSLLRSRIDPLGNVTSFTYDANRRLTAMDARGNHTRMTYDDRGNLRTRVEGALTQAWTYDAEGNIETYT. 610
189 4.000e-24UniRef50_A0A1I5WIR3 RHS repeat-associated core domain-containing protein n=2 Tax=Ralstonia sp. NFACC01 TaxID=1566294 RepID=A0A1I5WIR3_9RALS  ali  12 1306.VTDRNGKIATFSYDGLSRRTAAADATVSYTYDAGNRITQVVDSVGGVSRSYDSLDRLTSETAPKGSV-SYGYDAASRRTNMTVAGQTAVSYAYDNANRLTGITQGGAQVGFTYDAGNRRSSTLPNGVVASYTYDVAGQLTAIDAGGRRIQMAYDANNRLTSYDANGNTLTYAYDAVGRRNTKTIGSTTTAFMYDALGNTVALTDSTGTTSYGYEPYG........................... 1644
190 4.000e-24UniRef50_UPI000A19D35C hypothetical protein n=1 Tax=unicellular cyanobacterium SU2 TaxID=1981054 RepID=UPI000A19D35C  ali  13 2634...DPNGGQTTYTYNPVGNLITANGVTETRDYDLLNRLTYLENRNGSYTYTLDAVGYRIKVEEADGTVVEYDYDDLYRLTQETDPDNQTIEYRYDPVGNLQRIDSQEGTTTYSYDANDRLLWEVMGGDVTEYEYDDNGNLTARVVNGGRIEYEYNTDGIRVGIIVNGEETRFEYDSNGQISLTDINGELISYEYDAYGNLTE........................................... 2916
191 4.000e-24UniRef50_A0A2A6RKH0 Uncharacterized protein n=1 Tax=Chloroflexi bacterium Kir15-3F TaxID=2024553 RepID=A0A2A6RKH0_9CHLR  ali  10 1409.....GSSVARY-YDGNGNLIDSSG-VTDFSYDARNRKTSETSGYGTVAFHYDAANNEVALTYPDGRILQKSYYRNNWLHEVTTPAGSVTTQSYDAANNLLSVEPNGRLISYSYDAANQRTERDSVGVIVSYSYDAAGNRTSDDPRTNKLRYHYDAADQLIRMEDNRHSVHYRYDANGNRIEREAPREAMRYTYDSENRLIAAQAPGEITTMAYDGIGRRVAKSVDNKTRTYAY........... 1725
192 4.000e-24UniRef50_A0A2H3KTD9 Uncharacterized protein n=2 Tax=Candidatus Chloroploca asiatica TaxID=1506545 RepID=A0A2H3KTD9_9CHLR  ali  21  922................................................................................TVTYGDGRTARFTWDASGRLTITDRNGNVTTLGYTGQNLTSITAPDGRALALSYNASGQLIAVDPLGRSATFSYDASGNLASASDLGGVTTYTYDAAGHITVTDPRGSTTTYRYDPELRLIAETNLGQTETYTWDAFNNRTVIDRRGNTTTFTYDDRGNLLTMT. 1168
193 7.000e-24UniRef50_A0A2C3K4M6 Wall-associated protein n=1 Tax=Bacillus sp. AFS029533 TaxID=2033494 RepID=A0A2C3K4M6_9BACI  ali  14 1046............................................................ITDAYGAKHIYTYGSYNRPTLIKNTDGTFTKYIFNLTNNKISKDKNDNIVVYQFDTNNRLISIDPTNRVTNFGYDTNGKLTVKDYIGRNWYYTYDANGNLIVTDPLNHSESYTYDPSHQLSITNARENTTNFTYTSNKLTAVMDPLNYKTAYSYDGTNEFTETDAKGNITKYAYDALNNVTSYTY 1262
194 7.000e-24UniRef50_A0A0A0DN72 Uncharacterized protein n=2 Tax=Alkalispirochaeta odontotermitis TaxID=1329640 RepID=A0A0A0DN72_9SPIO  ali  11 1120...........YEYNMAGLLVSPDGSRIDYQRDVLGRVIEITTPDGTTSYEYDAVGNLVSVVDPLGGETTFTYNEVNRLLSRTLPNGIVSQYSYDTLDMTTRIDSLGNVISYGYDNALRVIAADVLRTSITYSYDESGKRLTRSVDNAVTNYEHTSGYQLDATTGAYNEL-FNYDADGRLSNFSRDGSQWTLQYNPLDQLVSESDSGISISYQLNAMGHRTQAVTAGNQRNF............. 1381
195 7.000e-24UniRef50_UPI000DE4ACB7 hypothetical protein n=1 Tax=Pedobacter sp. CM134L-2 TaxID=2233776 RepID=UPI000DE4ACB7  ali  38  70..........................................DGSGRTIAKFKRDIFGNDIIEDGNGRTQFKKDIFGNTIIEDGNGKTLAKYGKDIFGNTIVEDGSGKTKKFSKDIFGNDVIESANGSKQIYKKDIFGNTVVENERGESAKYKKDIFGNDIVENGRGEVQLIRKDIFGNTILEDGKGNVLKFKKDIFGNEVVEDSSGRVIRYKKDFSGNQIVEDGNGNKITYKIDFSGNMVFEAY 280
196 8.000e-24UniRef50_A0A2V7D3A5 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V7D3A5_9BACT  ali  13 1290..TDRKSQVTSTTYDGLDQVTYQDGSTISYTWDAGNRVTQVVDSLGGTTRTYDGLDRLTSETTPEGSV-SYTYDTNGRRTGMTVNGQPAITYAYDNADRLTSITPSGVITSYAYDAASRLAATYNAANRQTLTYDLNGNLTS----DGTSTYTWDARDRLTALAGPNPA-SFVYDGAGRRRARTIGGTTTNVLHDGLNNLLTTRDDGAGTTYTYDPFGTTSITGSPGNALSYT............ 1630
197 1.000e-23UniRef50_E3J3S7 YD repeat-containing protein n=1 Tax=Frankia inefficax (strain DSM 45817 / CECT 9037 / EuI1c) TaxID=298654 RepID=E3J3S7_FRAIE  ali  17  480....................................................DEAGRYTILDAAAGHSYLFAIPADGQLAAVVDRNGNRIELGYDADGELVRTDAEGEQTRYGYDATGQLTVVNSSGRALRFDYDPDGRIVRLDRNGTEYRYTYDATGRVVRTDPLGRVTAFGWDRFDNRTVTDPLGRTIRYRYDDIGNLTVERPDGTQTTTTWNAQRRLVSVDANGARWEREYDTRGNLAAV.. 750
198 1.000e-23UniRef50_A0A151DTC7 Uncharacterized protein n=1 Tax=Streptomyces sp. CC71 TaxID=1770211 RepID=A0A151DTC7_9ACTN  ali  12  453.....NGRTTTYSYDAAGRRTTPSGAVSRWSYDDFGNRTGLATFDRHLSFTYDAAGREVARRFGDHAVLEQSYDSAGRLERVVGSNNSVVTFAYRADGYLVSTDRLNGNRDYDVDPLGRVTGVRAADWSESYGYDAAGNQASRDYVGTRVRYEHDAAGRITVKTRLSRIWRYTWDVEDRLTVVTPDGTRWQYRYDPLGRRIAKERLDATT................................... 694
199 1.000e-23UniRef50_UPI000B4B72C9 hypothetical protein n=1 Tax=Clostridium sp. link-BC1 TaxID=1799534 RepID=UPI000B4B72C9  ali  13 1186.VTYPNKNITIYEYDSLNRLTNIVNK------DSDGIVIS--------SFEYTPVGNCLEVVENTGRIVEYRYDDTYKLLKITLPDGSEVSYKYDGVGNRIEKNDNGIITKYGYDNNNRMITE----GEKTYKYDANGNVVSVDPVGMSISYSYDYNDRLQAIDGTENVL-YEYSVEGIRVSKTVNGQKIYYEWDAEGNLISQNRKGIISYYIYDGRNSRILTDSTGKVTTYTYNAFGELLQNT. 1441
200 1.000e-23UniRef50_G2NWU1 RHS repeat-associated core domain-containing protein n=13 Tax=Streptomyces TaxID=1883 RepID=G2NWU1_STRVO  ali  904.....NGRTTRYLYDAVGRRTTPSGLTSAWTYDEAGRPTARTGTAGTLTFVYDAAGRETERRVGEAVRLTQTWDTADRLTTQTIGEGRASSYAYRADGYLTEIDPVGRVTTYAYDSAGNLTTIVHRAGRTTYEHDTQGRLTRRNGQTRTWAYTWNAEDRLTAMTPDGDHWHYIYDPLGRRISKQADDGTIAFTWEDTRLAEQSTPEGVHTTWDY............................... 1175
201 1.000e-23UniRef50_A0A2I0BLZ0 YD repeat-containing protein n=2 Tax=Microcella sp. HL-107 TaxID=2035245 RepID=A0A2I0BLZ0_9MICO  ali  16  515...................VVRGDGASVVFDSDGAGGYTA--DADVHESLAESGMGRLT-LTAPSGERWVF--DAAGELVSYRDALGQGYTLAYDADDRFVITDMAGQTITVTKNAAGQITLTHPDGRTWSLGYGTGGDLVSTNPDGRERTFTYDGAHRLTATDAGGGRVTRQWDADGNLVYTNNEGHDTVYEWDEFARVTSTDAEGATERFEYDGAGNVTAIDALGFTTSYGYDGDGNLTRET. 777
202 2.000e-23UniRef50_A0A1Q5G1F0 Type IV secretion protein Rhs n=7 Tax=Streptomyces TaxID=1883 RepID=A0A1Q5G1F0_9ACTN  ali  12 1038....ADGRVTTYTYDELGRRTTPTGQRTRYAYDSSDRLTELISGSRTIAFTHDLAGRELSVWDDAGNRRSYTYDADDRLTAVDDTLRGMSRFTLDAVGRVVSVDADGNQTRFEHDALGRVTSRKPD--TWRYTWDVEDRLTVTTPDDITWLYRYDPLGRRTSKDPTGEEIRFSWD...................................................................... 1290
203 2.000e-23UniRef50_UPI000930BC14 type IV secretion protein Rhs n=1 Tax=Listeria monocytogenes TaxID=1639 RepID=UPI000930BC14  ali  18  878.....................................................ANGLLLKVTSKDGNATNYTYNADGELVKMVTCSGKVLQYTWDADGHLKEIVPDGGKLAYSYDDDGNLTKVDQTGKAITYQYDSEHHMTSKDHNGKLIKNTFDADGRVTQTDGEGNTATLKY-EKGKTTTTDFNGNKKVVYFNERFQTTKTYADDTTTENKYDDKHQLVSIDQLGNTTTFENDANGNLTKTVY 1075
204 2.000e-23UniRef50_A0A2U1RNN9 Uncharacterized protein n=1 Tax=candidate division NC10 bacterium TaxID=2072417 RepID=A0A2U1RNN9_9BACT  ali  15 1522....ADGSSTSFTYDAAGRLLDSIGGTILHEYDTLDRLTTQYDALGRVSYTYDAASRLRTITQAPLNPASIDYDTLGRRTNLTLPNGVSTEYQYDAASRLTAYDPAGNRITMTYDANGNLTSITDPNGLATFTWDARNRLVGLAGPDATASFVYDAFGRRVVKQINGSATQYLYDGLDLRTLTDGLGSTVQYAYDPFGTTSSTNPA....................................... 1837
205 2.000e-23UniRef50_A0A1C5HSN0 RHS repeat-associated core domain-containing protein n=4 Tax=Micromonospora TaxID=1873 RepID=A0A1C5HSN0_9ACTN  ali  13 2666..TFIGYGVTRFSYDTLDRLTDSTGGLLTLGWNDLDQVVTVTGPTGTVGYGYDAAGRRSAMTVPGQPAISYSYDQTG-LIEQITQGGTTATWHRDAAGRTTRVDQAGITARYAYDAASQLTYETTGGGDLRYGYDGTGRVALTGSLAQVTTASYDAANRLTGRDDEGNLTGYTWNARGELTGVTGPGLATAYGYDPAGRLASRTAAGATTTFGYDAADRLTVTDPLGSTTRYAYDPFG....... 2978
206 2.000e-23UniRef50_F8X024 Uncharacterized protein n=3 Tax=Dysgonomonas TaxID=156973 RepID=F8X024_9BACT  ali  33  1................................................MKRIYIILVSALISMSLYSQPGRDREVRKDFS----MDQYQSNISRDIFGYLQYEDSRGKRASLKKDVFDNWIYSDNRNNEVKYSKEYWS-SILQDFHQNDKRIKVDIFGYQQYENNKGQRASLKKDIFDAWVYSDSRNNEIKYSKEYREDDMCENPSNYKEEYKIDIFGYQQYQNNQGEKASLKKDIFDRMVYED. 226
207 3.000e-23UniRef50_UPI000994E82F hypothetical protein n=1 Tax=Bacillus alkalinitrilicus TaxID=427920 RepID=UPI000994E82F  ali  19  524...........................................................SFTLEHNNGEKYEFNADGQLVQKYNSYQQVLNYSYNESGQLTSVTESGQQLHFSYNNAGLLTTVDPEQNSIAFTYNEVRQVTATDSNGKQIQFEYDEDGRLVTTDRKGNQTIFTYNNLYQLSRTDELGNTKRFEYDSHGNKVKEDEGGNLTTFSYDDRGNVTSTDALGRTTKMTYDARNNLLSV.. 762
208 4.000e-23UniRef50_A0A2V9E5B9 Uncharacterized protein (Fragment) n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9E5B9_9BACT  ali  14 1146......NFATSYGYDAASNRTDPENGATSYVYDTLNRLQTLTPPTGNFGFTYDTLSRRTQMTRPNGLKSVYAYDNLSRLQSVLHQSGSTTSYTVDNAGNRTSTDQLAGVTSYTYDPVGNRLSVSPYSVNTSNEYDSNGNTLTKVVGSNTTSYAWDFENRMSSVTGTGGTVSFKYDPFGRRIYKSSSTATSVYAYDGDNLVEETNSSGGATSYFHDGLGSVTSLSNAAGSITYTYDSFGKLTAST. 1457
209 4.000e-23UniRef50_A0A2K9EI02 tRNA3(Ser)-specific nuclease WapA n=3 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9EI02_9FIRM  ali  13  220.VTDPDGGVTTYIYDEVGNRTYPNGTKMLYTYDELNRLVELVDANGEIISSYGPAGSRIKIEEHTGRVIEYEYDNTYKLLKETNPDGREISYTYDAVGNLTKTD-DGNTVNYTYDENNRLISEDNNGNTLSYTYGYDNRLVSTNQTGTSTEYVYDVDGRVGKIVDDAKFSRYTVDKNGKLIVTNSNGEVTTYTYDAFGNLIEKTGDTNEFLYTYDAN............................ 518
210 4.000e-23UniRef50_E0ULS3 YD repeat protein n=1 Tax=Cyanothece sp. (strain PCC 7822) TaxID=497965 RepID=E0ULS3_CYAP2  ali  17 6460..TDLGNAIYTYAYDGLTQIISPTGETRKYSYDDLGNLTITYDNNTVKQLEYGNDNRLVKVTLPNGETLTYQYDEAGNVTSQVISTGETIETTYTTSGSIATSKNAAGTITYHYDTNGNLQIEYPNGSSIFYERDVLGRVTTETASGSITRYTYDEVGNLTITDPTGG............................................................................. 6636
211 5.000e-23UniRef50_UPI000691A8FE hypothetical protein n=1 Tax=Catenuloplanes japonicus TaxID=33876 RepID=UPI000691A8FE  ali  12  619..TDFDGRTVTYGYDLDGRLIDAGGRVTSYTYDAAGRLLTAESGTARLARSYDAAGRLLSET-ADGRTITFTYDAAGRRLTRTTPSGVVSQWRYDAAGRQIESVLGANTLRTAHDPAGRIIARTPDGLVTRYAYDVTGNVTSADARGGRYRYEHDAAGRVILRQRARHTWHYTWNSEDRLAVRTPDGTIWSYRYDPMGRRTAKYEDGSVTDFVWD--GNRTAEEPAGSTTTWEY........... 968
212 5.000e-23UniRef50_A0A080JYE9 Rhs family protein (Fragment) n=3 Tax=Snodgrassella alvi TaxID=1196083 RepID=A0A080JYE9_9NEIS  ali  2227.ITAIDGSVTSFEYDKVGNRTRSNGTQSVMTYNKANQLTSITHQKGSKVYTLDENGRRTQVIDGVQRSVSYQYDVTGKLLAETAGQRNSMAYTYDAMGNRLTKVANGITTHYSYNSNDQLISETTADVTTSYAWDNNGNLIKKTSPEGEISYSWSSSNKLIAIDDQVNRRQVSY....................................................................... 2413
213 5.000e-23UniRef50_A0A1W1WZS3 RHS repeat-associated core domain-containing protein n=2 Tax=Andreprevotia TaxID=397275 RepID=A0A1W1WZS3_9NEIS  ali  13 2085.ITRPNGTKTVYMRDVNGRLTTVLGGTTRNDYDTLGNDGKLANPARSIGYQYDSLNRLTQETPSRNRTTDYTYDAVGNRTLTTTGGTTSKAYDYDERDRLKTITTNGTVTTYSWDNNGNLLQKTALGSVTKYGWDARNRLTQKDAQHLTTAYQYDDNGRVSKTDKDGKTTSYLIDAYAQAVQETCNGQSTNYVY--GDQLLQQSKAGQSSYYEADGLGQL--TDASGSVTEYEYSAFG....... 2363
214 5.000e-23UniRef50_UPI000D784091 RHS repeat protein n=2 Tax=Butyricicoccus sp. GAM44 TaxID=2109686 RepID=UPI000D784091  ali  13  374..............DGSYRMTHEDGAAFIFSNDGKGKLQTVYNPDGTQVATYNGNGHISSVTDNAGRTVSYEHDNDL-LTGVTNADGDTLHYTYDGNGYLSATDFEGEVIENEYDGIGRVVKQTDIPTVSTVSYDDDARVTTVDANGLETRYYYDNHRNITVIDGTEYTTNNTYDGDYRASASDRLNGATAYEYDSSGNVTVRYADNTTMTLTYTAGGDIASTDALGNTETYTYDKNGHTTSYTY 647
215 5.000e-23UniRef50_A0A1F7LGA0 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium GWA2_73_35 TaxID=1802096 RepID=A0A1F7LGA0_9BACT  ali  15  644.VTDARGNATSHTYDLMDRRTDPLGAGESFGYDPAGNLTQRTDRKGQVSFTYNALNRLTTSSYADGLGTSFAYDAAGRLVRIDDSIGGTLTNSYDVLDRLLQYDALGRRTTYTYDANSRLTQIDDAGRRTTYQYDPAGNRTQVDPNGNTTTFTWDARDRLIAVEQPGTLASFAY-AFGRRLAKTVNGVSTQFLYDDLNQLTLTDPAGTTTEYTYEPFGRTTATNP.................... 1022
216 6.000e-23UniRef50_I5AXE2 Rhs family protein n=1 Tax=[Eubacterium] cellulosolvens 6 TaxID=633697 RepID=I5AXE2_EUBCE  ali  14  185.....................DELGGVRGWRHNFESRLVR----DNNTVYVTDEDGNIQSLKSDDGYEIRFFH-ENGNLVRACDNFSNSYEYQYDENGNLIQVDQGGRQVAFGY-AEGKLTSTDPNGDVLTFSYDKEGRLEEVRQPDGTIKNHYDDRNRVTIQDPDGTSTSFEYDEEKNVTQILQDGSRSVYQKDDRARIVSVTDADGTESYTYNDRNRLSETDRRGARTEYAYDSFGNI..... 453
217 1.000e-22UniRef50_A0A2V9GLZ5 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9GLZ5_9BACT  ali  14 2460......NFATSYGYDAASNRTDPENGATSYVYDTLNRLQTLTPPTGNFGFTYDTLSRRTQMTRPNGLKSVYAYDNLSRLQSVLHQSGSTTSYTVDNAGNRTSTDQLAGVTSYTYDPVGNRLSVSPYSVNTSNELDSNGNTLTKVVGSNTTSYAWDFENRMSSVTGTGGTVSFKYDPFGRRIYKSSSTATSVYAYDGDNLVEETNSSGGATSYFHDGLGSVTSLSNAAGSITYTYDSFGKLTAST. 2771
218 2.000e-22UniRef50_A0A2S4DB13 Uncharacterized protein n=1 Tax=Candidatus Entotheonella serta TaxID=1652106 RepID=A0A2S4DB13_9BACT  ali  10  668.TTDPWGITLSHTYDPKGNRLSPL---TRYGYDALGRLTHTTYPQGRTQKRYDRAGRVIDIERALIARYTYSYDKSGNRTQE-------------------ARTRSGHTTTYDFDAVDRLTTVHTPEHTTRYTYDATSNRLSESKTGGTWTFHYNPRHQVTEVTDPTATTTFSYDASGNRTEQRQGSHTTRYIFDARHHLRQMTRGGSSLEFLYDWQGMRVRLRTPSDTRHYVYDGA........ 905
219 2.000e-22UniRef50_UPI0009D68F49 sugar-binding protein n=2 Tax=Verrucomicrobium spinosum TaxID=2736 RepID=UPI0009D68F49  ali  10 2310......GLTHTYTYDLGGRRTGSTGKTIATTYDSQGKPLTVTEGGRTTVYHYDLASRAVAQTQPNGLWQYNAYDDLGRLESRQDALQAQFLWTYDAVGNVTVQDATNRTTGYAYDTSSNLVSTDGSLTTQTYTYNHFNQLTEEDGLGAVTRTTYDLAGNRTLTTAEQQTTTYHWDAENRLEVTLPNAEEHEYGYDYRTRRISRVENG...................................... 2570
220 2.000e-22UniRef50_A0A1B1N1L9 Uncharacterized protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A1B1N1L9_9BACL  ali  15 1039...DANGRITTRSYDAAGQVTDTFGNTLRYAYDASGRLTELTYPDGKVHYRYNAAGELSEVKDWRGRLTRYRYDQSGKLIETNRPNGSREKRSYDVAGQLIRYNEIGQIIQYTYDQFRRLSSGSSRGRITRYAYDLGGNLTESDADGNKARYTYNALGSRTSLTWRGKTTHYVVDEQGELSREDADGNYVSYHSDIRGSTTLTDEQGCVTRYTY............................... 1364
221 3.000e-22UniRef50_A0A2N1PIP4 Uncharacterized protein n=2 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PIP4_9BACT  ali  12 1384.........WSYSYDLMGNRISPENETFTYRYDNLYRLSELNTGKSSITYAYDALGRNIEEKRVD-STTANTFDAAGQLLVMKNADTSKVQYSYDPAGNRISMDEAGNNTVYSYDDSNWLTVVYPNADVVAYTYNGAGRLTEQHNQDVAVTYSYDAAGRMTGK----GDEAFEYDADGNMLS----DNTSFYTWNSDNRLIQV.......................................... 1583
222 3.000e-22UniRef50_UPI00040A19A8 tandem-95 repeat protein n=1 Tax=Haliea salexigens TaxID=287487 RepID=UPI00040A19A8  ali  14 3115.IDELDGRSTSYSYDDLYRLTAE-------------NVTDAVNGDYNASYQYDAVGNRTSVID--GVTTAYSYDANDRLTQ----QGGST-YTYDANGNTLTETLDGDVTSYTYNAKDRLVAVEQGGDTTSFAYDHNGIRNARTEFGVTTDLVIDVNRQVVEEVTAGASYSYGHD----LLSQERGGADSYYHYDGLGRLL-TDELGGVTD-EYD.............................. 3311
223 4.000e-22UniRef50_UPI0004855F9D hypothetical protein n=1 Tax=Cellulomonas sp. URHD0024 TaxID=1302620 RepID=UPI0004855F9D  ali  11  953.VTD-GSGTTTYSYDALGRRTGVTQNTVGYTYNAVGQVTALAYPTGTVGYAYDDAGQLTTVTDTAGGTYSYAWTADGQIASLTYPNGVITSNEHDATGKVTTVNQAGTTQSYVWDPQARIAAITGD-RAATFSFDTADRLT---ALGDGRTLSYNAAGQATLTDPTANVMNFGYDERGNRTTTTVTGTTSTAAYNLADQLTHLSADGTQIDYTYDAAGRASATNDDGAGTTYTWD.......... 1233
224 5.000e-22UniRef50_A1AK54 YD repeat protein n=2 Tax=Pelobacter propionicus TaxID=29543 RepID=A1AK54_PELPD  ali  18  836.....NNGTLKYEYDPAGNRTTPEGERISYRYDAANHLTAIVSPRGTFDITYNDLGRRTKLSYPNGATISYRYDNSERLVKLKTRHGRTISYTLDRVGNRLSTTEANATTNYGYDAIYRLLSYDPVGNRLSFTYDKNGNLAERDQHGHSWKYTFDYENRLVKAENGAVNVSFAYDPFGRRIEKDVEEGITRYLYDGM-NLIRETRAGRSETISYDGLGSIVATDRHGTVVEYNYDSFGN...... 1167
225 5.000e-22UniRef50_A0A174BRD5 Cell wall-associated polypeptide CWBP200 n=3 Tax=Clostridiales TaxID=186802 RepID=A0A174BRD5_9FIRM  ali  13  615............................................RNGTVYDFSDNGLLERISYLDGNTISLSYNGD-QLTRISNDTGSF-ALSYNSEGNLTVTDSTGRSILLSYDGDSLISAENPDGDSLRYTYENGLLATVQNFKGEVVENTYDSEGRVIHQYAADGTFDFTYDPENRRTSTGSDGYYLSIVYDELGRIIESTNENGTQKFSYDELNRVSETDREGNTTYYEHDNNGNISAITY 818
226 8.000e-22UniRef50_A0A2V6X9R7 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6X9R7_9BACT  ali  14 1544...DRNGRATTHRYDELDRRTYADGSVTTFAYDAADRAVVATDAAGTVVHEYDRLDRLAGVQTALGAV-SYGYDALGRRLTRVETGGQIVELGYDHAGRLTTVTPNGIVKELAYDEASRLVARDAGGNVTRLTFDAEGNTTSITDDTGTSTLQWDSRNRLVALTGPTVEASFSYDVFGRRVRKTLNGATTHYLYDGLGTVIGTSNAAGVVTTQY............................... 1863
227 8.000e-22UniRef50_A0A1H0WVC9 YD repeat-containing protein (Fragment) n=1 Tax=Acidovorax cattleyae TaxID=80868 RepID=A0A1H0WVC9_9BURK  ali  16  355...............................YDARGRLVRLVLPRGATVRHHEGGGWSIEATDGLGNAVRYAYDAIGRPLGLTDSAGRQLRFEWDLRANLVEADALGGTARYRYDAGGRVVRTTPGLLDTRFDYDLGRRTTVTDALGRRSSYEYNAAGRPVRTDALGRTTRWRFDARGNLTMTDAAGATTRLAYDHLDMPVAINALGHVWRQRYDERGNLARVDPLGHATRWRYDARGLPVAI.. 709
228 1.000e-21UniRef50_UPI0009E7A4E3 hypothetical protein n=1 Tax=Clostridiales bacterium MCWD3 TaxID=1766203 RepID=UPI0009E7A4E3  ali  14 2479..TDESGYTISYKYDAVGNLIYPDGKKVNYTYDAVGNMISVTDWNARKTYEYDENNRLVKTTHSDGSSESRSYNINGQLITLKNANGETINNEYDAVNNVIKE---GNI-QYSYDELERLTKASNLNNEIQYNYDIGGNITSVDADGNMISFEYDSQNRLTST----GDISYGYNAENIRTSTDDNGNVITYHYDRRGSTVATDETGKVVQYSYLPYGKIITQDSDD.................. 2807
229 1.000e-21UniRef50_R7FTU3 RHS repeat-associated core domain protein n=1 Tax=Eubacterium sp. CAG:841 TaxID=1262894 RepID=R7FTU3_9FIRM  ali  15  453..................RCTSADKKEYILTTDNSGQYPYIIDCNSTKTEYYDAKGRIAKITDHQGFETLISYSDS--LITITDCVSGKRIYIYDDASRLTYTDANGNKLFYEYDDEGRVKKGTDSKGICYFTYDEYGRVSQKDALSNKTLFTYDGNKR-ISTNRDGKQSIREYNDEGLLVVTDENGKNTSYEYDSSYNIVETDAKGNSVVKQYNSSNKPTITDKNGNKTVITYDGKGNVAKICY 704
230 1.000e-21UniRef50_A0A1C4UQP2 RHS repeat-associated core domain-containing protein n=1 Tax=Micromonospora tulbaghiae TaxID=479978 RepID=A0A1C4UQP2_9ACTN  ali  10 5036.....NGRTVRTSYTASGARTTPSGRSSRWTFDADGRPESLTDDAGREIQTFDAAGRLTGQHVADGAERRYTYDAADRVTAIADSLAGDLAFTADDTGRIRAVDGD-APQRYDYDEAGNLV--GAGGGRWEFT----GTMLVRSDDAR---FSYDAKGRLTGRVDDAGAWRFQWDVEDRVLAVTPGGDRWRYRYDGFGRRIAKQRLG...................................... 5252
231 1.000e-21UniRef50_D9T0D2 YD repeat protein n=9 Tax=Micromonospora TaxID=1873 RepID=D9T0D2_MICAI  ali  11 5043.....NGRTVRTSYTASGARTTPSGRSSRWTFDAAGRPESLTDDAGREIQTFDAAGRLTGQHIADAAERRYTYDAADRVTAIADSLAGDQSFTADDTGRIRAVDGD-VPQRYDYDEAGNLV--GAGGGRWEFT----GTMLVRSDDA---TFSYDAKGRLTGRVDDAGAWRFEWDAEDRVLAVTPGGDRWRYRYDGFGRRIAKQRLG...................................... 5259
232 2.000e-21UniRef50_UPI0009DBFB82 RHS repeat protein n=2 Tax=Actinomadura flavalba TaxID=1120938 RepID=UPI0009DBFB82  ali  12  699.....NGRTVRSAYDVDGNRVRPSGAEAAWSYDAAGRATGVTADGGTVALEYDAAGREVRRRIGAGAALAQQWDGGHRLVAQSAPDGRHRTYRYDRAGRVTAVHARGWSERYAYDAVGRVTSADDGDGRVHLEYDAQGRVVARRRTGRTWTFGWDADDRLTTVTPDGTRWRYRYDPLGRRIAKQRLGTQTDFTWD--GPLLVETPVTRVTSWGY............................... 970
233 2.000e-21UniRef50_UPI00093DDE30 sugar-binding protein n=1 Tax=Micromonospora sp. TSRI0369 TaxID=1703936 RepID=UPI00093DDE30  ali  12 5329.....NGRTVHTSYTDSGARTTPSGRSSRWTFDAAGRPERLTDDAGREIQTFDAAGRLTGQHIADAAERRYSYDAADRVTAIADSLAGDQSFTADDTGRIRAVDGD-VPQRYDYDEAGNLV--GAGGGRWEFT----GTMLVRSDDA---TFSYDAKGRLTRVDAAGA-WRFEWDAEDRLVAVTPGGDRWRYRYDGFGRRIAKQRLG...................................... 5545
234 2.000e-21UniRef50_UPI000263001D hypothetical protein n=1 Tax=Bacteroides TaxID=816 RepID=UPI000263001D  ali  39  10..........SVTLLPNQYRLFHIINYEFYLFC-IFPYYFCHKPKQHVIKKILLILIAAQFIIAPQIIKGSGAN---NSHEYIEVNPKKRKLSRKTFWEILL............................................................................................................................................... 97
235 3.000e-21UniRef50_UPI0003720519 hypothetical protein n=1 Tax=Synechococcus sp. PCC 7336 TaxID=195250 RepID=UPI0003720519  ali  17 5004......................................................................YRIDAVGDLLTVEDRNGNQLSFS--DDGIVSST---GQSVGFERNAQGRIVSIDPAGQRIQYEYDAAGDLVVTDRENNTSRYDYSEERLEEITDPLGRTIRSEYDEAGRLNRVLGSGQSVQIAYDPDNSLTVTDALGRATTYVYDDRGNLTEINPLLGETIRTYDQDNNLLSLT. 5182
236 3.000e-21UniRef50_A0A1G8VC53 Intein N-terminal splicing region/RHS repeat-associated core domain-containing protein (Fragment) n=1 Tax=Lachnospiraceae bacteri  ali  14 2256........................GGVIKNFY-SDGKLSQIVSSEKQTISISYNGNNTVIKEDISGKTITAVHNGSGLVSELHDSAGRVTFLSYDENSNLAIVRPDNTTLRYAYDEKHRIVQASNANGVVTNEYDDNNRVVETNANNVSASYIYDLNGNLREKDPYNNVIEREYDQNNNMVKVTDKGRVTTLSYDSRGNVTGVGSDGASAYYSYDLNNHLVSTDASGLTTSYTYNSSGQMTSET. 2526
237 3.000e-21UniRef50_A0A1Y2N431 Putative deoxyribonuclease RhsC n=17 Tax=Streptomyces TaxID=1883 RepID=A0A1Y2N431_STRPT  ali  1040.....NGRTMTFTYDALGRRTSPTGHATTYTYDAAGNRTAM-DIAGHVTFEHDAAGQERTRTDPTGRLTSYTYRPDGHLTAIEDSHTGRRTFDLDRAGRVTAVHAADWTETYAYDEAGNQTRHTSPSARGDRTYTG----TRITKAGRI-RYEHDALGRVTRVSRKPDTWHYTWNAEDRLTVVTPDGTAWRYLYDPFGRRIAKQRLTSEIR.................................. 1301
238 4.000e-21UniRef50_U2T4D1 YD repeat protein (3 repeats) n=2 Tax=Olsenella profusa TaxID=138595 RepID=U2T4D1_9ACTN  ali  12  363...........................TEFLFDAEGTLVRMVDVDGGADLAYDESGLLERVVSVSGERLDFHH-EGGLLVRVSDATGRSIGLEHEGALLVALTDELGHTRRYGYDHLGRMASTNPRGEVTRNAYDEHGRVARQAANGAEITYRFDELGHLTLVDQEGHESSYESDGLYRTVYTRPDG-TERFEYDRRNLKTATSRLGHTTRFRYDRAGRRSITNAAGQTLAFERNEMGR...... 580
239 5.000e-21UniRef50_A0A2W6CXL6 Uncharacterized protein (Fragment) n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6CXL6_9PSEU  ali  13  9............................RWEFDAEGLPVRVMDGPGTQVRFVHEQGRLVGLVHKGGKRLSLGWDGE-RITELACSDGRRVAYRYDEAGGLIEADGGGGVRRYELDAQGRVLAVDADGVVERNTYDADGRVLQVSAHGRRSRMRY-LPGHVTVVDDEDGVNTYLHDEHGRLIVVDGHGAELTKMYDEWGNPTTTDRNGAVTVQEWDERARLVRTEPSGAVFRSSYDESDRLLEV.. 230
240 6.000e-21UniRef50_A0A0E0UZK4 Uncharacterized protein n=1 Tax=Listeria monocytogenes serotype 4a (strain M7) TaxID=1030009 RepID=A0A0E0UZK4_LISMM  ali  18  24.....................................................ANGLLLKVTSKDGNATNYTYNADGELVKMITGSGKILQYTWDADGHLKEIVPDGGKLAYSYDDDGNLTKVDQTGKAITYQYDSEHHMTSKDHNGKLIKNTFDADGRVTQTDGEGNTATLKY-EKGKTTTTDFNGNKKVVYFNERFQTTKTYADDTTTENKYDKHQLVASIDQLGNTTTFENDANGNLTKTVY 221
241 6.000e-21UniRef50_A0A2H0YDK5 Uncharacterized protein (Fragment) n=1 Tax=Nitrospirae bacterium CG08_land_8_20_14_0_20_52_24 TaxID=1974068 RepID=A0A2H0YDK5_9BAC  ali  13 1064.VVDAKGQTTTYTYDKVATMTDQLGRSETYIYDANDNLVSFIDRKGQVTFSYDSKNRIERVDYADGSFTTYTYDAVGRLIQEIAPLG-SISYEYDVLGRRTKMDANNRLESFGYDALGRRTSTYPNGITTSYLYNVNGARSRMDRANNTYTMTYDENGNMXKSDCSPLTASFKYDALGRRIEKTMNGKTIQYLYDGSDPLARIQSDGMIRYYQQDALGSVIVTDESGNVTTYSYDPFGHVT.... 1462
242 7.000e-21UniRef50_R1G8T6 Uncharacterized protein (Fragment) n=1 Tax=Amycolatopsis vancoresmycina DSM 44592 TaxID=1292037 RepID=R1G8T6_9PSEU  ali  12  837.VTNEQGLVWHYRYDPAGNLTDFNGRTLQYRYDAAGQLIGRTNGAGETTTAYDEAGRMVSARNAD-AEVTFAYDALGRVVAETV-DGRVVRSEYDELGRRARHTPSGAVSRFEYGPAGRLVAQTVAGTRTTYGYLADGYLASVDAITGPRTFQVDRSGRVQAVVGRGWQENYVYHQTGRGTLLTAAGAV-RYAHDPEGRTTLRGPSGPQWQFRWTAESRLSVLTPRGEHWRYRYDALGRRVAK.. 1181
243 7.000e-21UniRef50_UPI0006A6CFAE uncharacterized protein DDB_G0290685-like n=1 Tax=Brassica oleracea var. oleracea TaxID=109376 RepID=UPI0006A6CFAE  ali  25  293...............................................................TDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESETDDGGDKESER........... 463
244 8.000e-21UniRef50_UPI0009EED39E PASTA domain-containing protein n=1 Tax=Methylomonas koyamae TaxID=702114 RepID=UPI0009EED39E  ali  13 1855...DRNGRKTTYAYDAKNRQVAANGAVTSMAYDAVGHLLSVADPDSRLSYSYDGNGQLLTARDNYGVQVASEYDAKGAIVAHIDPAG--IQYTRNARGNKTTVDASGADYRYQYNPAAQLTSAQHHGNGTTYGYDATDQLLSYDPNGNRKTYSYDNEGNRLSKTATGEVTLYDWDYRNRLVRASANGAVLSYRYDANNRRIARIVDGVAEGTLYDGDNAWLDTDANGAITT.............. 2201
245 1.000e-20UniRef50_A0A172UD03 Uncharacterized protein n=2 Tax=Methylomonas TaxID=416 RepID=A0A172UD03_9GAMM  ali  12  540.LDSPNTGATQYAYDAAGNLTDAADVTATYRYDALNRLLSEADAE----YGYDGAGQQGRLTDARRGATRHQFDLRGNLLTATVPSNNSVAFGYDADDRIVQTQPSGRRLQYAYDAAGQVRRIQVADTVTTTTRLLADNIVLTYGNGLSDSRQFDQDYRLTRTVGNLFRQQYGYDSLGNMTLETASLARQNYTYDAVGELTALNHANQNQSYQYDAVGNRTRQSPSGGTADYRYDP......... 811
246 1.000e-20UniRef50_UPI00069B6B23 hypothetical protein n=1 Tax=Streptomyces avicenniae TaxID=500153 RepID=UPI00069B6B23  ali  10  781...DCDGATVTYAYDPAGRLLDPLGHRSTHTSDRLGRPLTRTTPSGHTSATYDAAGRPARL-DTAGRVVTFAHDAAGRLTALRDSRGDTASYTLDPAGHVTAVTGPDRAEGYQYGTADRLLSATAPGGTVHYTYDAAGRVVRRSGPDETWTYTWDAEDRLTVTTPDGTSWRYAYDALGRRTAKRRDGSVTRFTWDA................................................. 1074
247 1.000e-20UniRef50_UPI00055B1B03 hypothetical protein n=3 Tax=Streptomyces TaxID=1883 RepID=UPI00055B1B03  ali  16  885........TTRYAYDAYGRLTSPSDATYRWEYDAAGQLRTLTYPDGHVHYRFDLNGRLTALVDPDGRSRRYAYDSEGRIVRH-EEDGVVREFAYDPAGQLVAEDGPGGRTRTDYDIAGNRTMTVTDGTATRCLYDAADQLTAVETAGRRIRYGYDGAGRLVDADDGELRQHLTYN...................................................................... 1104
248 1.000e-20UniRef50_A0A0U5K6U9 Putative deoxyribonuclease RhsB n=7 Tax=Clostridiales TaxID=186802 RepID=A0A0U5K6U9_9CLOT  ali  16 2384.........SSYEYDGLGRVTTGSGEVTTYAYDGCDQLESITYPDGRVRYEYDKNDNLTKVTDRTGAVTTYVYDAINRVTEIHRPNGVNTDYTYDDRGFIVAEDPHGNKRAFTYDDDGLLTATENEDRQGRYDYDDMGNRISKARNGSVAEYTYNASNQMVKVREYDGKVEYSYDADGNRILEEPDGNRKSYEYSVENRLAVRDAHDLLVAMAYDGDGNRI........................ 2692
249 1.000e-20UniRef50_A0A174TFW4 Cell wall-associated polypeptide CWBP200 n=4 Tax=Clostridiales TaxID=186802 RepID=A0A174TFW4_9FIRM  ali  14  571...............................................TLYTFDEVGLIQSIDYLDGNQVTYAYD--GNLISQVSNDTGSFQFSYNADGNLQVTDSVGRSITLSYDGDYLISVQNPDGDSLQYTYTLDGFVTVQNFKGQVVENTYDETGRVVHQYASDGTFDFTYDTENRHTATGTDGYVLEIWYDEFGRITQSRNSEGDYQITYNDLFQITSTDREGNTTRYDHDEEGNISRITY 772
250 1.000e-20UniRef50_A0A263D5F5 Type IV secretion protein Rhs n=2 Tax=Amycolatopsis TaxID=1813 RepID=A0A263D5F5_9PSEU  ali  12  887........VWRYSYDAAGRLISETGRTIGYRYDAAGQLVYLRDRLGNVVRRRDPLGRVVAE-GVNGRMVTSAYDPIGRRTSRRTPTGAETTWRYGEGPRPAELVTAGHTVSFGYDALGRETARTNLLMERRYRYNTNGVLAGIDSSGDARSFDLDPGSRITAVRGSGWSESYAYDGAGNITSAAWDGEVLRYRYDRQGRIVLRSAKPDNWHYTWDADDRLVVTTPDGARWRYLYDPIGRRVAK.. 1224
251 2.000e-20UniRef50_J4UHN0 RHS repeat-associated core domain protein n=1 Tax=Lachnoanaerobaculum sp. ICM7 TaxID=936594 RepID=J4UHN0_9FIRM  ali  16  241..............................TYDNSGFISEISSADINLKYDYDD-DRLVSVTNTSGEKIIYKYDTDGRVTEVLDEKGSKDSYFFDEKYRVILIDAFGNFTAYSYDDKGRITSTDANGGLTKYAYDGADPVEFIDEYGAKTENSYDDSGNFIGSKFNGNRVSIAYDDSGNISSTDALGDETKYEWDESGRVIQIDAMGNRTGYSYVKNENITVTLADGNVYNYTYDDFDRLIS... 526
252 2.000e-20UniRef50_M3A5Z0 Rhs protein n=3 Tax=Streptomyces TaxID=1883 RepID=M3A5Z0_STRMB  ali  14  683...........YTYDEIGRVVSINGRMLTTTCDSAGRRTRRVTPAGVTTYAYDAAGHPVSLTSA-GRTLNFEHDADGRLTSIADRLTGRRTFTLDASGRVAAVDAAGWQERYAYDELGNQTTRINRAGRVRYEHDREGRVVIRQPD--TWKYTWDAEDRLIVVTPDGIQWRYHYDPLGRRISKAADGETTRFTWDGSSLAEQTTSASRALTLTWDQMG........................... 976
253 2.000e-20UniRef50_A0A1I5ZSA3 RHS repeat-associated core domain-containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1I5ZSA3_9PSEU  ali  14  955..........RFEYDPLGQLVSENGRVVRSEFDALGRRTGRRTPTGQSSFGYDSADRPTAITTA-GRTLRFEYDAAGRLRGQTVLRGAATVYRYDGNGRVSAVNGPDWRENYGYDAAGAITARTYRGGETRYTHDAEGRVVTRERRGQRWEYQWNSASRLTVRTPDGTVWRYRYDALGRRVAKDPAGAVIEFAWD.................................................. 1216
254 2.000e-20UniRef50_A0A1H5TN34 RHS repeat-associated core domain-containing protein n=1 Tax=Eubacterium ruminantium TaxID=42322 RepID=A0A1H5TN34_9FIRM  ali  2385.........TVYTYDANGNRTYANGVTLTYTYDECNRLKKVTDKNQKLIAQYEYTGERTKVSDGSEIETEYAYDNCNRLLSETISSGNTTEYTYDQVGNRFSKTIDDTTTEYTYNSLNQLTYEKTVNGSTTYSYDANGNMISKTTDGNLSEYYYDLFNRMIGFSDGSSEYSYTYDAEGVRRSKTCLSHTT....................................................... 2592
255 3.000e-20UniRef50_UPI000DD32890 hypothetical protein n=1 Tax=Paraliobacillus sp. X-1125 TaxID=2213194 RepID=UPI000DD32890  ali  21  969......................................................................YSFNTNGQLTKIKDHAGKELLITHNSEDSFTVTEPVSNKTTIRYNSLGLISVTDSSGREVTFEYDVKCLTSITDADGKVTEFTYDKNGRVLTGTNNEEITYFTYDNRGRVSSTDNNGNTKGYSYDSNGNIMEEDALSNNSSFTYDNNNLLTKIDPVGFKTVYTYDNNGNLLSE.. 1196
256 3.000e-20UniRef50_UPI00047B590C hypothetical protein n=1 Tax=Butyrivibrio sp. LB2008 TaxID=1408305 RepID=UPI00047B590C  ali  15  419..................................................EYDKDGYLVAKGDNTGENTRYTYNEDGILTRVSSSQGKNVTYEYDEYFLTTATYPNGSTRRYTYNESGRVIQIFPDGGEMSYSYDDEKNITTTEQNGLKVEYTYNDRNQKTVTDKNGHTVRFSYDNRGNLTIVGPEGLSESYTYDAEGRLIVKDSEGNSYRYIYDFDGNLSVTDPLGNRIKYDYDAENNAISVTY 723
257 3.000e-20UniRef50_L8MV30 RHS repeat-associated core domain protein (Fragment) n=1 Tax=Pseudanabaena biceps PCC 7429 TaxID=927668 RepID=L8MV30_9CYAN  ali  13  771...DPDGKSIAYTYDAASNRTSVMSGTTSYTFDALNRLDTITNGTDVTDYDYDAVGNLSRTVLPNGVIETRSYDGLNRLTSVTEQDGRKVDYKYDSLYRLTITDSNGNKTVYTFDAVGNRLSKVDDGIQTSYVYDANDRLIS----DGISTYTYDANGNLSVTDDSGRTVEYKYNSTGRVISIDPDGTVIAYIYDGLGSRALTNAAGTVTSYNYDAYG........................... 1082
258 3.000e-20UniRef50_D1AA66 YD repeat-containing protein n=1 Tax=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NBRC 15933 / NCIMB 10081 / H  ali  10  656...DAGGEITTFTYDRAGRLVRANGRVLRWTYDEVGNRVRRRTPSGASVWTYDPAGLPLSLTTA-GQVITFEHDAAGRPIAITDRLSGHRAFELDAVGRITAVQGQGGNERYTYDSAGNIISADAAGGRIHYEYDAQGRVVLRRPL--IWRFYWNAEDRLTSVTPDGHWWRYLYDPLGRRIAKAPDGKT........................................................ 950
259 3.000e-20UniRef50_A0A0D0FYZ5 KY49.ctg7180000000014_quiver, whole genome shotgun sequence n=31 Tax=Burkholderia TaxID=32008 RepID=A0A0D0FYZ5_9BURK  ali  12  590..........RFAYDPLGRLIDPVGNVWHHDYDELGNRIRTVRPDGHTTYERDDLHRETLRTLASKVDQRTVYDPAGRLLQRTAPL-AERRYRYDGAGQLTQIDSRRGLTDYRYDPVGRLIESIGPAGKERFAFDPASNIV--DPGHPETRFEYDARGNLVHRMSPAGEQHYEWDAFNRLVEEASRRSASRYYYDALGRRIAKEVDGERTTFGWD-DDRLAYESETQGSTHYVY........... 907
260 4.000e-20UniRef50_A0A1W1Y0V7 RHS repeat-associated core domain-containing protein n=1 Tax=Clostridium acidisoli DSM 12555 TaxID=1121291 RepID=A0A1W1Y0V7_9CLOT  ali  17  284.................................................YYFNGSGQLTEKKNKNGQAIEYSYDTSGKLTEVEDDISKEYKFQYNTNGLLEVTDGMNKSISFNYDSSNNLTITDADGNTKNYNYNDKGQVLSCNFGDGTQVFTYDSCGRVIEQDDSLNTTTFSYDEASQTTVTDRNGNSKTLTHDSNYNLVVKNELGNIKTYTYDSNRNRLSET----------DENGNTTKYTY 483
261 4.000e-20UniRef50_A0A0Q4QRK4 Uncharacterized protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A0Q4QRK4_9BACL  ali  10 2324LLTYPDNKTVTYTYDRAGRVTDWNGRVTAYSYDANGRLASTLRPNGTTTRTYDAKGQLLTINDGLDSSYTYGYDAVGNVISVTDSVGNVSGSVYDAAGLQ----PDSAETEMTYTADNRL-ATYNGNPVV---YDQDGNMI-TGPLGSMQSYSYDSRNRLMEA----GGISYGYNSENVRTSVTVNGVTTRYETDGQGNPTREAADGSYATYHYDRRGSTVATDDNGVITTYEY........... 2612
262 4.000e-20UniRef50_A0A1G7L2T7 RHS repeat-associated core domain-containing protein n=1 Tax=Lechevalieria fradiae TaxID=200378 RepID=A0A1G7L2T7_9PSEU  ali  12  996..........RFGYDPGGRRITPSGAVEDLSYDPAGRLAVLRTAGRTVAFDRDQLGRETARRLDAGVTLAQRWDPMGRLAEQNAPAALQRRFHWRQNGSLAAEDDRGGR-RFEHDVLGRLTAVLGPAGAERYSYDPAGNLTHADGLAGRTTYAHDAQGRVVEMRRRTRTWRYTWNADDQLVEVTPDGDLWRYHYDPLGRRKVRHAPDRTTEFTWDGV-QLAEQHAAGVVTTWS............ 1257
263 4.000e-20UniRef50_A0A2G5IMI1 Uncharacterized protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A2G5IMI1_9ACTN  ali  12  291...DLGGRITASAYDALGRRVTPSGARAHYEYDTVGRTTSTRDAAGQEIQTWDAAGRPLEQVTAAGNQISYGYRTDQYLVRVEDALDGAMSLELDAVGRVSRIQGHSQTESYSYDEAGQVTSRLDRAGSTRYEYDSAGRVVVRSRKSDVWRYSWDPEDRLTVITPEGTVWRYLYDPLGRRISKQRLGERTDFTWDG................................................. 554
264 4.000e-20UniRef50_A0A0U5HBJ8 Putative deoxyribonuclease RhsC n=103 Tax=Actinobacteria TaxID=201174 RepID=A0A0U5HBJ8_STRRE  ali  17  530..............................................................................LEQIDDRNGNWITFEHDEAGRLRIDSADGRVTRYGY-TDGHLTEVNSSGRPTRFTYDERGRITSTDTNDSHFTYVYDAAGHLASTDPLGATTRFTRDRYNRLSTTDPLGHTTTFEYDEAGNLTRVNPDATVVRQTYDDRGNVTSTDPSGKTTRLSYNAAGHLTLVT. 797
265 5.000e-20UniRef50_UPI0009B2F180 RHS repeat protein n=1 Tax=Burkholderia ubonensis TaxID=101571 RepID=UPI0009B2F180  ali  13  646..........RFAYDPLGRLIDPVGNVWHHDYDELGNRIRTVRPDGHTTYERDDLHRETLRTLASKIDQRTVYDPAGRLLQRTAPL-AERRYRYDGSGQLTQIDSRRGLTDYRYDPVGRLIESIGPAGKERFAFDPASNIV--DPGHPETRFEYDARGNLVHRMSPAGEQHYEWDAFNRLVEEASRRSASRYYYDALGRRIAKEVDGERTTFGWDG-DRLAYESETQGSTHYVY........... 963
266 6.000e-20UniRef50_A0A1Y3TEG3 Uncharacterized protein (Fragment) n=1 Tax=Lachnoclostridium sp. An76 TaxID=1965654 RepID=A0A1Y3TEG3_9FIRM  ali  15  327.................................EDGLLASVEDHTGRRVSYTYRDGLLREARLPDGGVFRYCYTPGGKLESVENPLGTVTENRFDEEGRLQQEFPDGTRMTYAYDDRKKVELTERNGSKVTYLHDDRYRDVKHIYSNGEERFAYNQNNQRTYVDRLGNRTQYAYDPAGNLTVIDALGNRTEIRYGEKNRPAEVRVNGKELKGTYDGEGRLLSMK----------DALGNQTEITY 534
267 7.000e-20UniRef50_A0A1I6V5F6 RHS repeat-associated core domain-containing protein n=2 Tax=Saccharopolyspora flava TaxID=95161 RepID=A0A1I6V5F6_9PSEU  ali  14  950...........FRYDAAGRRVTPTGAESIWSHDADHRATGLRDAVGRLTQRWDARDQLVEQTDPAHRRRRYRYFADGHLAGVDDPLSGTRSFELDAAGQVLAVRGADRSERYSYDEVGNLLQADAQGARSSYIYDAQGRVVVRDA----WHFSWDAEDRLVVVTPDGVRWIYRYDALGRRVAKAADGVTVAFTWDDVALVEQVHNGRHATVWNY............................... 1221
268 7.000e-20UniRef50_I0V6L1 RHS repeat-associated core domain protein n=3 Tax=Saccharomonospora TaxID=1851 RepID=I0V6L1_9PSEU  ali  22  223..............................................................................................DRWSLTTLTDRNGNRITFTYDEQGRLVITDSTGVPYRYEYDTAGRINATDRNGYRYFYDYDEDGRVVRAAGEDGALAFDYDARNRVTVINALGHTTTYHYDRFGHLTVVDPLGNTVAMEYDRYHRLLATDGTGNTIRYTLDDNGDPITID. 423
269 1.000e-19UniRef50_A0A1T5EPG5 RHS repeat-associated core domain-containing protein n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A1T5EPG5_9FIRM  ali  15 1120IMRDALGRVTSYEFGASGERTYPNGERAEYHYDEDHRLKELIHGDLRVDYSYDEADRLSVKTYSNGNKVRYDYFPGGNLKSMIDPDGGKWDYGYDEVGRLSNVLKDGELLRYGYDIFGNRTSLESDGQKIVYKYDAMDRLLSVDRRGNITRYNYSAVNQLAAVDSKGIETEYSYNGLGNLLERTINGEDERYTWD--NNVVSMTDGYAAASYAYDEFGRDIDIDPASRDRSRDYTKDGNLIQ... 1477
270 1.000e-19UniRef50_A0A1M5TE41 Intein C-terminal splicing region/RHS repeat-associated core domain-containing protein n=1 Tax=Clostridium collagenovorans DSM 30  ali  15 2484....PNNVKLTYNYDKSGRIITPYGN-TSYEYDKLDRIQRVVGRNGATVYEYDALGNRTKVKYANGVTMKYSYDKCSRLVKEEDKNGQVISYKYDEINRLIEEDAVGNRTTYKYNKLNQLLKENKENSETSYSYDKNGSLITTIQKGSIESYEYDFEGNRIEKTVNEETINYDYDERGNLLTVDKNGTVTDYKYDAFGNILE--SEGSTESYQYDAN............................ 2827
271 1.000e-19UniRef50_D6K869 Rhs protein (Fragment) n=2 Tax=Streptomyces sp. e14 TaxID=645465 RepID=D6K869_9ACTN  ali  12  564...................................GYVLTVEDPYSGLTRQFTARGWLVGIEDRNGNYISLERDEDGVPLTVIHSGGYRIRVDHDDQQRVTATDGAPVRLRFGHDAEGNLEVRNAVDAPTRFTYDSAHRVTGRDSNDTEFAYVYDAEGRVVETRGTDGTSRLTYDGTSTVAYTDSLGNTTIYRANRRGQIVATDPLGHTTTQTWDRHDHLLSTDPLGRTTHWTWDDAGDLVSVT. 795
272 1.000e-19UniRef50_UPI0005ED0633 hypothetical protein n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI0005ED0633  ali  18  234..............................................................................LSALTDRNGHVVSYGYDARGRLAITDSSGAPLVYGYDSRDRVTSTDPDGRVITFAYDDLNRVTVTDSLGRRTCHHYDEQQHIIRTDAAGHTVDTQHDRYGHLLAADALGRTTRFSLDPNGDPIRIEPDGATWRHAYDAAGNQTVTDPAGATTRFGYDDAGRLSTVT. 501
273 1.000e-19UniRef50_UPI0002FEF1AA VWA domain-containing protein n=2 Tax=Ruminococcus flavefaciens TaxID=1265 RepID=UPI0002FEF1AA  ali  11 2650...DRNGYATLYEYDANGNRSYANGIVVSYNYDELNRLISEKDKQGTVEYTYDKLYRLTEYTYANSAETTYTYNALNQLTSE-----NGTSYQYDNAGNLISVTSDTKSVLYAYNAENKMIRTVQEGNSISYEYDYAGNRTVKKSENDYTYYLNDVSGSLTQVDANGNEKCW-YTIGADLISQERSGTVSTYLYDGHGSVRGLDETGAVTTYNYDAWGEL......................... 2922
274 1.000e-19UniRef50_A0A096B3Q6 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A096B3Q6_9FIRM  ali  13  13............................................RNGTVYDFSDNGLLERISYLDGNTISLSYNGD-QLTRISNDTGSF-ALSYNSEGNLTVTDSTGRSILLSYDGDSLISAENPDGDSLRYTYENGLLATVQNFKGEVVENTYDSEGRVIHQYAADGTFDFTYDPENRRTSTGSDGYYLSIVYDELGRIIESTNENGTQKFSYDELNRVSETDREGNTTYYEHDNNGNISAITY 216
275 1.000e-19UniRef50_A0A1N6LC74 RHS repeat-associated core domain-containing protein n=1 Tax=Singulisphaera sp. GP187 TaxID=1882752 RepID=A0A1N6LC74_9BACT  ali  12 1883.......NVITMTYDAAGRMTGIRDNISQYTYDNADRLITVDDA-GTTTYGYDAVGNRASLADSLGGVTDYVYDSRDELTGVTDDAGRRTAYTYDAANRLTKTALTGGTVSYGYDAVNRLTQETNDSQLTSFSYDANGNRTMTTATGNTFNYAYDDEGNLTSKTESGNQVLYTWDHRNRQIVEQVVGHTTTFTYDALDRRIGESEGGATRWSLYD.............................. 2185
276 2.000e-19UniRef50_A0A1K1PTB5 RHS repeat-associated core domain-containing protein (Fragment) n=1 Tax=Ruminococcus flavefaciens TaxID=1265 RepID=A0A1K1PTB5_RUM  ali  11 3025...DWDNNITAYEYDSNGRVTRPDGSVETRGYDKAGRLVKQVDINGDKVYAYDDAGNITSSSDLNGKSAEMKYDSANRLIEF---NGEKVK--YDADGNMVYGPVNGKMTELVYDCRNRLVS---AGGV-SYEYDAENNRISKTSGNVKTSFVVDTSGRVLTAETSGKKTSFVY-GIG-LISQQTDTETLFYHFNNIGNTEAVTNLSGTITFAYGPYGEL......................... 3249
277 2.000e-19UniRef50_A0A0Q9QNX0 Uncharacterized protein n=1 Tax=Paenibacillus sp. Soil766 TaxID=1736404 RepID=A0A0Q9QNX0_9BACL  ali  13 3201.VTDWDNRITRYEYDHNGRLTNANGSVLTQSYDAMGRILRQ--------KEIDAKGNVINQND-------YSYNSIGNITSSNDPQPITMNMTYDKNNRLI--TFNGQTVK--YDADGNMTYGPLNGVMVNFHYDSRNRLIE---AGNTT-YEYDAENNRIAVIDNDERIEF----INNLAMKDAKGNATWFVY-GIGLIGHQETSGAFSTYHYDVRGSTTATDDTGMVTRFTYTTYGELIERT. 3434
278 3.000e-19UniRef50_UPI000480C78B RHS repeat protein n=1 Tax=Pseudobutyrivibrio ruminis TaxID=46206 RepID=UPI000480C78B  ali  11  274...............................FDGAGLLVSFGDIDGHTVVSYDRGRRLKSVETKNGNSLLFTYDNAGLISKVTDHTGRFVCYTYDEKMQLTEITELGAVRKFTYTEDGKIKVINPKGIVITNEYDKQHRTVKQSPDNSVMTYEYDDINKTTTTEQNGNKVVYTHDDLERHTATEYYDGTEYYTYNTRNQKTSTDKRGNTTRFAYDNKGHLTKIV----------DALGNKTFITY 492
279 3.000e-19UniRef50_A0A1Y3T759 Uncharacterized protein (Fragment) n=1 Tax=Lachnoclostridium sp. An76 TaxID=1965654 RepID=A0A1Y3T759_9FIRM  ali  19  225.............................YEYLTRGQRQYRFDRDGRLASVEDHTGRRVSYTYPDGGVFRYCYTPGGKLESVENPLGTVTENRFDEEGRTQQEFPDGTRMTYAYDDNQRTLYVDRLGNRTQYAYDPAGNLTVIDALGNRTEITYDGEGRLSMKDALGNQTEITYNSAGRIV--QPDGSEVGLAYDSRGNITLRDASGSLTRYTYDSLNRVTSVDGNGNRTRYAYDVMGNVT.... 560
280 4.000e-19UniRef50_A0A0H2XRS9 YD repeat protein n=1 Tax=Burkholderia cenocepacia (strain AU 1054) TaxID=331271 RepID=A0A0H2XRS9_BURCA  ali  17  356............AYD-----TGELGARWITPY------TTRIDIEGDTWFYRDASGRTLSRLDDTWVTIAYGHDELHRLAMQKDRAGNTITLDYDARDHVARIDANGNVLSFEHDKHGRIVLIEQDGKRRTYAYDEAADLIATDRHGNAWNYQYDGRGRLTVTDALGQTTRYAYDEHNNLTLILPDGSVEQMRYDARGNRTHERADGSIVEMAYDDKDQMIRVDPNGHVWQRKYDDAGNLVEE.. 686
281 4.000e-19UniRef50_UPI000C82470A hypothetical protein n=1 Tax=Ottowia sp. Marseille-P4747 TaxID=2045302 RepID=UPI000C82470A  ali  1805..........RYSYDADGQLTDANGQSARYQRDEQGRITQTSKADGSTFTHYNADGQLQSQSWPDGSRQDFAWDAFQRLLQVTGPQGAQRRYSRNLAGHITRIESEEGASAYAYDRLGRLTQAEPDQANEAYSWDAAGRLSSAHQAGA---WTYNEANQLLQENAPAQQSQTEYNAQGHLIKETGAGWERNWRYNAAGRLSEISADGFTVQYRYDPFGRRIKTVTQGATSRTTYDEEGRITR... 2137
282 6.000e-19UniRef50_A0A0S8KUW0 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM1_79 TaxID=1703410 RepID=A0A0S8KUW0_9BACT  ali  15  498......................EDDRIYTFDYTTLGKLVRIEDGRGNVTVTYDATGQVETVSDGLGRTLTFTYNDDAYLTLVTDALSGVTEYSYDALGNVTQTDADGNTFSFDYSGL-ETTLTDPLGNTRAHTHDRLGHTTVTNPDGTTSTFGYTARGGLTITHADGATESLSYDALGNATSTDQIGNTTAATYNANGQLTTTNVAGATTTNTYNADGTLTTTDPAGNTTTFGYDSLKRLNLITF 839
283 6.000e-19UniRef50_A0A1I5PL13 RHS repeat-associated core domain-containing protein n=1 Tax=Variovorax sp. 770b2 TaxID=1566271 RepID=A0A1I5PL13_9BURK  ali  16 1033.......AVWRHQYDELGNRTRPDGHEVRFERDDLHREVAREQANGAQSQSYDPMGRLLQRISQATPRRTYAYDKAGQLTGIGDSRRGRIDYRYDPVGRLLQANGALGREVFAFDPAGNIASPDAPGQPTSYRYDALGNLVERVRNGERSSFEWDGFGRMTAAKSHQGTTTFRYDALGRRVAKGPRGHTV-YGWDG................................................. 1301
284 6.000e-19UniRef50_A0A1X1J3I3 Uncharacterized protein (Fragment) n=9 Tax=Streptococcus TaxID=1301 RepID=A0A1X1J3I3_STROR  ali  17  866...................................................................................................TSQTDEKGNKTNFDYNENYQLTKITPTGLVYSITYNSEGYIAIQIPNGSTLTYEYDTNGHLITTDATGVPTRYEYDDKGRMTAYDGNGKVIQNEYDEENRVTQTDGAGAVSTLSY-SEGQTITTDGNGNQTVYTYDEQYRTTGIRY 1016
285 6.000e-19UniRef50_A0A0F2NPM9 Uncharacterized protein n=2 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2NPM9_9FIRM  ali  14  976MVTDWAGRITSYEYDPNGRLTRPDGTEQTNTYDAAGQLLQQKDVDGNVIYTYDGAGNVTKEQSPDNRLATYEYDADGNMTK--GPLGGVMNYTFDCRNRLTST----GSASYQYDAENNRISVANNGGRT----DNVINLISTDEKGSQTFYVY-GLG-LIGQEAGGDYHTCHYDRRGSTVATDASGKVTRFQYEPYGTLTHRT---GTTSFQY--NGRFVMTDANG.................. 1232
286 6.000e-19UniRef50_R9JAK1 YD repeat (Two copies) n=1 Tax=Lachnospiraceae bacterium 28-4 TaxID=397287 RepID=R9JAK1_9FIRM  ali  20 1260....................................................................YRFRADEKGQITHIEGRHGKTIVLCY-ENGHVAAADGAGNTAAFGYEGDLLVSITNPGGGSMGFAYDDEGNLLITDFSGNYLSCRYDAFGRVIEQNTAGRGKSYAYDEEGRTTVADELGNQTKYSYDENGCVTGIEQGGSGIRSTYDENGRLTQTDGLGNVTKMAYDEYGRMNRAIY 1441
287 7.000e-19UniRef50_A0A1H6F6R3 Putative deoxyribonuclease RhsB n=1 Tax=Thiotrichales bacterium HS_08 TaxID=1899563 RepID=A0A1H6F6R3_9GAMM  ali  11 1156.VTDWAGRVTQYSYDANGRVTRPNNTVVTYAYDAAGQLLQQKDSAAALIRQYD-----------------FVYDAAGNIVDMSYGDGNRTAYSFDADGNM--TDGNGGMDSYVFDSRNRLIKT---GDTSTYRYDAENQRIAVDNGNGETRYAINALSQLVRAAPDGTQTYYVY-GLG-LLGEESNGAYRAYHFDLRGSTVASDAAGKVLSFQYAPYGGLVSHHPVDVDTPFLYNGRD....... 1401
288 7.000e-19UniRef50_A0A229GZ70 Type IV secretion protein Rhs n=2 Tax=Streptomyces TaxID=1883 RepID=A0A229GZ70_9ACTN  ali  12 1032....PSGALSSFAYDAAGHRTTAGGHTIASAYDESGRLAQVWDPAGRLAYTYRADGHLTGVADQLRGAHGFELDPAGRVTAVRVAGGRGESYAYDETGNQTHSDATGGRVRYEYDAAGRITSRKPD--TWRYAWDAEDRLTVTTPDGTVWRYLYDPLGRRT.................................................................................... 1250
289 8.000e-19UniRef50_A0A2V3J9K9 Uncharacterized protein n=1 Tax=ANME-1 cluster archaeon TaxID=2056316 RepID=A0A2V3J9K9_9EURY  ali  16  174.............................YNFASNGRINNIADKNGNLNFEYNLLGRLTRVSDDSGMFLNINYDLHGKISSVADPLGREIKYEYAASDLVEVTDALGNSSFYEYDKKNRLIKEDEDGKTYTYEYDRGGNVTVIDVSGNKTKIEHNSNGNPIITDALGGVATMQWDSDMNLSFTDANGATTSYEYDAYGNLIETDALGNSTNLEYDTDFNLIKIDATGNYSVMSYDSFGDMTSI.. 487
290 9.000e-19UniRef50_Q1K295 YD repeat n=1 Tax=Desulfuromonas acetoxidans (strain DSM 684 / 11070) TaxID=281689 RepID=Q1K295_DESA6  ali  14  854...DAGGS-HSYAYDSLGRLTYTLQNTTGYSYDATGNLVTLSYPGGAVTTSYDGNHRPLSIQAELGDQTQIGYDTNGRPVQWQHGNGLLTSAGYDGGGNLTSRDGTGQLTAYQYDVVGQLISADKNSILRTYSYDPVGNRLTLNEDGEIDTLTYNQSGRLKTLSNSGTVSDYLYDGNNLRVVKDSDGVVTHYHYDLQGRLLAETDSDGTLR.................................. 1137
291 9.000e-19UniRef50_UPI00047DE85E hypothetical protein n=2 Tax=Butyrivibrio proteoclasticus TaxID=43305 RepID=UPI00047DE85E  ali  16  425..............................RFDESGLLVAVGDNNGIKYEVIYDVIQVKELSAENGDSLSFFYNEDGNLRSIVDHAGREVTFEYEESHLIKVTSPDGRTLVNEYDEKDRVTQEFPDGGEILYSYNDEHYTEVTQQNGCKVRYYTDELGRHIRTYEEGIEEKYTYNERNLKTVTDKNGNTTRFTYDNFGRLTIIGSNGLRETYTYDSEGRITSKDSEGNSYKYRYDPLGNRTKYDY 708
292 1.000e-18UniRef50_A0A250KMP9 Uncharacterized protein n=1 Tax=Methylocaldum marinum TaxID=1432792 RepID=A0A250KMP9_9GAMM  ali  14  834.......FTLRNAYDEAGNRITVIAHAVRYAYDALDQAIEIRDAVGQIIREYSADGYLTRRTDADTVVLAYDYDAAGNLTERRDARFGIDRYVYDPVGRITQHDPHGQIKHYLNDPAGRLTTRDAQGEWSRYRFDRAGNLIERHDRRGALHLRWDANQRLIESRLEGVSTRYRYDPLGRRIEKRTGDKVTTFVWDG................................................. 1080
293 1.000e-18UniRef50_A0A038H0R7 Uncharacterized protein n=3 Tax=Burkholderiaceae TaxID=119060 RepID=A0A038H0R7_9BURK  ali  16  455........................................................RLVARAGRDGLGLKFSYNEKNELSGITDGAQNAIRYAYSPEGDLIEVDFNGNPANLEWDALGRSAATSAQSRDTRFEYDADGNVLVEHPDGTSESFNWNENNQLVSVNALGQVQRFEYDDKGRVSVTDALSQTTRTEYNDAGLPVVTSTTGDVTTADYDALGRPVVTDPAGRTTQYAWDSRARLIALT. 740
294 1.000e-18UniRef50_A0A0F2JFG3 Rhs family protein n=1 Tax=Desulfosporosinus sp. I2 TaxID=1617025 RepID=A0A0F2JFG3_9FIRM  ali  11  559......GSTITYNYDSVGNLTYPDGTQVDYTYNALNLPITVYDELGGVTYQYDGNGRLLSITNESNQISQFAYDALGELTQVTNPDGKTVQYTYDSVGNRLSTDALNGTTNLGYDYEDRLSQVQDGSKTIHYNYDGDGNLIKKTITGSTSTYEYDGLGSLIITDSVGAVKKYQYDAFGNPTII.............................................................. 838
295 2.000e-18UniRef50_A0A1I6PBJ3 RHS repeat-associated core domain-containing protein n=1 Tax=Saccharopolyspora flava TaxID=95161 RepID=A0A1I6PBJ3_9PSEU  ali  15  229.....NGRTVASAYDALGRRVTPSGAESAWEYDGNSRPTALYDNAGNEVQRWDANHQLLSITGAAGRQLQYTYRADGNLTGLDDKLTGPRTFELDRAGRVTAVTGTGWTERYAYDVAGNLTLIRRAGNV-RYEHDAQGRVVSRKPE--TWRYYWDSEDRLVEVTPDGTRWRYRYDPLGRRVAKTPDGNQIEFTWDG................................................. 480
296 2.000e-18UniRef50_UPI000407B3FE hypothetical protein n=1 Tax=Methylocaldum szegediense TaxID=73780 RepID=UPI000407B3FE  ali  13  834.......FTLRNAYDEAGNRITVIAHAVRYAYDALDQAIEIRDATGRIVREYSADGYLTTRTDADTVVLAYDYDAAGNLTERRDAWFGIDRYVYDPVGRITQHDPHGQVKHYLNDPAGRLTTRNAQGEWSRYRFDRAGNLIERHDRRGALHLRWDANQRLIESRLDGVSTRYRYDPLGRRIEKRTGDQITTFAWDG................................................. 1080
297 2.000e-18UniRef50_A0A0Q8R0X3 Uncharacterized protein n=3 Tax=Duganella TaxID=75654 RepID=A0A0Q8R0X3_9BURK  ali  15 1608.........TQYHYDAPNQVKDSNGNTLTLTYDMLARLKTVTATDGRILRFNYADGRISSVTGP-GLDMVFKHDGFGNLVKVT-GNGRSEEFAYDEMGQLTYTDPNGRTTKYEYKHYELPLVITPTGPV-QFDY-EIGKTTITNQKGAATRYELNSFGSLKIIDGAGTTTTWATNDVHMLSKTDPRGVEAVYEYDTAGNMVAETVGGKSIKRRYDKL--LEETDRNQHTTTFGRDDRGNLLTTQH 1902
298 2.000e-18UniRef50_UPI000D3E0C7F tandem-95 repeat protein n=1 Tax=Euzebya sp. DSW09 TaxID=2052804 RepID=UPI000D3E0C7F  ali  14 2403....PNGLVTTTSLDPLARPTTPAGRSRSYTYDPRGLVTEVVDSLGTSSYHLDPAGRLASETTPIGQVTAYTWDAVGNRIGV-DHGGTVETATFDDNDRLLTMGAR----TYSWDAAGNMLGESGGGRTALYVYDSRNRIVSASVDGRVVDHEYDALGNRVSTDVDGVHTDLLVDDRG................................................................... 2583
299 2.000e-18UniRef50_A0A235GJI2 RHS repeat-associated protein n=5 Tax=Burkholderiaceae TaxID=119060 RepID=A0A235GJI2_9BURK  ali  17  489.........................................................LTARIGRDGLGVTLAYNAAGELAGLSDGHGLAVALDY-TDGRVTAIDAAGGTLRYEYSREGDLVATDVLGHRRTYAYEQHLLTRYTDFNGFATCLEWDCNDRTKVTDADGHATTYTWDDRGQLIAQNGAGQIERFAYDEAGRIAVTDALGNTTRTEYNATGLPVVTNAAGDVTHTAYDALGRPASVT. 746
300 2.000e-18UniRef50_A0A1C5BLC5 YD repeat-containing protein (Fragment) n=1 Tax=Streptomyces sp. DconLS TaxID=1839766 RepID=A0A1C5BLC5_9ACTN  ali  16  524...........................................................TVTDPETHRTWHFADRTEHLAQVDDRNGNWLTFEHDAEGTVRITTDSGRVTSYTYTDGNLTEVINSSGLPLRFGYDDRGRVTSTDTNDRSYTYAYDDRDRCVAEDPLGATTSYVRDRYNRLSTTDPLGHTTSFRYDETGNLTSIRPDGTTVRQTFDTRGNRTVTDSSGCTTRFTYTECGHLTSVT. 808
301 2.000e-18UniRef50_A0A0F2PS17 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4b TaxID=1629717 RepID=A0A0F2PS17_9FIRM  ali  14 1505.........TTITYDETGKRIKPNGVTVDYSYDIGGRLTQHTSAKGVIAYTLDKVGNRLSKTDEQGKTTSYSYNNLYQLTRVEYPDGQAVDYTYDPAGNRT---GAGGVT-YTFDDANRLIQVISVGQSVYYDYDYENRLVSYMDENKSAHYTYDGDGNLVEKDSSGEENNYIYDGLGSISVVDVYGNPLNYTYDAFG............................................... 1757
302 3.000e-18UniRef50_A0A2A2AK22 Uncharacterized protein n=2 Tax=unclassified Comamonadaceae TaxID=83494 RepID=A0A2A2AK22_9BURK  ali  728.............WDADFNTTDINGQSQRYQY-QQGRPSSIQTPQGQTIRAYD-WHYPTTIEYP-GATRTQSYDSLWRPISVSNSAGHTIHYQYDRLDRLTQAQPSQSLEHYSYDASHNRTASAHQGGAWRYE--SGNRLGSWGQPDNPTRYQYNASGHIASAEHNGATRHYHYDAGQRLSHITQNGQTIRYQYDPAGRRISKTTGQGTTWYLYSDEGLVEEINAAGQTT............... 985
303 3.000e-18UniRef50_UPI000A0116B4 hypothetical protein n=1 Tax=Actinomadura rifamycini TaxID=31962 RepID=UPI000A0116B4  ali  20  244..............................................................................................................RFAHDPVGDLTEADSAGVPVRYTYDDHRLTGWTDRNGHRYRYVYDENGRAVRGEGSEGRLAFHYDPDNRVTRTDSLGNTTVYRYNEYDQVVETDPLGGVVRSEWDQFDRLLSTDPLGHTTRFSYDDRGNIVQIRY 385
304 3.000e-18UniRef50_UPI000DCC32F7 hypothetical protein n=1 Tax=Phytoactinopolyspora sp. YIM 96934 TaxID=1981511 RepID=UPI000DCC32F7  ali  15 1278..........SYTYDDAGRLTTSAGEYIDYDYDGSGNILAEVDDPGLITYEYDAAHQLVSV---DGQ--EYTHDADGNLTS-----DGTTTWTYDAFDQIVEAEHEGDVAELAYDAQGNRISVTTGGQQRNLSWDINGELTTVDDPDGQTTYRYGPTGLPTRIHLDDDTQFLFTDALG--TVTDADGDITHSEYEPFGARRNTTEDGLTT................................... 1490
305 3.000e-18UniRef50_A0A285ZNT6 Uncharacterized protein n=2 Tax=Pedobacter xixiisoli TaxID=1476464 RepID=A0A285ZNT6_9SPHI  ali  39  87..........................................DERGQTVLKLRKDIFGNTILEDGRGQQVYSKDIFGNTIVESSANNVVRKHRKDIFGNDVVEDGKGNTITFKTDIFGNKVVEDGKGEVVTFRTDIFGNEIIEGRNGEVKLVKKDIFGNFIVEDGNRNVIKYKTDIFGNEVVEDGSGNVIRYKKDFSGNQIVEDGNGNKITYKVDSSGNKIFEAN.................... 277
306 4.000e-18UniRef50_M2XGM9 RHS repeat-containing protein n=4 Tax=Amycolatopsis TaxID=1813 RepID=M2XGM9_9PSEU  ali  10  878..TDFNGRTTRYGYDAAGQLVDALGRVVTFTYDGADRMISAYDALGRIVSEYDAIGRRVARRTPSGAESFFAYDAASRPVSLRDPSGREVRQGWDAADRLTRVDRAGRVVSYGYNLAGAITQSDPAAGSTSYLHDTEGRTIARRKLGGDWTYQWNSDDRLTVVTPDGERWLYHYDALGRRIAKDAQGRIIDFTWDGSN............................................... 1208
307 4.000e-18UniRef50_A0A2G7EHB7 RHS repeat-associated protein n=7 Tax=Streptomyces TaxID=1883 RepID=A0A2G7EHB7_9ACTN  ali  12  482....................................................DGVARIEQLTDRNAHSITFEYDEDDRVTSLAGADGGTTRYGYTDGNLTEVTNSSGRPLRFEYDDEQRIIATDTNGRRYDYVYDNLHRVI---AEGGTIRIDYDGTD-----EATGHRVT---------TVTTRDGSATHHLFDERGHMGQIDPLGHRTRIERDPHNRLTHTDALGRTTTLGYDAEGRLASVTH 690
308 4.000e-18UniRef50_A0A1L7FDZ4 RHS repeat-associated core domain n=1 Tax=Actinoalloteichus sp. GBA129-24 TaxID=1612551 RepID=A0A1L7FDZ4_9PSEU  ali  11  805......GVQTSFEYDGLGRVISQNGATSTFGYDAVGRRVRRTTPVGESVWSYDAAGRPASLTDASGDQTRYLYQADGGVVAVTDQLSGPREFTLDTRGRVTAVEASGWTEAYAYDHIGNITHADVADTDERPDVAAMTRMPSTTSQGPRT-YT----GTLITRA---GSVAYEHDAQGRVVAVTRDGEVVHYAWDSFDRLTVLTPKDDHWRYRYDTEGRRIR....................... 1075
309 4.000e-18UniRef50_A0A221WA21 Putative deoxyribonuclease RhsC n=4 Tax=Actinoalloteichus TaxID=65496 RepID=A0A221WA21_9PSEU  ali  19  332..............................................................................LVSVEHQSGHRLTIEHDAAGHRVSIDADGRVTRYGYDEAGNLTVIDSAGATTRYEYDADGRTAVTDAAGATRAYQFNDLGQVVVTDALGNTARFEWNHHDQLVAIDQLGGVTRREWNADGDLVAVHPDGGRTETVHDALGRPIRIRPDGTRHHWRYDGLGRLLSET. 573
310 5.000e-18UniRef50_A0A1K2FRZ0 Putative deoxyribonuclease RhsC n=27 Tax=Actinobacteria TaxID=201174 RepID=A0A1K2FRZ0_9ACTN  ali  16  401...........................................................TVTDPRGQVRHFADQSADRLEQIDDRNGNWLTFAYDSEGNLTVINSSGVPLRFSYDERGRVTSTDSNNRSYTYHYDDRDRTTVTDPLGSATHFTRDRYNRLSTTDPLGHTTSFRYDETGNLTVTDPAGRTTHFTYHESGHLTSTDPLGNTTTVECDRAGLLTVTDPLGAVTRYARDAFGRPTAIT. 732
311 5.000e-18UniRef50_Q2SKC0 Rhs family protein n=2 Tax=Hahella chejuensis (strain KCTC 2396) TaxID=349521 RepID=Q2SKC0_HAHCH  ali  24 2510...............................................................................VTVTLPDGDVERFTYTAMGDTASTDASGRTTQAGYDPNGHTLTYTNDGKAVRFTRDSQGRIVSTDPNGSELTYTYDFNGDLVSTDPMAAQTSYTYDPLGRTIVEDSEGHRTEFDHDIEGRQVVTDRNGNTTFLYYDDRGNVTSVDAEGHTWSYAYDDHGNQLSET. 2768
312 6.000e-18UniRef50_UPI000694C4AF hypothetical protein n=1 Tax=Amycolatopsis taiwanensis TaxID=342230 RepID=UPI000694C4AF  ali  12  888........VSRFEYDAVGNLVSSGDEVAEFAYDPMGRLVRAANPDAELTYEFDAAGRVLAET-VNGRTIHSRYDLLGRRIARRTPTGAETAWTYDASPRPVSLHTAGRTITFGYDPTGNETERLDSGVILAQAWDLNGRLVSQTPDGHVTAIEDDALGRITESRGPAGVERYAYDARGAITAAVWPGADTTYDYDERGRVVMR.......................................... 1137
313 6.000e-18UniRef50_A0A084EZB9 Cell wall-associated polypeptide n=5 Tax=Haemophilus parasuis TaxID=738 RepID=A0A084EZB9_HAEPR  ali  19  218.................QFRYFPNYTEVTDNLGRIEQYHFDHH--QALVKRVFADGSTQQFTDSAGRKTEFRYNAQGQLVEQIRSDNQRQYYGYDNQGRLIEQDMMGHTSRYAYDGQGNLIMFTNEGESQHIVYNEKGRTALIDPLGNRTHFRYNAQHQLVTEDCSGNRTAFRYNEWGQLTITDAEGHHTTYRYDERHQAVVTYADGSTAHFHYDFASRTTYTDSKGNSTHYRY........... 450
314 8.000e-18UniRef50_K0C9Z1 YD repeat protein n=4 Tax=Alcanivorax TaxID=59753 RepID=K0C9Z1_ALCDB  ali  17 1094........................................................RLISIEDPYRNKLTMHYDRNGRLQEITDNNSGLW-FSYNESGRLSVTDWSGARRHYEYDEAGNLIAIDPEGNATEYTYHRDGHLLIIKPQGRTVAFSYYDNNKASYVNALGETEVLDYDLYRQRTVTDPRGFVREHFYDKNNRYKKRDAMGGLTQYSYDTDGLITREDPLGNTIDYSYDKRGNRMTRTY 1345
315 9.000e-18UniRef50_UPI000364AF27 hypothetical protein n=1 Tax=Orenia marismortui TaxID=46469 RepID=UPI000364AF27  ali  13  197.......................................................GVIKEEADRNGNKISFRYDGSGRLTSINDTVGRVYSLIYNSSGKVSRIIIPGNQRRYNYDRQGRLTEVEPNGATTRYTYDTRLLTKIIDPA-RVTRVEYDEQDRVLKQFYDGGNFKFNYSSGDYREVTDRKGSISKYWLDDGGRLKKEDPLNNRIKYSYNGAGKVSIINPKGATTKFQYDDNQNLVK... 390
316 1.000e-17UniRef50_D9V066 Predicted protein n=8 Tax=Actinobacteria TaxID=201174 RepID=D9V066_9ACTN  ali  13  656...DYNGREVRYAYDAAGQLTSQTGETVEFRYDLLGNVVERRHAGGVSRFEYDPLGRVLAETDAAGRRIAWGYDAAGRPTSLRDPAGHLVEWSWDSNDRLVIEDQLTGARRFDLDPLGRATRVTGAGWHESYQYDASGNVALSGPRGGPVSYQYDAQGRVVRLSRPPAVWRYSWDPDDQLVEATPDGVRWRYLYDPFGRRIAKVAAGRVTTWDWDSA............................ 1019
317 1.000e-17UniRef50_UPI000DBA65C9 type IV secretion protein Rhs n=1 Tax=Streptomyces sp. Amel2xB2 TaxID=1305829 RepID=UPI000DBA65C9  ali  14 1055..TTASGRVSTYVYDPAGNRTDSSGHTLEFAFDALGREITRTAPDGGLTYDYDPVGRPLSVS-ADGWTEQYAYDGHGNQIEGTWPTGGRTTYVYDDAGRLTRISKKPDVWRYDWDGEDRLTSVTPDGETWTYEYDPLGRRIRKDGLGTAVDFTWDGT-RLAEQYDASTRTTLTWDHDGQR................................................................. 1318
318 1.000e-17UniRef50_B5HEJ2 RHS/YD repeat-containing protein (Fragment) n=6 Tax=Streptomyces TaxID=1883 RepID=B5HEJ2_STRE2  ali  14  518.......................................TVTDPESGLTRHFDGDAWLERISDRNGHTVTYDRADDGTPLALVHSAGS----------RLAVATEDGRVTGYGYTDGDLTAVTKPSGATLTFEYDERRRVIAIDSNGSRYDYAYDDLDRVIGEGGAGHVLTLSYDPAGHRVTTTADGRTTRHVIDSACRVVTTDPLGHTTRFTYDARGNRLTRT----------DALGRTTSYTY 738
319 1.000e-17UniRef50_UPI00047B99CC RHS repeat protein n=1 Tax=Azovibrio restrictus TaxID=146938 RepID=UPI00047B99CC  ali  14 1029.........SSYRYDSQGRMIGAENDQVRWQYDASGRLQEETQHLGGVTHERDALGNRIATTLPNGRTQRYERDELHRETERQ--MGRQERMGYDPLSRLSQQGPGGETRRQGYDAAGNLIKIEDRRGRIDYRYDALGQLTGARQKGLEERFAFDPAGNLT----DGS-------PQGRPRMANRKGQVTSYEHDGEGNTIRKVHRGGTLNLHYDAENRLVKAVRPGREAEYSYDPLGRRIAK.. 1343
320 1.000e-17UniRef50_A0A1P8WGD3 Cell wall-associated polypeptide n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=A0A1P8WGD3_9PLAN  ali  16 3965.....GNRTTTYTYDSVGNRLS-------RQDSIDGNTSYVYDSNDRLISE-----------SENGVTTTRSYDAAGNLLTVSVNGTLTASYQWDAEGRLIATDGDGAIVEYQYDDFGNLVTRTVAGDVQKLLVDNNLQLVEEYTTGGVVEAHY-VFGQRISQTSISGEITYHFDRLGSTTLSDSAGVVTTYVYDAFGRRMATTGN....................................... 4155
321 1.000e-17UniRef50_A0A1X9YS39 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1X9YS39_9BACT  ali  26  1................................................MKK-YFILLLLTVISLQIHAQRIQFDIFGNLQYESKAQRYTAYLKKDIFDNLIFSDNNNNKLAFTKKDLNYKYILEDEEAKITFFRYVINRYISE--RGYKAKFDVDIFDKVIIEDSKNNRVEIGTDIFGNPTYEEKRNDVTSIKRDLSGNLEYRSDK-EQAFLKKDISNKWGYSDSSGNKFEFSGKTWDKLM.... 192
322 2.000e-17UniRef50_A0A0C1L5T4 RHS repeat-associated core domain n=10 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0C1L5T4_9PSEU  ali  13  461........................................................QLASVQDRNGNRIDVRYDSAGYRLGLDSSDGLVT--------RLWLANPSGTVASYDYNDRRQLVAVYNSSQAMRFDYDAEGRITQTDRNGEWYRYHYDAEGRVTSSSGSGDALTWEYDDXXRIRRTDAVGATTTYGFNERWQLTETDPLGATTTRQWTSNDLLSVTDPLGRTVRREIDERGNVTRVT. 659
323 2.000e-17UniRef50_A0A1G5DV10 RHS repeat-associated core domain-containing protein n=1 Tax=Thiohalorhabdus denitrificans TaxID=381306 RepID=A0A1G5DV10_9GAMM :_  ali  11  142.....................DTAGNWIR--YNAERRAVAYGNSNDQVTLERDNDGRLLHVLDHHGNRVTFSYNTDDRLTLVEDRAGRTVRYAY---------------TDTTYDHGPKLAVTDVRGNTWSYEY-SGDRLSATDPKGRTTELEYNPNGTLKETTPGGFTVQTSYDAEGAFVKESPEGLVTETTYNKDGDLIRIRKNGELVREHRYGDRKKITIDAAGNRTVREYDEWDNLIRVTH 357
324 2.000e-17UniRef50_UPI000A062E22 hypothetical protein n=1 Tax=Demequina aurantiaca TaxID=676200 RepID=UPI000A062E22  ali  11  869.........TTYTYDGAGNVTDPLGRVTSMSYDVVGNVTDVVKPSGTVSFEYDELNRPVATTTPAGRVDTFTYDGAGRVVAAVNSTGMSASYDYNAVGELTKVTSSGVVVVYAYDPSGRVKTVTRQGAVTSVGYDVAGQLEVTTTKGATESYAYDPANRLKYETAGNSCTTYTYDTVGNRTTQSVDGAAVTNTWTPNGELASSTTTAGTQSYDTDLSGELVSSTVDGTVVGYTHDTAGNRTSRT. 1240
325 2.000e-17UniRef50_A0A2T1DMP4 Uncharacterized protein n=1 Tax=filamentous cyanobacterium CCP2 TaxID=2107700 RepID=A0A2T1DMP4_9CYAN  ali  16 1237..........TYRYDAAGNRIRTTQNRTDYSTNNLNQYSTVGDA----VYNYDADGNLISKTQG-NNTWSYTYDRANRLIRVTESNGNETRYEYDALGNRVATIYNGERTEYLVDPFGDVIGEYNGNGDRIASYTHGLGLVRRTDGTNTAYYDSDAIGSTVLTGAAGNINRYQY....................................................................... 1401
326 2.000e-17UniRef50_A0A228RJF6 Sugar-binding protein n=11 Tax=Burkholderia TaxID=32008 RepID=A0A228RJF6_9BURK  ali  12  996.......FVWHHQYDEIGNRIRPDGHAVDWTYGSGHVHGLMLDGKELVQIERDDLHRETLRTLPSKIDQHTAYDRAGRLAQRTVQRANERRYRYDAAGQLVIEDNRRGLTDYRYDPVGRLLESIGPAGKERFAFDPLGNLLKQYAGEH---FSYDARGNLVHRRSPAGEQRYEWNAFNRMTAATVDESESRYYYDALGRRIAKEVNGERTVFGWD-GDTLAYESGEQGSTHYLY........... 1269
327 3.000e-17UniRef50_UPI000C7A1AFA type IV secretion protein Rhs n=1 Tax=Nonomuraea indica TaxID=1581193 RepID=UPI000C7A1AFA  ali  17  222.................................................................................................................................VRYGYDEEGRLSVTNSSGLPLRFSYDPEGRLAWADRDGCWYRYRYDADGRTVMTDSLGHITTFDLNDRGQVTVTDPLGHSVHREWDGRDRLLATDPLGRTVRHAYDERGNLTAIT. 361
328 3.000e-17UniRef50_UPI000DE9B47A hypothetical protein n=1 Tax=Roseimicrobium gellanilyticum TaxID=748857 RepID=UPI000DE9B47A  ali  428..........SYTYDLAGKVLSETGKTHTYTYDAAGNRTGTTYSTGRSTRTYDALNRIATLVEG-GRTTTWHYDLAGRAIALTLGNGQQQDNHYDAVGKLTARDAVGNTTTMAYDDVYRLTTVTQSGEITRYTYDDASNRASKVEKENTTSYTYNTANQLIAWSEENGTEAMTYDTRGNRSVTLPDSSVHSYAYDYRVRRITRTEGNA..................................... 707
329 3.000e-17UniRef50_W2E327 RHS repeat-associated core domain-containing protein n=3 Tax=Paenibacillus larvae TaxID=1464 RepID=W2E327_9BACL  ali  827.VTDPAGRKTTYTYDKHGNLIRPDGFKETRTYDAAGQLLTLSDADGSSTFTYDANGNVITVQGPDNRLDTYEYDADGN--QITGPLGSRESFKYDARNRLIQA----GQTAYAYNSENNRISVTKGNSVTKYVVNPHAMLSQTDGNGGQAWYVY-GLGLIGREDSEGTYQTYHYDRRGSTVALTALGEVTRYVYGPYGELLRKTGDT...................................... 1079
330 3.000e-17UniRef50_A0A0B6RXU3 Rhs family protein n=8 Tax=Burkholderiaceae TaxID=119060 RepID=A0A0B6RXU3_BURGL  ali  12  999.......YVWHHAYDENGRTVRPDGHRIQFERDDLHREVQRRLAN-RVAQKYDPAGRLASSAQRLGARRSYRYDPAGHLAQIDDNRKGASLYRYDPVGRLVEALAPAGKERFAFDPANNLLDTDPEGPTILRGRDPNGNLLGSYAGSH---FSYDDRGNLVEMRSPEAQHRYDWDGFGRLASVNEAGRQATYFYDPFGRRIGKEVNGERTVYGWD.............................. 1252
331 3.000e-17UniRef50_UPI000D6923CE hypothetical protein n=1 Tax=Ornithinimicrobium sp. KCTC 49018 TaxID=2144182 RepID=UPI000D6923CE  ali  20 1800...............................................................................................DLGLLSVTDPQGRTLTFARDGAGRITITAPDGSVTGYGYTDGRLTSVTDPTGSETTFGYDAAGLLQITDGLGNAQTLEYDADGRLTVTDAEGRTTTWEYDDLDNVLRVDPEGAQWRAAYDGRDVTQITDPRGAATVVTYDDSGRPLTWT. 2014
332 3.000e-17UniRef50_UPI000C124A82 hypothetical protein n=1 Tax=Chromobacterium violaceum TaxID=536 RepID=UPI000C124A82  ali  19  58..........................................................................................................................ERADGSEVHFVYDEHDNLVIIDPMGEKWLRAYDDKGQLIETDPLGHKTKYAYNEQGLPVYTDCSGSATQWQYDERGRLLIVDAMGNATRYQYDAEARLLITDPLGRGTHYEYDKAGRLQKRT. 226
333 6.000e-17UniRef50_UPI00068A80A0 hypothetical protein n=1 Tax=Streptacidiphilus oryzae TaxID=348818 RepID=UPI00068A80A0  ali  13  794......GRTLVFRHDEVGRRTTPSGASTALAWDALGNLTGLTASGQRIGFERDAQGRETRRVFGSGPVLDTTWDQLGRLLTVTGAAGRRRTHRYRADGVPILTDSQRGEREYVLNPMGRVLAVLGEDWTESYGYDRAGNLVEITYEGGRTTYRNDEQGRVVERTGKTRTWTFSWDADDRLTVEVPGGSRWRYRYDPLGRRISITESGERTEFTWD.............................. 1045
334 6.000e-17UniRef50_E1IA82 Uncharacterized protein n=2 Tax=Oscillochloris trichoides TaxID=104176 RepID=E1IA82_9CHLR  ali  12 1867.VTTPAGQVTRYTYNGVGLVIGGDGTRTTQTYDAVNNLLSVIGPNGKITYTYNAANQRTQTSYPRTVTETYTQDRLYRLTEMRDSAGVVVSYQYDAADQLTRMDDSTNSTSYRYDANGNRIEREGSREATVYQYNAENRTAAITGSGKRTTMAYDGIGRRIAKTVDNHTQTYAYEGLDPVAYTETWNSQHTNLYRAIGQILAEDDNGLQHWLTQDALGNTVALANDNGQTAYRYDSYG....... 2177
335 7.000e-17UniRef50_A0A1G1HH32 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RBG_13_43_8 TaxID=1801705 RepID=A0A1G1HH32_9BACT  ali  14 1271.VSDRKGQVTTYISDKQNRITYADGSYTAYTYDAIGRLSYIYDSQGSISYEYDAIGRRTNMTVAGQPTVNYDYDDNSRLTNLVIASGAWQSFAYDDLGRRTSVTPNGVNTNYGYDNASHLLEINPVNQVLTYTVDATGNRESMNRQSATKNMTYDENGRLVGINGFDASASFKYDALGRRIEKNINSEAIQYLYDGVDRLARIKADGTVRYYQHDVLGSVIATDETGTVTTYTYDPFGNTT.... 1633
336 7.000e-17UniRef50_I1D6D7 RHS repeat-associated core domain protein n=9 Tax=Pseudonocardiaceae TaxID=2070 RepID=I1D6D7_9PSEU  ali  17  729.....NGRTISSVYDPLGRRTTPSGAESRWEYDSNGNLVALHTANKTLLFEHDSAGREVSITNAAGRRVSYTYRADGYLTGINDQLIGPRTFDLDPAGRVTAVSGPGWSEHYAYGKSGNPISTDNDGNV-RYEHDAQGRVVSRKPE--TWRYYWDDEDRLVEVTPEGSRWRYRYDALGRRVEKSPDGSRIEFTWDG................................................. 984
337 7.000e-17UniRef50_A0A0B8T6C0 Uncharacterized protein n=2 Tax=Sphingobacteriaceae TaxID=84566 RepID=A0A0B8T6C0_9SPHI  ali  32  22.........................................................................................AAIQRDIFGDLDYQSRDGNQSSFKKNVFDDLTFTDSRNNKVTLEKKYL-NATYPGILGNEKR-KRELFYQLIQENRRGEGYVAKYDIFNKLIIEDNEGYKLEKGKDIFGEQIAEQMDGVKTSFNKTINGTLEYSSGK-DKASLKKDIFDKYLYSD. 177
338 8.000e-17UniRef50_A0A1I0FGF8 RHS repeat-associated core domain-containing protein n=3 Tax=Lachnoclostridium TaxID=1506553 RepID=A0A1I0FGF8_9FIRM  ali  14  277................................................VYIFDQKGRLTAKNDTNGKGLCFTYGRNGKLECVSNGYGISISYGYDSVGRLIVTDHTGRSITLGY-EMGRLCYVTNAGGE-SYCYYYDNDKTIQNPRGVVLENEYDDQGRTLCTD--GGKIYYDYQEESNRTVTEQNGSKVAYIHDERFRNIKTVYEDGEERFAYNERNQMIQADKNGNKTRFSYDDKGNMSQVIY 480
339 1.000e-16UniRef50_A0A139WZ37 Uncharacterized protein n=1 Tax=Scytonema hofmannii PCC 7110 TaxID=128403 RepID=A0A139WZ37_9CYAN  ali  15 2580...........YFYDAVGNLWRSNNIVETRQYDQLNRLVSLKNALTNIISSYDPVGYRLEVEEHNGRKVKYEYDELYRLLSITDPNSRIISYTYDNVGNLRSNDSVEGLTTYYYNNNDLLLDETQLKNTYNYTYDNNGNMISRVKDGNEIIYTWDFENRLIGVNNDGKPVDYVYDAKGIRVSSTSDGITTNYEYDSSGNLISQTKDGQQSFYLVDGLGTRVLTDGQASITTYTYDAFGKLI.... 2864
340 2.000e-16UniRef50_A0A1G5G2L0 RHS repeat-associated core domain-containing protein n=1 Tax=Butyrivibrio hungatei TaxID=185008 RepID=A0A1G5G2L0_9FIRM  ali  15 1228.VTDSDGQRVGYEYDEKTAIVYPDGKRAEYHYDAFRRLIELTNAQESINYEYDTIGRLLTGTDRDGDKYEYAYNEKGNRTQIKDVSG-VYDYAYDELGRLSESRKDGAVSSYSYDAFGNRKALVSDGVSATYSYDIIDRLISKDLLPVITSYSYDNRGNLIEEDAAGKMVTYVYDALGHRVGVKENGR......................................................... 1484
341 2.000e-16UniRef50_G5IAE8 Uncharacterized protein n=1 Tax=Hungatella hathewayi WAL-18680 TaxID=742737 RepID=G5IAE8_9CLOT  ali  11 2453....PDGYEVKYEYDKNDNLTDRDGRSTGYEYDALNRLTKVTRPDGGVSYTYNDAGLITAETNPEWQTTTFKYDNNGQLLECKEDKGQTYTYTYDEAGNRTRQDVFGDQRTYTYNADNQMVSVVCEGNLTTFTYDANGNLTAEYKNCAEVRYQYDTENRLAAVYDTQRLLAAAYDGDGNRT................................................................ 2711
342 2.000e-16UniRef50_A0A2E0UTQ1 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0UTQ1_9CHLR  ali  12  927.VTDWDNQVTTYSYDAAGRQTYPNGITTTNTYDDADRLTTMADNDGTTTYTYDALNRLLTVSYPVGTPTSYTYDPMGNRLTLT-QDGIVTTYVYNAADQLQSTDNNGNTQTFTWDRANRLAGLTNGATTMTYRYNGDGARLGKTVNGINTDY............................................................................................. 1122
343 2.000e-16UniRef50_A0A2V8MVU0 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8MVU0_9BACT  ali  11  822.VTDTNGTVTSYSYDNLYRILSAIDKATTYAYDPVGNRVSIITPKTSSYYTYDTDDHLLTA-----GATAFSYDRDGNLILRV--SGATTTYTYNAAGRLISVTGGGSSSAFAYDGDGNRIQQTVDSGRYTY................................................................................................................. 948
344 2.000e-16UniRef50_UPI0006931EC2 hypothetical protein n=1 Tax=Streptacidiphilus anmyonensis TaxID=405782 RepID=UPI0006931EC2  ali  11  80...............SAGRRLD-LGT------DSRGRVYTLTDRQQGLIREFTPDGRLTRVSDRSGRSYALEYDRDGTPLGIDHSGGYSLRVAV-ADGRITELAPDGGLLRYGYTG-GHLTQVNSSGLPMVFANDAAGRITSTDRNGSHYRYLYDERGRVVDEGGADGSLRFQYGEPDRVTETNALGHTTQYHVNARSQIVAEDPLGNTTHYERDEFHRLTVTDPLGRTTRFAYDESGDLITVT. 324
345 2.000e-16UniRef50_A0A0F4ITK5 Type IV secretion protein Rhs (Fragment) n=5 Tax=Streptomyces TaxID=1883 RepID=A0A0F4ITK5_9ACTN  ali  15  3..............................................HFTDHTDETALLAQIDDRNGRWISFEHDESGAPTAITTSKGRVTRYGYTDGHLTSVINSSGRPLSFDCDEHGRIISTDTNGSRFDYVYDANGHLESTDAMGAVTRFEYDRYNRLSRTGPLGHVSRFTYDEHGRTTVERPDGRQARAQYNELGLPIRIVGDGNITRQSFDVRGNRLSIEPSGATTHFAYDGAGIVTSVT. 281
346 2.000e-16UniRef50_L0D7I7 RHS repeat-associated core domain protein n=3 Tax=Singulisphaera TaxID=466152 RepID=L0D7I7_SINAD  ali  20 1269................................................................................TRSYPDGTVVQF--DTAGRVSITDRNLNTTTYAYVASGQPTITDPVGLVTTLAYDASGRLTITDPANRVTTITVDSNNNLTIVDPDSALSQFTYAANHRMTEVDPRGQTATVTYNAFGQFTSESGGGATTSITYNG----SVTDPNGRTTTLAFDALGVVTKTTY 1471
347 2.000e-16UniRef50_A0A2S9JMD8 Uncharacterized protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=A0A2S9JMD8_9SPHI  ali  26  1................................................MKKIVCVALMLSFSVLFAQRGAIDTDIFGALQYRSADGRYKASLEKNIFDDLIFTDSRNNKLQYEKKYL-DKAEPDLRGNKDAQMR--LLRRLVRENSRHRATFKVDIFDKTIIEDNKGYKLEEGKDIFGHVNVKERNGSKTQLKRNLRGGLEYTRDN-NKASFDKDIFDKWIYKDSFGNEIQFGKETWKR-ILEHY 197
348 3.000e-16UniRef50_U5DJF5 RHS repeat-associated core domain protein n=1 Tax=Rubidibacter lacunae KORDI 51-2 TaxID=582515 RepID=U5DJF5_9CHRO  ali  13  381.IDGVEHGVESFLYDDLNRVTSGTGKRVELDYDQTSQLAEI--------RRYNSLSGGTSV-----ATSTYTYDAIGRLAPLSDPL--TYSYTYDRAHRLTQSNSPDGTASYSYDRRDQLLSAEYEGGTETYSYDDNGNRTVTEANNRLSTYSYDDEGNLIQVDASGEVTTYTWDHRNRLTVRNSNGRDVEYRYDVLDRRVAKVPAAATSQYVFDESGTLVQETADGVRWTLTYDSFGNVVHET. 697
349 3.000e-16UniRef50_B1T003 YD repeat protein n=159 Tax=cellular organisms TaxID=131567 RepID=B1T003_9BURK  ali  13  779.......YVWHHEYDELGNRVRPDGHAVDWLYDGEERVQFERDDLHRETTHYDPAGRVLQQTAPL-AERRYRYDAAGQLSRIEDSRKGGTDYRYDPVGRLIEAISPVAKERFAFDPASNIVAETPAARRSHFEYDARGNLVRKRTPAGEHEYEWDEFNRLVAETSRQSQARYFYDAFGRRIAKEVNGERTVFGWDG-DTLAYESDGERGTHYIY............................... 1050
350 3.000e-16UniRef50_UPI0009970B38 hypothetical protein n=1 Tax=Streptomyces sp. CNQ329 TaxID=1298879 RepID=UPI0009970B38  ali  12  322.......................TGARRPLTIDAHG-TYTATDPDTGTTFVVEPHNQIAEVRDRAGRCIVYDHDDLGTPLAIRHSSGRQIQIE--VQGDRITASADRQLMRFGY-TDGHLTVINSSGQPVRFAYDHEGRMLSTDRNGSQYAYRYDHLDRCVEQGGAEGHLAYRYAYDGRTAVTDSQGHTTRYTINTALQVTETDPLGHTSHFVRDNHDQLLSTDPLSHTTAFTYDGAGNLTSITY 566
351 4.000e-16UniRef50_A5GE16 YD repeat protein n=2 Tax=Geobacter uraniireducens TaxID=351604 RepID=A5GE16_GEOUR  ali  15  475.........................................TDVDG-TVNNFNQNGKISATVEPSGKTYGFAYTADS--VTVTDPYNKSTIFSYNSDGQLSRVSPPGDYSTLVKNTDGTFVITEKDGLNHNF--DQWGRILSRDKNGTAMTFAYDG-GNLSVTDGAGRTVTFAYDGTNKLSVTDPKGNAYTFGYDGGNLITVTNPDSGQWSYTYDPAGLLTKADPGGNVVTYVYDDTHRVISGT. 718
352 4.000e-16UniRef50_A0A1C6PHM3 RHS repeat-associated core domain-containing protein n=3 Tax=Streptomycetaceae TaxID=2062 RepID=A0A1C6PHM3_9ACTN  ali  16  2...........................................................SITDPQGRSTELDWTVEGKLTRRTDPDGSQQAWTYDGEGNLAHTDAAGGETRFEYTHFDLVSARTTPGGTWDYTYDAAGRTSTETDDGRTLRYSHDPCGQLVSRNGLGQTVRYERDLAGRVTAKDADGSITRFAYDLHGRLVSATGPETELSYVRDSSGRVLREVCEGRELVNTYDAIGRRTLR.. 210
353 4.000e-16UniRef50_U2J3X0 Uncharacterized protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=U2J3X0_9SPHI  ali  30  21......................................................................................AQRGTVDTDIFGNLQFKSIDGKKASLEKNIFDDLVFTDSRNNKLHYEKKYLDK--MEPGLRGDKEAQAHMLRRLVRENSSEYKATFKIDIFDKTIIEDNKGYKLEEGKDIFGNTNIEQSSGRKSVFKRNLRGGLEYTEGR-NTASLEKDIFDRWLYKD. 179
354 5.000e-16UniRef50_UPI00069C3DD9 hypothetical protein n=1 Tax=Chromobacterium subtsugae TaxID=251747 RepID=UPI00069C3DD9  ali  15  475........................................................RLALIKDRAGNSIAMNF-RDGRLSQLVSSAGYAVDLNHDAIGRVTRVTLQNLETEYRYDAGDLLAATDENGESWSYQYDRTGRLTVTDAYGRTTEYYFDEKGLLSHIRPDGTQDSYDYDANGNLIHERADGSEVRFAYDEQDNLVEIDPMGEKWLRAYDDMGQLIETDPLGHKTKYAYNEQGLPVAIT. 748
355 5.000e-16UniRef50_A0A1R1FKI0 Uncharacterized protein n=5 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1R1FKI0_9BACL  ali  15 1123...DWNGRLTRYRYDASGKLIRPNGSQEQREYDGAGQLIRLTDTSGNKQYTYDTLKRLRSGAEP-GRVVHYTYDPSGNLTTEQVGTSETESYTWDNRGNPVEIDANGNASAYEYDARNRLVKAGKLGQVTRYVIDDAHELSRVDGEGNVTRYVY-GLGLIGREDADGTYLSYHYDLRGSTTLTDVQNRVTRYTY................................................... 1383
356 5.000e-16UniRef50_B8G9R1 YD repeat protein n=1 Tax=Chloroflexus aggregans (strain MD-66 / DSM 9485) TaxID=326427 RepID=B8G9R1_CHLAD  ali  13  583..................................................TVTGLGILVAWRDRRGNALTFTHDLSGQLTAITDATGRVIRVENDAAGRIAFVLPDGRRFDLEFDDRGDLVAITDANTPTRGTY----------------RFEYDERHRIVKQDPEG--ILYEYDDRDRVVRVDASGSVSLASYDPIARTTVTDNLGFRYVYAYDELYRVIATDPLNRTSRTVYDDQYNVVAYT. 779
357 6.000e-16UniRef50_A0A1H5AQM7 RHS repeat-associated core domain-containing protein n=1 Tax=Amycolatopsis tolypomycina TaxID=208445 RepID=A0A1H5AQM7_9PSEU  ali  11  872..TDFNGRTTRYGYDAAGQLVDVLGRIVTFAYDAADRLISARDPLGRVVAEYDALGRRTLRRTPSGAQSAFAYDAAGRPVAVSRRLGHTEEYTYLPDGHLAVTDALSGPRALEVDAAGRVCSVTASGAITHYRHDALGRTVERQRHGRSWHYHWNSDDRLTAVTPDGTEWVYRYDALGRRIAKDGEGRVIGFTWDGT-ELAEETHAGMTVGW................................. 1222
358 6.000e-16UniRef50_A0A1H6EUT5 RHS repeat-associated core domain-containing protein n=3 Tax=Nonomuraea TaxID=83681 RepID=A0A1H6EUT5_9ACTN  ali  13  462.......................................TVTDPTGRTTHFTGVQDLVTAITDRNGNRIDVHY-LDGLPTEVVHSGG----YHLDIEGRIVEIRGAGQTISYAYDEAGDLTVTNSSGLPLRFTYDDDGRLTRHDRIGTWYAYTYDLEGRCVYGTGSAGVTEISY-GDGVTRARDSLGHETTYRFNDLSQVTVTDPLGHTTRYTWDRHDRLLART----------DPLGRTTRHTY 665
359 6.000e-16UniRef50_A0A243QCX0 Type IV secretion protein Rhs n=2 Tax=Gordonia TaxID=79255 RepID=A0A243QCX0_9ACTN  ali  1414..TDFNGATTTYAYDAGGRLADYDGEVTEYSYDSAWRPESVVGAFGRWHSTYTAAGRLASVTTPTAVHTRYGYDSAGRTCDITTSAGTAIDSSWDPVGRLTTTLANRGRTDYQVDVLGRITAAVSPAGTERLTYDASGNITGTTPDDGRTSYRYDPASRLTSMSPD--VWQYVWDVHDRLSVTTPDGTVWTYTYDHLGRRLSKTATGAVTRF................................. 1795
360 6.000e-16UniRef50_A0A1M4WDT1 Uncharacterized protein n=2 Tax=Pedobacter caeni TaxID=288992 RepID=A0A1M4WDT1_9SPHI  ali  45  50.........................................................................................................................................GLVVRQDTSAGTKVYKKNIFGDTVVEDERGRTITFKKDIFGNTVGQYENGEKRVYKKDIFGNNIVVDEMGRTVKFKKDIFGNTIEEDDKGGKKVYKKNIFGDTVVED. 158
361 7.000e-16UniRef50_R9MSD6 YD repeat (Two copies) n=2 Tax=Lachnospiraceae bacterium 10-1 TaxID=1235800 RepID=R9MSD6_9FIRM  ali  17 1671.........................................................................DEEGRIILIEGKHGGILTFTY-ENDRISSSDASGNTIHFTY-EEGRLAATDPEGNSISFAYDSHDWLAITDASGSAYANRYDASGRVVSQSIAGGESAASYDTENRCTAADELGNETKYYYDENRRITKVEQAGTCIRNSWNEKGQLAQTDALGNTTQMLYDKKGRMNCVIY 1847
362 9.000e-16UniRef50_A0A2D5Z8Y5 Uncharacterized protein (Fragment) n=1 Tax=Phycisphaeraceae bacterium TaxID=2026777 RepID=A0A2D5Z8Y5_9BACT  ali  19  811.......................................................................TYDNAGVVRTVTDRRGNRLTFS--QAG---IASSSGRNVTFERDAQRRIVATDPNGQQVRYGYDAANDLTVTDRDDNVTRFVYDGNHRIVIIDPLGRQQRSEYDDEGRLIAIDAEGNRIEHIHNVTGRRVQKDAEGNEFAYVYNDFGDVTSVT----------DPLGNTTRLTY 978
363 1.000e-15UniRef50_A0A1V2SL75 Uncharacterized protein (Fragment) n=12 Tax=Streptococcaceae TaxID=1300 RepID=A0A1V2SL75_9STRE  ali  15  876.....................................................................................................QRDEKGNTTTLDYNENAQLSKITPTGLVFAVTMTDAGYIAVQLPNGATLSYEYDDNGYLTTTDATGVATRYEYDDKGRMTAYDGNGKVIENVYDDQNRVIQTDGTGAVSTLAYSP-GQTVTTDANGHQTTYTYDDQYRTTGITY 1024
364 1.000e-15UniRef50_A0A174ES71 YD repeat-containing protein n=1 Tax=[Clostridium] clostridioforme TaxID=1531 RepID=A0A174ES71_9FIRM  ali  16 1123................................................................................EITQPDGSVKIF--NAYGLLTEKDRKGYKTSYVYDSAYQLQIITPSGKIFEIAQDDEGKITITLPDGGTIHYEFDDQDNLVVTDPEGGVRRYEYDDANHMTAWYDENDSIRNTYDSEGRVTQEDALGNVSTYSY-ERNLTIMKDNRGNHVLYHLDDRGRTVKVEY 1291
365 1.000e-15UniRef50_A0A1G1EBG8 Uncharacterized protein n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 TaxID=1801687 RepID=A0A1G1EBG8_9BACT  ali  16  953..........SYTYDLDNRIVSANGK--SFIHDANGNLIGV---DNKTTYTYDFRDMLIQAS-SDGYNIQYKYDSLGNRIART-ENGATTRYIVDPNRLLSETDDQGNITSYYVYGLGLISKITPGGKAYFYYYDGLGSTVAIDFTGNVNKYSYNPFGKVT.................................................................................... 1102
366 1.000e-15UniRef50_UPI00099F3E7E hypothetical protein n=3 Tax=Streptomyces TaxID=1883 RepID=UPI00099F3E7E  ali  15  937..........SYTYDALGRRATPSGATSTWTFDAAGNITFDHDLAGRIAHSYDALGRLTTTSGQLVQQRAYTYRADGNLVGVEDQLSGTRRFDLDTAGRVTGVHAANWTEKYAYDETGNQLFQDAIGERTRYEHDGLGRIVSRKPD--TWHYEWDAEDHLTVTTPDGTRWRYTYDPLGRRTAK.............................................................. 1165
367 1.000e-15UniRef50_R9IE07 YD repeat (Two copies) (Fragment) n=1 Tax=Lachnospiraceae bacterium A4 TaxID=397291 RepID=R9IE07_9FIRM  ali  568.....GTYI-SYEYDSTGRKTDQNGRSINYTYDCMGRILTVSGSAGQESYTYDAMGNVTSATDADGNVTKYAYTLNGRLKEVTDAHGNKTEYAYDKADRLIYIGEADRTTAYERDAFGQVVCIHDA....................................................................................................................... 697
368 2.000e-15UniRef50_A0A2G6TV33 RHS repeat-associated protein n=1 Tax=Burkholderiales bacterium 23 TaxID=2035215 RepID=A0A2G6TV33_9BURK  ali  12  241.........TTYRYDALGRLTQAGNAASHFAYDPVGQLLSETQALGNATHGYDELGNRTHTRMPDGRTLHWERDALHR--EVRRSQGASSRYDWDPAGRLLRHRAAGHVARYAYDAAGQLIARDSLRGRQDFRYDPTGRILASDPAGNTTHFEYDVHGNVTKRTRGNQVLDLTWNADHQLIETTRHGVTTRYAYDPLGRRVSKSDAFGSTHYLWD.............................. 564
369 2.000e-15UniRef50_A0A1V4VV27 tRNA nuclease WapA n=1 Tax=Pelotomaculum sp. PtaB.Bin117 TaxID=1811694 RepID=A0A1V4VV27_9FIRM  ali  12 1330..TDNRGNNIQYAYDQVGNLTYPDGKQVNYTYDPTNRLTSVTDWANRTTTYYDPNGRLTQTNRPDGSIETRRYDDSGRITQLKDAVINQYDWVYDAGGNITTEDADGNMTTFTYDSCNRLTVV----GSTYNTYDAENQLVKTDPNGINTYYVY-GLG-LIGEESGDTYKSYHYDLRGSTVALSNISGTITFQYGPYGEL-QRISGNSSTPFLYNGRDGVI-TDANG.................. 1624
370 2.000e-15UniRef50_A0A1D3TT84 RHS repeat-associated core domain-containing protein n=2 Tax=Anaerobium acetethylicum TaxID=1619234 RepID=A0A1D3TT84_9FIRM  ali  15  645...............................................TTYIFDSTGKLVRETGRNGLEYVISYNTDGLVTSISDQAGHTCQFEYMNGSLVKITDVNGKTTTYTYDAAGRLTGTDSDGICYRNEYGDFGRVHAQYDGSNPTIFAYDDAGDVTITDRNQKQRKHFFNVKRQLTIIDENGNENTFSYDENGNIASTDALENVENTVYDSHNRVLSRT----------DKMNNVTGYTY 864
371 2.000e-15UniRef50_A0A2K8U6S5 Uncharacterized protein n=1 Tax=Candidatus Thiodictyon syntrophicum TaxID=1166950 RepID=A0A2K8U6S5_9GAMM  ali  12 1759......NVVIDYAYDVAGNRTNRNGTVTTNVYDSNDRLLTETTGATTFRSTYDDNGNLKSR--GNGVATEYQYDAQNRLIGVSGAAGAAT-FAYDADGMRTGRTVGGVTTTFLLDPLAQVVVETRGAHTITYTYGHA--LIAQTQPGFGTSF-YLADGQRSHTNAAGAVTTYSFDAFGVLLV............................................................... 1951
372 2.000e-15UniRef50_A0A1H0S2E1 RHS repeat-associated core domain-containing protein n=3 Tax=Microbacterium TaxID=33882 RepID=A0A1H0S2E1_MICTS  ali  10 1394...DAAGRVSRYGYDKTGNLTRSNGVSTRYGYDAARQVTAITSTTGAVRTQENASGLRASTVDKPGCSTVSSY--LGHRSLPSDPQGATLSYGYDAAGNVTEATPAGAATTFAYDNDNRLTSTQSIGATDDYAYDQVGNVSMVDASGASVTQEFNSLNQLVSATPAGAQT-YGYDADGHRTSVTGGGSGATYRWNELGQLTGYTDPSGSTQFEYDALSRRVSTSTNGA................. 1726
373 2.000e-15UniRef50_A0A1G1LLE8 Uncharacterized protein n=1 Tax=Omnitrophica bacterium RIFCSPLOWO2_12_FULL_50_11 TaxID=1801834 RepID=A0A1G1LLE8_9BACT  ali  18  385............................................................................................................................................TRTLADGTRVHF--NARGQTSVVDRNGHTTTYAYDESGRLTITDPLGLLTTFEYGQDGFLDRTDPAGRVTAFDHDEAGRLTRTDPDGSIREFTYDGRHRLTGET. 490
374 2.000e-15UniRef50_H1CCX0 YD repeat (Two copies) n=1 Tax=Lachnospiraceae bacterium 7_1_58FAA TaxID=658087 RepID=H1CCX0_9FIRM  ali  14  612...............................................TSYAFTKEGDLARIDYLNGNTVQFSY-TGDQLTEISNASG-SLLLEYTG-GHISRTDSTGRSITLTYDGDYLSQVDNPDGNSFSYTYEDGCLTEVSNLKGEVVQNVYDSQGRVVQEVANMGVFDFTYDTDNRVTCTGTDGYLLEIHYDELGRITRSTNAEGTARITYNEENQVTSTDREGNTTRYTHDEAGNISRITY 811
375 2.000e-15UniRef50_A0A209BEF8 Uncharacterized protein n=47 Tax=Actinobacteria TaxID=201174 RepID=A0A209BEF8_9ACTN  ali  17  489..................................................TADGIALVARITDRNQHTISFDHDAYGNLAAVTNSSGMPLRFTYDERARVTSTDTNERRYLYEYDDRDRVAEVDPMGGTVTTSYDPHQHTSTTDQLGCTTTFVNDESGRVVVTRPDGSVVHITYEGGGSPTEINPDGSSWRYTQDERGNVTVTDPLGATAHFARDSAGRLSVTDGLGHTTRYAYSAFGRTSSVT. 804
376 2.000e-15UniRef50_UPI0006920836 hypothetical protein n=1 Tax=Sphingobacteriaceae bacterium DW12 TaxID=1550091 RepID=UPI0006920836  ali  38  109.......................................YTISDNNGNRTTVRKDFSGDYIISDNNGNRTTVRKDFSGDYTISDNNGNRTTIRKDFSGDQTISDNNGNRTTVRKDFSGDYTISDNNGNRTTIRKDFSGDYTLSDNHGNRTTIRKDTFGNFNASDNHGNRASIKKDVFGNISIDDPKGILKSVKYNIIENLFGEN......................................... 273
377 3.000e-15UniRef50_A0A255IKX4 Uncharacterized protein (Fragment) n=5 Tax=Lachnotalea glycerini TaxID=1763509 RepID=A0A255IKX4_9FIRM  ali  13  826...........................................................TITDHSN--TKRIFNEYGYLTQIIDAKGNTITLTYDANYFLQAISS---STGFTYNENGNITAIQPDGNTLTYCYDDSENLTSTNELGITLHYCYDDAHRMTE----------WYDGSG--------DRVVSNTYDSEDRVTRVDANNNECFFTY-QDGKTITTDGTGAQTIYSYDDQHRTTKITY 994
378 3.000e-15UniRef50_A0A1Q4TDZ6 Uncharacterized protein n=2 Tax=Mycobacterium sp. SWH-M3 TaxID=1490482 RepID=A0A1Q4TDZ6_9MYCO  ali  21  288................................................................................AITDAHQNRILFTYDDSGLTSVTDATGATTQFEYDDDHRMVATDSNGAHYVNEYDDTGRVIYTDAIGAHRVYGFDPAGRIVRTDPTGATTTLRYDPLGQVTVTAPDGAVTSFGYDESGNRVRIDPLGRRTEYTYDDFGNLTEISPDGGTTRLSYDRAGRLTSRT. 615
379 3.000e-15UniRef50_A0A1E4LR91 Uncharacterized protein n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A1E4LR91_9BURK  ali  2177.TTDGLGQATTHTYDGTNKRTSPTGATTRYHYNANGVLQQETNPLGHAQYAYDSLGALQGVTDPLGQATTYTWNGQNQLLTQTDANGQ............................................................................................................................................................. 2267
380 3.000e-15UniRef50_A0A286I1D2 RHS repeat-associated core domain-containing protein n=1 Tax=Streptomyces sp. 2323.1 TaxID=1938841 RepID=A0A286I1D2_9ACTN  ali  12 1045.....NGRTMTFTYDALGRRTDAAGNRTTFDHDAAGQLTRTIGDHLALTHTWDPTGRLTSLTTAATGTLQYTYRPDGHLTAIDDSHTGRRTFDLDRAGRVTAVHAADWTETYAYDEAGNQTHATARGERTRYEHDGLGRVTQKTRLSRTWQYTWNGEDHLTVVTPDGTLWRYLYDPLGRRTAKAADGVTTDFSWDG................................................. 1314
381 3.000e-15UniRef50_A0A2K9DXS8 tRNA nuclease WapA n=1 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9DXS8_9FIRM  ali  14 2247.......RVISYTYDVVGNRLNDDGVITKYKYDKNDRLLTE----GEIKYSYDDNGNLISKTGPD-ETTIYEYDYENRLIKTTTIQGNRVEYTYDVFGNLEERDADGNLIAYHYDGLGRLLTDETQSITDTYTYDAFGNIISST--GNTTGEQYDANGRFITADPFGG............................................................................. 2473
382 3.000e-15UniRef50_A0A142Z280 Type IV secretion protein Rhs n=7 Tax=Burkholderiaceae TaxID=119060 RepID=A0A142Z280_9BURK  ali  12  862.....NGSTMRFRYDALGRLVEETGSVTQYGYDAAGRLAQTRDALGRLTFFHDLRGRLTTAQTED-STVRLHYDDAGHLTAEEQALGTVSRHEYDALGNRIRTDPAGRLTRFSYDAAGQLARIDDRTGASEYGYDPVGRLLKAVTPELTERFAFDPAGNPVETDHE-RTARYAREAAGQKSRHDARGVQVTYEYDAHGNLARRRPGGLTWLYRWDAAGRL......................... 1232
383 3.000e-15UniRef50_UPI000673494B choice-of-anchor A family protein n=1 Tax=Gilvimarinus polysaccharolyticus TaxID=863921 RepID=UPI000673494B  ali  14 3524..TTLGAF--TYTLDPTGRRTAINGITHSYSFDDLYRLSYAYDKVGNRTQQT-VNGITTGYTYNANGGIHYAYDNNGNTLTETEDGSVIARYAYNSQNKMVEAVKGGITTTYSYNADGIRTRKTSNGIATHFTVDSNRQVILENSANDKRYYHY--GDDLISQTAQDGYHYYGYDGLGSTLLTDERGAETSYRYDAWGDLLGSTGD....................................... 3753
384 4.000e-15UniRef50_A0A0P7J7T9 Sugar-binding protein (Fragment) n=2 Tax=Neisseria sp. 83E34 TaxID=1692264 RepID=A0A0P7J7T9_9NEIS  ali  17  424................................GLVSRYEYDYDMDGKVLKSHTNLGEAWTFTDALGREEIYGFDENYEEIYHIDADGHRTDTERDDWGRTLQRDELGRETRFGYDTFGNLIITTPDGSRTQIDYHDTLNVAVNDPAGRITEYAYDGRGNLIITDPAGHSTGYTYNEQWPATITDALGKTKQLEYGSDGQLIYIDCSGQATRFSYNEYGDLTVTDALGHTTRHHYDAAGNHIRTDY 654
385 5.000e-15UniRef50_A0A2N2NE00 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-3 TaxID=2013726 RepID=A0A2N2NE00_9CHLR  ali  11 2062...........FTYDAVGNRLTQTTATTQYTYNDLDQLLS----AGAAQYQYDGRGNLARVTDGA-DVTQYAYDAADRLRGVTLPDGTAVAYTYDAAGRRVRQSVAAQVTNYLWDEYGDVVLETDGSGSALASYVLGGELLAQIRGGVMSYYLHDGQGRALSDDSGAATDTFAYTAFGELYSKT--GLTTNYLYTGQ-RLESIIGLYYLRIRNYDPIGRLLTRDP.................... 2277
386 6.000e-15UniRef50_UPI0004147ECA hypothetical protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI0004147ECA  ali  12  986.ISELTSGTRRFDLDSVGRVTAVNGWRESYVYDSAGNLSTTQAPDGRTAYEHDAAGRLISKTNGQKKTWTYTWNAEDRLIEAATPDDGQWTYAYDPLGRVSKTGRNGRALTFTWDGTRLAEQTTSDGQTTSWDY............................................................................................................... 1142
387 6.000e-15UniRef50_A0A0K9NFN0 Putative Rhs family protein n=2 Tax=Dorea sp. D27 TaxID=658665 RepID=A0A0K9NFN0_9FIRM  ali  13 2284.VTDRSGEKTSYKYDTSGCMTRPNGTESVVTYDELNQLTGIEDVNGKVTYLYDLSGNLIEIIRQDGNTTRYGYNERGELQSAV-ASGATITYGYDKAGNKVRITREQSVKENRFSPVNQLLSRDSKAGITTYEYDMDGNLIREGPDEEILTYSYDTENRLAVKDNRSLLQSALYDGDGNRI................................................................ 2489
388 7.000e-15UniRef50_A0A1I2VTZ6 RHS repeat-associated core domain-containing protein n=4 Tax=Duganella TaxID=75654 RepID=A0A1I2VTZ6_9BURK  ali  12 2162.VTDVDGKATTYQYAADGKLVTPDGITARYRYDSNGRLVQVLDANGRRTFEFDAYGRLMRE-QAHGRNTKYKYDKVGNRTERARTSGAVTNYNYDNNDRLSETTSTGNSTSYAWDANGNLLSKAVGGLQTFYGWDADNRLVSQAQAKTVAQYAYDGNGNRVVTGASTESTRYVWDPQGRILAGDDGQAAGSYRYDAFGQVLEQ---GGTTAYRY............................... 2487
389 9.000e-15UniRef50_UPI000989B2E0 RHS repeat protein n=2 Tax=Methylocaldum TaxID=73778 RepID=UPI000989B2E0  ali  12  868.LTDGAGD-TAYQYDVRGRLTDGLSYTTRYGYDDADRLVSLTYPSGRVIYPRDNTGRITEVTFGNGLILTRSFDADGRLTEQTVGTVQHHAYALDEADNIVITDDMGRNQNFTYDALDRLIGANGRYGSRGWSYDEVGRLLETRSAGQTRSFAYDEAGRMVGAREDGRLTTYRYNGLGQRVQKTTF-QTTGYHYDAAGHLIAESGEAG..................................... 1145
390 9.000e-15UniRef50_A0A0F2QVW2 Uncharacterized protein (Fragment) n=1 Tax=Desulfatitalea sp. BRH_c12 TaxID=1629708 RepID=A0A0F2QVW2_9DELT  ali  16 3036..............................................................DRNGTIGKILYDPQGRPTSL--ADGWDTQMTYDAEGNITERDSQNRRVEYTH-TNGRLTTIKDLGHQESFDYDAKGRVTKIDKRGVEEIIAYNGDGLVASVDSEGRKFDYSYDTGTRTIVQNAAGLVKEMWYDANGYLVRVDINGET-----DKDGRDTSVVPDGSTTAKEYDLYDNVTKITH 3227
391 1.000e-14UniRef50_A0A0S8E3A3 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium SM23_29 TaxID=1703776 RepID=A0A0S8E3A3_9BACT  ali  16  360..............................................................................................DNQGRLIKIDRNGNIISILRTSNGIITVSDSSGRKLSFSADAQGKITQIDPAGRIFKYEYDSNGNLIKTIPLNNQTLYHYDTNYNLIQTDANVHSTYFEYDGKDRAYHQDENNNEVTLSFDTTNKITSTDSLGNITKYEYNDYGLVTKIT. 517
392 1.000e-14UniRef50_A0A1H6CZW1 RHS repeat-associated core domain-containing protein n=1 Tax=Actinomadura echinospora TaxID=1992 RepID=A0A1H6CZW1_9ACTN  ali  11  631..TDFNGRTLRYDHDAVGRLVDPLGRVTSYAYDANGRLARATDALGRVISTYDPLGRRIGRQTPSRAEVAWQFDPAGRLRRVHDARGRETQLRYDTADRLTSQDAHSRITHYAYDAMGNITTRDDRGGRTSYEYDPQGRLITTTLSGREWRYFWDAEDRLVLLTPGGDRWRYHYDALDRRIAIAPDGRTTTFVWDGP-LLAEQQRNGTVTMWAY............................... 992
393 1.000e-14UniRef50_A0A1G1HN35 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RIFCSPHIGHO2_02_FULL_42_12 TaxID=1801714 RepID=A0A1G1HN35_9BACT  ali  15  885.VTDWLGKITTYSYDDAGNLFDPNNTKVVYAYDTADRLTYTLDAIGNVTYTHDAENRMTGVTDTNGNMTAFTYDYNDRLVESTVG-GVLTQYKYDGFGNRLVKIEGGTTTRYVQDINGSLAETDAAGAITAYYVYGLGLISKVLPDGTAHYYHYDSRGSTIAITDAGENITYAYDPFGNVV................................................................ 1117
394 1.000e-14UniRef50_UPI000DBEBFC5 hypothetical protein n=1 Tax=Echinicola strongylocentroti TaxID=1795355 RepID=UPI000DBEBFC5  ali  27  47.........................................................................................QLIERNFFGHLEYSSRNGEKALLEKNVFDNLIFTDNQQNNITFEKKYLHQGDMLKNEREERMFLMDLVRQYRRETN--YKATYEIDIFDKLIIQDNRDYKLEIGEDIFGNTRTESINGRRMAFTREKNGGLSYESTT-EKASLRKDIFGHWIYED. 202
395 2.000e-14UniRef50_A0A0X8JNR5 Uncharacterized protein n=1 Tax=Desulfomicrobium orale DSM 12838 TaxID=888061 RepID=A0A0X8JNR5_9DELT  ali  13 3655.................................................RHYDADGRLTAEGGRLGVNRSWKRDADGRVTSITDRAGNVSKIVY-KSGQVERIVTPQGETGFAY-VRGRLASVYPSGLAVSYACDDYGYLLEKDNAGRTDEYWYNSQGEMVRHNVNGKTTVKEYDNAWNLLVIHPDNSEEKSEYNAFGQPVRRDPAGTVTAYAYDASGNLLKMTEAQGTSTFTYDARGNQLTAT. 3920
396 2.000e-14UniRef50_UPI000C178708 hypothetical protein n=2 Tax=Streptococcus suis TaxID=1307 RepID=UPI000C178708  ali  17  863.................................................................................................GQLIRIDEKGNKTDLEYNEQAQLKIVSPTGITYGIILNESGYIAIQLPNGATLAYEYDEAGNLIATDAAGAKTRYDYDDKGRMTAYDANGKIVENVYDDQNRVTQTDGTGAVSTLSY-SDGQTVTTDANGQQTTYTYDTFYRTKGISY 1016
397 2.000e-14UniRef50_UPI000889AFE7 tandem-95 repeat protein n=1 Tax=Acinetobacter kookii TaxID=1226327 RepID=UPI000889AFE7  ali  13 1789..............................................QVSYYFNKTQGITKIVEPTGHTLTI------NRNGIFHSTGTAIRFVRDSSGKIITTAPDNSTWKYEYDAADLVKAIAPNGVENLYFYNGQHRLKITDKDDNLIAYEYDADGRLIAMDAKGQRVELIHQLEQNTQVKDRLGRVTTYTYDDYGNIIKEDALGNITVRTFDRYDQLSET-----------DALGRITTWTY 1978
398 2.000e-14UniRef50_A0A2N2HQ40 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-19 TaxID=2013746 RepID=A0A2N2HQ40_9DELT  ali  13 1119...........YEYDSVGNRVRGPGKNEHQAHDAGNRLLEDRDHR----YEYDANGNLVKKTGALGAVTTYRYDDENNLIGVEIALGPLTTYDYDPFGRRISKTVLGRTIRYVYDNEDVILEYDKEARIASYLHDEPLAVERRRPNGGFETYDYDGLGSVTLTDSKGRVQRYEYDSFGNPRASNPLINQTGREYD---------PETGFYYYRYDPAGRFITRDPAGGINRYAY........... 1374
399 2.000e-14UniRef50_A0A0A0C0T2 Uncharacterized protein n=1 Tax=Cellulomonas bogoriensis 69B4 = DSM 16987 TaxID=1386082 RepID=A0A0A0C0T2_9CELL  ali  15  617.........................................................................DLDGRLQNMFDERGDGLTLTYDGDELRSLTDQVGQTLTFTWDE-GRITSATSDGRTVTYEYDRR-LVAVTAVDGATTRFDYDETGAVSVTDPLGNVRANTYDPQGRLSQVDQLGEVTTFAWDAEAEITVTDPTGAVRVDEYRGNNLVRQVDPNGAVVETLYDANNNI..... 793
400 2.000e-14UniRef50_A0A2R4EPG2 Type IV secretion protein Rhs n=9 Tax=Acidovorax TaxID=12916 RepID=A0A2R4EPG2_9BURK  ali  12  979....LGRYAWRHAYDALGNRTDPGGRHVQWLYYGSGHLHQIR-VDGHVLSERDALHQEIERTQGA-LESRYGWDPMGRLVAHKVPSGDRIQYRYDPTGNLIATDGLRGDSHYRYDPLGRLAAQRGDGERETFAFDPAGNLLQRDPHNRLTRFAYDLHGNVTERRIGWHTVRFAYSPEHQIIATTE--QVTHYRYDALGRRIEKRDAFGRTAFLYD.............................. 1273
401 2.000e-14UniRef50_A0A1Q4FH90 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 69-70 TaxID=1895869 RepID=A0A1Q4FH90_9GAMM  ali  12  856...........YAYDGLGNRVQPDGRVLSQRFYGPGFLHQIALDDDVITETVRSQGALTSYFDDDVVERRYVYGADGNLAAVSDRRFGQTAYAYDALGRITRANAE----RFAFDPAHNIV--DAPQQAVR-----SNRVVAYDDK----RFRYDTHGNLIEKRIGGHTMRLHYDPEHRLITRNGVRQSVTYGYDAFGRRTWKRDAFGTTEFVWD-GNRLLQELRRGRCLTYVYD.......... 1099
402 2.000e-14UniRef50_A0A1I5CLB5 RHS repeat-associated core domain-containing protein n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1I5CLB5_9PROT  ali  18  518.......FLPTAEIDPLGFSYDDRGNLITHMLGDGTVTQYKYNDRGLVVAITDALGKRQLFEYDQTGRVVQETDCTGSTQRYEYDEHGQMILQIDALGNTTCTSPDGATTRNEYDSLGRLTCEEPMGGRTTYQLRPDGMLAATEPNGQNTRYTRDSTGQLQIENPNGAIYSFEYDRVGSIVVEHSFGYRTTYSYDPVGRLTMATSDGEWTTFEYDSAGQLVAGSNRDSVVSFQYDSAG....... 794
403 2.000e-14UniRef50_UPI000D553025 hypothetical protein n=1 Tax=Dysgonomonas sp. Marseille-P4361 TaxID=2161820 RepID=UPI000D553025  ali  55  135..............................................................................................................................................................DAEIKDEKGNKRTIRKDIFGDLEISDDRGNKKTIKKDILGDVTIEDSKGNKKTVKKDIFGNIEIKDNKGNTTTVKKDILGNIEIID. 220
404 3.000e-14UniRef50_A0A2N2AAZ3 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-8 TaxID=2013789 RepID=A0A2N2AAZ3_9FIRM  ali  1324.......RTTQYQYDPLNKVLRSDGTETGYTYDPAGNRLEKVDKAGETTYSYNQANEMLSLTDGDEGPTTFDYDANGSLLMETRPESRTTSYSYDFANRLVRVDPQDKFVEYGYDGDDNRIVKMAA....................................................................................................................... 1451
405 3.000e-14UniRef50_UPI000479C30C RHS repeat protein n=1 Tax=Butyrivibrio proteoclasticus TaxID=43305 RepID=UPI000479C30C  ali  14 1331..DDLGRLTKSYKYDAFGNRTTEADTKTSYEYDALDRLTRVRDSSNNETYSYDRRGNQVALTSGDIIKKTFKYDAMGKMTHATDTEKGDISYTYNGLGRVESVRPE-EKIEYLCDDYYNLLERTVNGETESFIYD--NNVVSMNRGGSNYYYLQDELGSLTGTDGL-TVDAYAYDDFGRRVLRNRLGKEKSHAYTKNGNIIQ........................................... 1556
406 3.000e-14UniRef50_A0A1C5TA84 Cell wall-associated polypeptide CWBP200 n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1C5TA84_9CLOT  ali  15 2273.ITYADGTKVSYEYDKNDNLTDREGKVTTYTYDAINRVTRIHRPNGISTYTYNARNQIVEVSDYL-----YTYDDRGFIAGET-AIESLAGYAYDDKHNGRHEDPHGNRHTFAY----QIVETD-----RTFTYDAAGKLTATETEDNVYTFEYDLMGNRTEKTLNGTVVRYEYNESNQLISEKYNGKKTTYTYDADGNRISETGRIGTRTYEYSVENRLAAVDGDELLLAAAYDGDGNRV.... 2546
407 3.000e-14UniRef50_A0A2K9EMT2 tRNA nuclease WapA n=1 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9EMT2_9FIRM  ali  15  185...EAGEIISSYKYTPAGNRIRTNGRVIKYTYDDTYKLIYTYDAVGNRLSK-SVNGVVTEYTYDANNRTVYTYDKNGNTLSKKTNTGEEVTYTYDYNNRLTKVNITGATVEYAYNVDGRVQKVVDGTNITNYLVDENRLLEERDGEGNTVSYIY--GDDLISQKRGDSFSYYHYDGIGSTALTDIHGNITTYTYDSFGMLTSRT---GTTENDY............................... 427
408 3.000e-14UniRef50_UPI00022E201C RHS repeat-associated core domain protein n=3 Tax=Saccharomonospora TaxID=1851 RepID=UPI00022E201C  ali  16  711............RFDALGRRVSPTGAESTWTYDARDTVTFDHDPRGHETERRFADGLVEQEVSAPGHRRSYRYTPDGNPGVVVDSTEGTTRLELDPVGRVTTLDGYGRRESYTYDPAGNIRTAGWRSQGSEFEYDGS-RLTRTAGLG----YEYDGQGRVVSRWHRGRRWRYLWNAEDQLTVTTPDGTRWRYRYDALGRRIGKSPDGAAVT.................................. 954
409 3.000e-14UniRef50_A0A085WJS1 Uncharacterized protein n=1 Tax=Hyalangium minutum TaxID=394096 RepID=A0A085WJS1_9DELT  ali  14  890............TYASRGNGMTELGYGWMHSYGMNGSLTYITEDWREVTFTAPPGWYLTLTVLSDGYRLRYEFNSSRRLRSISEPGGSRVDILY-ANGLPSEVRDSDNEVSFGYTDGKLTKVTDRANRTVRYAYEGDDLVGAVDVLNNMETYAYDDAHNLVRTDKRGKVWVTLYDALDRWVSINPLGHKASAFYDTVNRRVYVDRLGNEWQREHNAAGNPVVVDPLGNRTERQWDTAHNLTQE.. 1144
410 4.000e-14UniRef50_A0A1C6R0P4 YD repeat-containing protein n=1 Tax=Streptomyces sp. AmelKG-E11A TaxID=1100822 RepID=A0A1C6R0P4_9ACTN  ali  14  601.................................................................................................................................ISYGYQDRDLTTVTKPSGATTTFVYDDRRRLAWIDSNGSRYDYVYDDRDRVVVTDPLGRTTRFTYDAHNLLTRTDPLGLSTVFSYDTNDRLLVTDQAGTTTRYRYDHAGRLTSVT. 809
411 4.000e-14UniRef50_A0A1W1HLL0 Uncharacterized protein n=1 Tax=Nitrospira sp. ND1 TaxID=1658518 RepID=A0A1W1HLL0_9BACT  ali  23 1870...........................................................................................................................................TSLRDRNGNQTTYAYDGSGRLTITDPTGQVTTLAYSGTTVQSITDPAGRVTQLEYDAAGNLQRRGADGTAVTFAYDAQHRLIRRT----------DARNQVTQYTY 1967
412 6.000e-14UniRef50_A0A286IY71 RHS repeat-associated core domain-containing protein n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A286IY71_DELAC  ali  21  138..............................................................................LAGVEDSNGNGFHLQYDAAGLPVRTD--GVQVGFAYDWSGQLEEEAPAPAQVSYRYSKDGDLSVVDASGLVVRYEYDDAAHTVQVDADGHVTRLERDAYGNVLSTDAQGNITTYQYDARGRTTITDALGRTTRFEWDERGNLLSTTADGSTTRYRYDQRGLPVTIT. 418
413 6.000e-14UniRef50_A0A1F7P8N7 Uncharacterized protein n=11 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7P8N7_9BACT  ali  11 1666LLTLPNQVSTEYQYDAASRLTSATGQELTYQYDPAGNRTRIGGSFARTSATYDAANRQLTF-----GSLILSYDANGNLV----GDGPAT-YTWDARDRLVTVDGPGTVTSVQYDPLGRRNRTAINGTESRSVYDGPNPVQQLDGAGGVATLRTDAAGRILITDSLGSTLQFTYEAFG---KTGVAGTTIRFTYDRTHRFLSEDPLGGINSYRYVDNNPLSHLDPFGKTTVYYY........... 1948
414 7.000e-14UniRef50_Q5H2D1 Rhs family protein n=52 Tax=Proteobacteria TaxID=1224 RepID=Q5H2D1_XANOR  ali  12  340.........................................................MTQIEDACGNHWRFER-RDGHLVRIVGADGVQGRFRHGRIDRLQLHDPATGLTHYRYTDGDLVAAEDALGAPRRFVYRQHRLLQHTDRVGLSFYYDYDRQWRVVHSWGDGGDYRFAYDDLLRETVTDSLGHVSLVKFDE-NRLCEIDPMDGVTVFAYDAVGRVAVTDPEGLCTRFDYDERGNLRTLT. 541
415 8.000e-14UniRef50_A0A0L6Z7Q1 Putative deoxyribonuclease RhsC n=1 Tax=Clostridium homopropionicum DSM 5847 TaxID=1121318 RepID=A0A0L6Z7Q1_9CLOT  ali  20  803...........................................................SYTAPEGEIYTLTKLENGYKIAEKDA----TTYYFMRQGLLTIEDKNENKTQFQYDELNKIIS--PSGKELQISCDSEGRITITMPDGNSVAYEYDSMGNLISTNAKGSRISYNYDDKGRLISFDSKGNVINNIYDDENRVVQEDSKGSIIYIKY-LNGYNETTDAKGNKTLYYYDSQFRKTKIVY 990
416 8.000e-14UniRef50_UPI0003A08C51 hypothetical protein n=1 Tax=Actinokineospora enzanensis TaxID=155975 RepID=UPI0003A08C51  ali  19  427..............................................................................LVAITTPVGGRTTYRYDQAGHLAEVAVVGRSARFGYDDDGRLVSTDGNDEWYRYHYDENGRTVYTNALGHNTTFEYNELGHVVRTDPRGRTILSTWDRFGNLLSRDKLGRVTRYIRDEDGFLGLTRADGASVIVERDDRGQVTRVDTSGGSWHHEYDDLGRI..... 664
417 8.000e-14UniRef50_E1RGQ1 YD repeat protein n=1 Tax=Methanolacinia petrolearia (strain DSM 11571 / OCM 486 / SEBR 4847) TaxID=679926 RepID=E1RGQ1_METP4  ali  12  957......RSTVAYTYDAGDRLLSAGG--TTYTYDNNGNRIQKNELNGTTLYGYDDAGRLAGVSLPGGTSVEFAYDGDGNRLSKSVDSANTTWYVWDVNGVLTETDGEG--TSLSLYGLQRISMTNSSGEQIYYQYDGLGSVRLSDGSGNTVAYSYDAFG....................................................................................... 1110
418 9.000e-14UniRef50_A0A1S1QKG9 Type IV secretion protein Rhs n=3 Tax=Frankia TaxID=1854 RepID=A0A1S1QKG9_9ACTN  ali  11 1054.VDD--RRVTS-EYDALGRRTTPSGAVSDWEYDAAGRPLALRTAGRALLFAHDAAGREIERLLAPAATLTQAWDANHQLLSQTVTAGQRRDFGYSPDGYVTEIDDLGGLRRFDLDPMRRVVAVTGSEWQERYAYDTAGNVTATWPVAGTSQATR-GAGGVSQTGPASGARDRSEDGDERGVREYRRAGAVRYEHDAQGRVTRRRLXGRTWRYAWDADDRLTVTTPDGTNWRYRYDPFGRRVTK.. 1359
419 9.000e-14UniRef50_A0A1H9RZL2 RHS repeat-associated core domain-containing protein n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1H9RZL2_9ACTN  ali  11 1004........TRRFDLDGTGRVTGAHGWRETYAYDAAGNLTSAEAPDGRTAYAHDAAGRRISKTNGQQRTWTYTWNAEDRLSGVTTPDGAEWTYTYDPLGRRVSKGPDDEAVVFAWDGT-RVAERTADGRTTTWDYDTHRPVAQTD..................................................................................................... 1165
420 9.000e-14UniRef50_A0A1B4HPE3 Sugar-binding protein n=12 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1B4HPE3_9BURK  ali  14 1095............................HYRYDLAGQLTHVEDSRGLSDYRYDPIGRLIESIGP-GGTERFAFDPASNVIDARSPDQARTQLEYDAQGNLVETRAAGSLQRFEWDGFNRLTETEARRSEARYFYDAFGRRIAKEVDGVVTTYGW--EGNLAYESGATSSTHYVY....................................................................... 1274
421 1.000e-13UniRef50_I2NVH5 YD repeat protein (3 repeats) (Fragment) n=1 Tax=Neisseria sicca VK64 TaxID=1095748 RepID=I2NVH5_NEISI  ali  11  783................NGQSKDEGINRTRFEYDPVGNLTKARNQHSSVELAYDELDRLIGETNGQSATVGYQYDPLGNRIRTILPDGRHIDYLYYGSGHLHQISLDGEVITIERDKLHREIQRTQGSISSLYDYDPMGRLKSQTPRGKQRRYAYDKAGNLISADQRSGVLNYVYDKIGRI................................................................. 969
422 1.000e-13UniRef50_A0A2G9Y998 Uncharacterized protein (Fragment) n=1 Tax=bacterium (Candidatus Ratteibacteria) CG23_combo_of_CG06-09_8_20_14_all_48_7 TaxID=201  ali  23  480.................................................................................................................................TKYYFNIEGKLTIEDRNNNTQTFAYTDDNLTEITDSSGRSTTLAY-ADGKLTITDPAGNTTTLQYTADNLTRVIDPGINTTTYTYDEDNRLISKT----------DPNGNTITYTY 586
423 1.000e-13UniRef50_A0A1G4TSM1 Intein C-terminal splicing region/intein N-terminal splicing region/RHS repeat-associated core domain-containing protein n=3 Tax=  ali  16 1181.........................................................................................TVYEFSSAGRLLSLNKQGQALSLSYNASGQLASVTEPGIGIGLTYDANGRLVVQDPLQRQVKLSYDAKGQLKITDPAGQETVYSYDDKGRILTAAEQGTRTSNTYDSQGRIIAQQDAGHRTKFEYEKDGTLVVTDREGSVNVLTHDALGQETSYTY 1358
424 1.000e-13UniRef50_UPI00073F6387 hypothetical protein n=1 Tax=Paenibacillus senegalimassiliensis TaxID=1737426 RepID=UPI00073F6387  ali  15  653.........................................................................NEQGQLIRTNNSYGQSVELKYNHTGLLSQIVETGVSIELTYTTE-QVIVTDSANRTATFEYDPQGRMIRTDVGGYITTYTYNAKNQIVKIDGDGAILNNQFDVHDRVAQQDAFGYTTSFQY-GNNRVTTITNEEQIRTIAHNSKLQLISTTAAGDSVEYEYDAQGRRIQEQH 832
425 1.000e-13UniRef50_A0A0C1U4E9 RHS repeat-associated core domain protein n=1 Tax=Clostridium argentinense CDC 2741 TaxID=1418104 RepID=A0A0C1U4E9_9CLOT  ali  15 1721.....GEETTRTVYDSLGRKVKEVSNLYNASLD--NIYSHAYNGDHGVRYTYHNNGNIKTIINEENNQATYDYDIYGNKIYEKLPSGVIYTYEYDSVNRPIKKYDVNAVLEYEYEIVNTVKGIGTKKAIKTYTYDYKDRVKVINSDGTAYAKSYDALGNIAYEDARGNTSYYKYNGLNKISSEDEDGDVKGFEYDKNGNLIKETEEIFEKNYEYFKDGMLKAEDNEGRGKEYEYDKDNNLSKE.. 1999
426 1.000e-13UniRef50_A0A0Q8DH27 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0Q8DH27_9GAMM  ali  13 3240..........TYTVDNTGLRTSSVGRTVTYQYDALKRLKREVDSRGNRTTTYDAVGNRLTQVRTKAGVTTYTYDVNDRLQREDVGGGGAVQYRYDANGSLIERSDVAGLSMYSYDGGDRLVAVTPTGAM-SYRYDPAGIRQAQTVNGVTTRYVVDARNDQVIEEHTGARAVL-YDRIGR-----SDGGQTVYLHDGLGRLLTTSAGAAADRY................................. 3458
427 1.000e-13UniRef50_A0A179I0Q0 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A179I0Q0_9HYPO  ali  18  168...........................................................................DEQNMTPAYKSGFMTAWRRDEGRMTAWKDDDGKMTAWKSDDGKMTAWKSDDGKMTAWKSDDGKMTAWKDDDGKMTAWKRDEGRMTAWKSDDGKMTAWKRDDGKMTAWKDDDGKMTAWKGDDGKMTAYTYKSGFMTAW................................. 304
428 1.000e-13UniRef50_A0A0J9FGN4 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=A0A0J9FGN4_9BACE  ali  44  32.......................................YEYSGVNQERKTVEKDIFGNIIIRDDKGNRKTIEKDIFGNITIRDDKGNRKTIEEDIFGNTIIRDDKGNRKTIKKDIFGNTIIEDGKGNRTTIKKDIFGNEIIESSDGHRKIIKKGIFGNTVIED................................................................................. 156
429 2.000e-13UniRef50_D4JKV6 Rhs family protein n=8 Tax=Bacteria TaxID=2 RepID=D4JKV6_9FIRM  ali  16  290.............................................................................................................ITFIRDERGRLAAETDTGSFLEYAYDSEGMLKVTDHAGRKVKLEYDGDMLKTVTTPSGAVYTYSYGDNGRITETVNARNVTRNRYDSLFRVTQEFPDGGTMDFEYDDKNRVTLTERNGSRITYVHDSRYRNTVTLY 431
430 2.000e-13UniRef50_A0A0S4JZN9 Rhs-family protein n=5 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A0S4JZN9_9BURK  ali  10 1002.....GEVITDIERDRLHRATSRTGALTSFQYDPVGRLLAQV--AGHLRYEYDESGNLLAIDDKRNGRKTYSYDVIGRIMSAVQPD-LAERFAFDPAHNL-----LDETVA----SAGRV-----EGNRVRYDYDAHGNLTEK-LTGKHTRLEWNAAHQLVKSNPTAQTVKYAYDPFGRRIAKRDGFGMTRFVWDG-NRLLCEARGKWERTYVY............................... 1222
431 2.000e-13UniRef50_A0A066YKP5 RHS repeat-associated core domain protein n=3 Tax=Streptomycetaceae TaxID=2062 RepID=A0A066YKP5_9ACTN  ali  15  253..............................................................................LRAITDRNGNRIDIEYSAAGRIAIESTNSRITAY------RLIGAGPSEQSAGFRYDGNGNLAILDAAGIPLRLTYDEAGRVTSWTGRGGRYRYIYDRAGRCVQTRGDHGVLVFTYDLERRVTTRDSLGNRTVYQLNDAGQTVSTDPLGGVTTSEWDPLGRTTSYEY 445
432 2.000e-13UniRef50_A0A1V5MJC8 Putative deoxyribonuclease RhsC n=1 Tax=Firmicutes bacterium ADurb.Bin419 TaxID=1852892 RepID=A0A1V5MJC8_9FIRM  ali  17  128.................................................................GNGNKYIFDSAGQLVRLEDRNGHYITLTRSEESMVICEPASNQTLTVVYNEKGLVEVEDKTGRKTSFKYDENNNLIITDPNNKTASYTYDSNGYVLSGKDGDEITTNTYDEKGRVLTQDDAGNETTFSYDETSETTIKDRNGNTSKRVHNRLGQLVRLE----------DELGNETTYTY 309
433 3.000e-13UniRef50_A9C332 YD repeat protein n=3 Tax=Delftia TaxID=80865 RepID=A9C332_DELAS  ali  15 1547..............................................................................LQSITDTNGNALTLTYDDAPLLQVQNAYGQSLQFEYDAAGNLTRTDAPEATESYSYDHTGLLSHTNALGQATQFKYHGNGQIPVTAADGAHTAFAYNATD---VTDARGKLTRYAFNKYGNPLTIAGPAGTTSMTWNDVLMLSKTDANGVVTSYTYDANGNQTSE.. 1776
434 3.000e-13UniRef50_A0A2P6UA22 RHS repeat-associated protein n=5 Tax=Thermomonosporaceae TaxID=2012 RepID=A0A2P6UA22_9ACTN  ali  15  269........................................................................................................PDGITIRYGYDADGHLAVVNSSGQPLRFSYDDNARLTGVDRNGFWYRYEYDEEGRAVRGVGKDGYLTLAYDPANRTTVTDSLGHATTYRYNEQFQVVETDPLGNTVRREWDRFDRLLSFT----------DPLGRTTRYTY 406
435 3.000e-13UniRef50_A0A1Z4LTJ0 YD repeat protein n=1 Tax=Calothrix parasitica NIES-267 TaxID=1973488 RepID=A0A1Z4LTJ0_9CYAN  ali  12 3267.VTDRQNNITTYSYDLVGNLIFANGIIETRQYDLLNRLIENTNSDNNIISSYDNVGNRLVLEENTGRRVEYSYDDLYRLTSVTDATNGTTNYVYDNVGNLTETN-NGIVTNYSYDDAGNLITTATNGQTIEFQYNTDGIRVATTVDGETTNYHADALGSRIITDNAGDIAAYIYNPYG................................................................... 3547
436 3.000e-13UniRef50_A0A2G1UKX1 Uncharacterized protein (Fragment) n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2G1UKX1_9ALTE  ali  21 2543...................................................................TGYYSGPVDPDRYELTTQAGYIYTLNQD-FGIEKVVDPNGHSLRYTND-----GIFHSSGKAVTFQRDSHGRLALTTPGGDQLTYHYSSDGDLEASDALGNTTAYTYNNHGLLDIIDPLGRTLVRNYDESGRLIAEDSDGNRTDFNHDVEGRSVVTDRNGNTTLYYYDDRGNVTTK.. 2718
437 4.000e-13UniRef50_A0A1Q8CEL1 Uncharacterized protein n=1 Tax=Actinophytocola xinjiangensis TaxID=485602 RepID=A0A1Q8CEL1_9PSEU  ali  18  442..............................................................................................DPDGTLTIAQADGHTLRFAHDESGRLLPTQPDGKETRYRYDAAGNLAVTNSSGRPQVFGYDADARIVSRDRADTHYRYHFDAQGRVTVEDSLGHRSEYHHNALRQIVATDPLGATTRFEWDRYDRLTSTDPLGRVTRCGYDTAGNRT.... 667
438 4.000e-13UniRef50_UPI000349E89D hypothetical protein n=2 Tax=Synechococcus sp. PCC 7336 TaxID=195250 RepID=UPI000349E89D  ali  12  751.ITEHDGRITQYEYDDVYRLTDPDGRTIDYTYDALGNRLTRIDSLNTITYSYDANGNLLSRTSDTSGTTRFIWNDSNRLVGVELPNGDEISYIYDQAGIQVSSTINSETTTYVVDSN................................................................................................................................ 902
439 4.000e-13UniRef50_UPI00068CB754 hypothetical protein n=1 Tax=Kitasatospora azatica TaxID=58347 RepID=UPI00068CB754  ali  18  513......................................................................................GARWPLALDSEGRYTVTDPSGHIRTFTVDPANPELATDRPGHRLTFDYDHDGRVTVINSSGLPLRFEYDDAGRMTAIDRNNSRYDYAYDEQGRTIATNSLGAVEQYEVNESHQITATNALGHTTRFTRDRYHRLSVTDPLGRTTAYEYDATGNVITVT. 741
440 4.000e-13UniRef50_A0A1B6AT65 Uncharacterized protein n=1 Tax=Streptomyces sp. NBRC 110611 TaxID=1621259 RepID=A0A1B6AT65_9ACTN  ali  12  874.MTDATG-TTRFDYDKVGNLTEPDGGVVKAGYDKAGHLSQLGYPDGEVDYRYTPNGRLIAMADPDGRARRYAYDRDGRPAARTDPDGRILTFRYDRLGQLV----NARTWTYTYDAVGNRTVRCLGDTETHYRYDDADQLVSSRSHGLHTRYAYDSSGRLTEVRTGDCHQRISYDGFGRRAVTDAPREEAEATYNGDGLLTR........................................... 1161
441 4.000e-13UniRef50_UPI000C783702 hypothetical protein n=1 Tax=Dysgonomonas sp. Marseille-P4356 TaxID=2040292 RepID=UPI000C783702  ali  44  137.................................................KKVRKDIFGDTIIEDSNGNKTTVKKDIFGDTIIKDDKGNKKTVKRDIFGNTIIEDSDGNKTTVKKDIFGNTIIEDSKGNKKTVKKDIFGDYTIE...................................................................................................... 230
442 4.000e-13UniRef50_A0A117KEZ9 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium CRH TaxID=1742859 RepID=A0A117KEZ9_9FLAO  ali  41  20............................................................................................................NIIYKKDSSDNTIIELEHNQNATIQKDFFGNTIIEDEYGQTALLKKDVFDNIIIENEKGQIAKQKKDVFDNIIIEDGKGQIVKQKTDVFGSIIIEDGKQKTAKQKTDIFGNTVIENGKGQIITRQKDIFGTLMIDN. 161
443 5.000e-13UniRef50_UPI00099D0D5D hypothetical protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI00099D0D5D  ali  15 1162...........YTYDATGNRTYPDGRTTTYTYDGDGRSTAQYDPAGHLTRTYDAAGRLKSTVSAKGGTQNYTYDKAGRLATATGCTAGALTYTYDKVGNRLTQNDPTGTTTYTYDAADQLTKTTAPTATTTYGYDANGNLTAGTPTSNTVRLAMQSDGNLVITTNPGATATLQ--ADGNLVVQDANHATLWTSYTSAGKRIWASDDTGTLTYTYDAAGRLTTATGK-STQTFTYDPFGNRATST. 1512
444 6.000e-13UniRef50_A0A1F7MWK5 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium RIFCSPHIGHO2_02_FULL_73_26 TaxID=1802102 RepID=A0A1F7MWK5_9BACT  ali  10  252LLTLPNGVSTEYQYDAASRLTSPSGI------------------LGDLSYAYDPAGNRLRITLLPGAVASATYDAANRQLTF-----GSLTLAYDANGNLLS----DGTTTYAWDARNRLVALTGPGLAASFQYDPLGRRSGKTLNSGATRFTYDGVNPVEVADPTGAAT........................................................................... 406
445 6.000e-13UniRef50_A0A1G2VI36 Uncharacterized protein n=1 Tax=Parcubacteria group bacterium RIFCSPHIGHO2_02_FULL_48_10b TaxID=1817741 RepID=A0A1G2VI36_9BACT :_  ali  14 1055...PPLRAIEEYAYDGAGNRIGPQQNQ-SYTYNSANELLQVK----NILFAYDNSGNVIEKTDADNGTFTFTYDAENRLVAVKTDDGETTTYVYDPFGRRIEKQVNGTVERFFYDNEDILFIADNNNRVVS.................................................................................................................. 1182
446 6.000e-13UniRef50_UPI000DD4B4BC hypothetical protein n=1 Tax=Lentzea sp. NEAU-LZS 42 TaxID=2200761 RepID=UPI000DD4B4BC  ali  14 1552.....GAYDVTAQYSTNGQVTSLTSGTTAFGYDAAGRLT----SAGTATYGWDADGNRTEAS-----TVQSTYDAANRLTGASDGSAH----TYDADGNLTDVTRSGTTTHYSYNGFGELVAANNGATSVTYGRDALGRTTSSGGD----QLSYDPSTRLSQFRAGTTRTDLVRDPSGLLAETTQGGGSSRVFHNLHGDVGMVFNGTVQQTKTYDAFGNAAST...................... 1757
447 8.000e-13UniRef50_A0A2N3XJ20 RHS repeat-associated protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A2N3XJ20_9ACTN  ali  14  319.....................................................ASGYSLKTTDGR----TLSYDSAGRALAIKDKQGRQVTYTRNGDGRLSLTNSIGRQSDFSYDSDGKLSQITSDGRHIKFEH-SGGRLTVTGVDGRSIAYEYDSNGLLTVTGPGGAVLHNTYDSKGRVAQTNALGSTAKFSY-KDGETDVQEPDGGIWTDIY-----------SGNVLLAQYDPFGNKTSYAY 499
448 8.000e-13UniRef50_A0A1F7PPQ3 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_71_22 TaxID=1802110 RepID=A0A1F7  ali  12 1151LLTLPNQVSTEYQYDAASRLTSATGQELTYQYDPAGNRTRIGGSFARTSATYDAANRQLTF-----GSLILSYDANGNLV----GDGPAT-YTWDARDRLVTVDGPGTVTSVQYDPLGRRNRTAINGTESRSVYDGPNPVQQLDGAGGVATLRTDAAGRILITDSLGSTLQFTYEAFGKTGVAGTTSNPIRFTYDRTHRFLSEDPLGGINSYRYVDNNPLSHLDPFGKTTVYYY........... 1433
449 8.000e-13UniRef50_UPI00073F08A6 hypothetical protein n=3 Tax=Paenibacillus TaxID=44249 RepID=UPI00073F08A6  ali  19  452..................................................................................................................................TYLFDADGLLTSIDLNGNEVTLAYQGE-NLQQVTTDGATFTLSYNGSGQLVVSDHAGRKLEYGYDGAGDMVSTDVDGAVTKFSYDGAHHVISVTAPGQTAEMTYDEEQRVTSLT. 569
450 8.000e-13UniRef50_F4KRN7 RHS repeat-associated core domain protein n=1 Tax=Haliscomenobacter hydrossis (strain ATCC 27775 / DSM 1100 / LMG 10767 / O) TaxID=76  ali  13  918...........YNYDKLGNRTRELNNTQTYAYDAIDRLVQVVNPLRQAKYTFDAIGNRKT---AEEQQQSKTY-ASNTLNQYTNISQGSTTLTYDKNGNLTF----DGQFNLGYDPENRLTRVDN-GNTALYRYDALGRRIQKIIKQDTTFYLYNGLDLIEERGNRGLKASFVYNNIDQILSMQRNGKNYYYHTDPLGRKISDEAGKVVEQYEYDAYGQARVYNASGQ................. 1147
451 8.000e-13UniRef50_A0A2P9DR39 Biotin carboxylase subunit of acetyl CoA carboxylase, putative n=2 Tax=Plasmodium (Laverania) TaxID=418107 RepID=A0A2P9DR39_PLARE  ali  21  883........................................................................KDNISNDNIYKDNISNDNIYKDNINNDNIYKDNINNDNIYKDNINNDNIYKDNINNDNIYKDNINNDNIYKDNINNDNIYKDNINSDNIYKDNISNDNIYKDNISNDNIYKDNISNDNIYKDNISNDNIYHTDKTTNEKNNKNLLHYNNYRNQN................... 1036
452 8.000e-13UniRef50_A0A178X2Q1 Putative deoxyribonuclease RhsC n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A178X2Q1_9PSEU  ali  16  547........ITNESGLPFRYAYDSMGRIVGWTDRNGEWYRFHYDREGRVVR---------TEGSGDCLTVTMEYDLAARITHVVDSLGRHNAYHLNETGRVVREDPTGAARAYEWDALDRLVGETDELGRRRIYRYDDRNNLVQRADGTGLTIERNDFGQAVMVEAPGVETRWEYDERGNVTVVEPGGGTTSYTYDEWGHVAVTGPNGSTLTVVSDDAGNPTVTDPSGATTAYTYDCFGRVT.... 777
453 9.000e-13UniRef50_A0A2N5G679 Uncharacterized protein (Fragment) n=3 Tax=Bacillus TaxID=55087 RepID=A0A2N5G679_9BACI  ali  646.VTDPEANVTSYTYDGKGQKASANGIVTTYEYDEADQLTSLKNKGSSLSYEYDQVGNRLSETDEHGYKTSYAYDDLYRLTEVTY................................................................................................................................................................. 735
454 1.000e-12UniRef50_A0A0M6WTD0 Uncharacterized protein n=1 Tax=Roseburia inulinivorans TaxID=360807 RepID=A0A0M6WTD0_9FIRM  ali  18  270..........................................................................................SMQFDKMGKLVREDINGRGITFSYNESGLLTACADNGNIFSYYYNEKNLLVVEDQSGRKILLTY-KENLLTVTLPDGGVYQYQYGVDGRISHVENAGGVTTIDYDNKHRITRQKPDGGVMEFLYDDVKRVICTDRNGQKIIYVHDNLYRHTETLY 431
455 1.000e-12UniRef50_C7Q0B8 YD repeat protein n=1 Tax=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) TaxID=479433 RepID=C7Q  ali  15  474..............................................................................LIAMSDRSGNRVEYIRDALGTPVEVRHSGG-YRVAVD-----LRETASGQRIS-----ALRLVGDDAESALIGFGYDERGRLSRVDPEGNSLQYSWDEQNRITGQDRLGMDYHYTYDERGRVVHGQGNHGTASFDYHDEERFTVTDSDGNVTRYGYDERGRIVAVT. 634
456 1.000e-12UniRef50_A0A0B5EV03 LipX3 n=1 Tax=Streptomyces albus (strain ATCC 21838 / DSM 41398 / FERM P-419 / JCM 4703 / NBRC 107858) TaxID=1081613 RepID=A0A0B5  ali  16  476..............................................................................LTEIRDRNGNTVTLRHDAEGLPTQLAHHGG---YRLGENGRITALTDETRLLTYSYDDAGNLAIVDSTGTPQRLSYDEARRITWQDRNGSRYRYEYDSADRCVATTGDGGDYRFRYDLAGQTTTVNSLGHATTYRFNDACQLTETDPLGHT-----------VSRTY 642
457 1.000e-12UniRef50_UPI0009E526AB hypothetical protein n=2 Tax=Micromonospora TaxID=1873 RepID=UPI0009E526AB  ali  13 1200.VTRQGGPSSAYTYDRAGSLT-----RVAHTSGSTMLVSQDV--------TRNLAGAPDTVTTTRGGSTSYSYDDIGQVTRVCRPAAGTTSYGYDHNGNRKSKSGSTSTTTYAYDDDDRPTGRTVNGATTTLTYNANGALATEVGPGGTTTYGYGLDANLRRVQPPGPVVGYDYDEDGNRIGRTVNASTATWTVDTLGLPTRVEEKNGSGTLT................................ 1415
458 1.000e-12UniRef50_L0DIM5 RHS repeat-associated core domain protein n=3 Tax=Singulisphaera TaxID=466152 RepID=L0DIM5_SINAD  ali  1935.MTDSLGGVVSYSYDQMGRLYRETQSRVDFGYDLNSNLTS-------LTRYSDLAGTSTVLVSA------YTYDAANRLTDLVHETGTVVSYTLDAVNRLTQEGTTSDTLNYSYTNDGQLKGITHSNGSESFGYDSNGNRITSD---GTFNYAYDVEGNLTSKTSSGDETLYKWDYRNRLIEVDQLGGSITYTYDAADRRIGVT-EGGATRWT................................ 2174
459 1.000e-12UniRef50_A0A014M3M7 Uncharacterized protein (Fragment) n=3 Tax=Streptomyces TaxID=1883 RepID=A0A014M3M7_9ACTN  ali  15  44.....................................WAYEYDPAGRL----------TSETDFDGRTLTYSYDAAGQLTARTNALGQTISYAYDTLGQVLTKNADGALTTYAYNPAGRLLQATGPDATITYRRDRLGRVESETCNGRSISFTYDSVGNRTSRTPSGATSTWTYDATGRPTALTTAERTFTFEHDPTGREITRR-LGETLTLKHNPTGRLTAQTLTGPDAR.............. 229
460 2.000e-12UniRef50_UPI00031A9C42 hypothetical protein n=1 Tax=Nocardia otitidiscaviarum TaxID=1823 RepID=UPI00031A9C42  ali  1501....PTGSETRWRWDWSGRPTDTDGHTIGFTHDLAGQLTEWTIGELAITNAYDPLGRLQQQTRPDGSRLDYTLDPIGRVHRLTRNGALAEQYSYDSLSNITETTAPDGSTRREY--HNNLLIRD---GRTRYHYDAAGRLITTTRLSRVWHFRYDAFDQLTDVWTPGQEWHYTYDALGRRTTKTRLSTVGTYLWDDTNLIEQTTP........................................ 1773
461 2.000e-12UniRef50_G5GIK0 Uncharacterized protein n=2 Tax=Johnsonella ignava ATCC 51276 TaxID=679200 RepID=G5GIK0_9FIRM  ali  10  889..........RYEYDPVGNVTMVDGLKTHYTYDSMGRMTGIQNDTSKFSYEYNVAGEITRITKPDKSVEQRSYDVMGRLVKVDDSTGNESEYKYDKNNRLIEEDGFGNITRYEYNSLNQLTKINPDGRNTSYEYDKKGNLISLKEGGETVAYKYGAAGRMIKASTKAGDIDYRYDALGHLVR............................................................... 1159
462 2.000e-12UniRef50_A0A2G7AW76 RHS repeat-associated protein n=5 Tax=Streptomyces TaxID=1883 RepID=A0A2G7AW76_9ACTN  ali  11 1019........TRRFDLDGIGRVVRAHGWTETYAYDSAGNVVRTTGPAGRTTYEHDPHGRLVRKSNGRSLTWTYTWNAEDRLTEAVTPEGDRWRYTYDPLGRRTAEDGSEARTEFTWDDTRLAERTAPDGRVSTWDYDSHRPVAQTD..................................................................................................... 1185
463 2.000e-12UniRef50_A0A2N1KNX0 Uncharacterized protein n=1 Tax=Siphonobacter sp. BAB-5404 TaxID=1864824 RepID=A0A2N1KNX0_9BACT  ali  12  153.............................................................................RLTRMQDLDGNQISLAYSDTLLQSLTHSSGHTLQFTW-TQGRLATIEDPERKLTYEYDQDGNPSVTNPLGRITGYSYNRNGAVSRVNGQNVVTTYTFDEKGRVIEKNGNGYHLEYGYDANNNIIRTDGNKKATLYAYDARGNVLKTDPAGQVTSYSYDQLNRVTSIT. 373
464 2.000e-12UniRef50_A0A2A2T6T9 Uncharacterized protein n=1 Tax=Comamonadaceae bacterium NML91-0035 TaxID=2029113 RepID=A0A2A2T6T9_9BURK  ali  13 2560.VTGAINQTTTYQYDANDRLTDSIEGTTSYRYDRKGNLVEKANGNNKTAYSWNSDNRLIKVTGQNNKTIQYGYDPQGRRIKVTQGTSKTTHYSLDSEHEVVVESTRVNTTHKTYGGVGELISQ-SDGATTKQIYDAQGRLI---ADGNTSRYSFDAFGN...................................................................................... 2735
465 2.000e-12UniRef50_E4T265 Uncharacterized protein n=1 Tax=Paludibacter propionicigenes (strain DSM 17365 / JCM 13257 / WB4) TaxID=694427 RepID=E4T265_PALPW  ali  32  42...EHGKKIAIYSKDVFGNRVIKDGNGNVMQTISKDVFGNTVDGRGQKVRSIEKNVFDDTVIKDGKGQTTIGKDVFGNTVIKDENNQKVVSIEKNVFGDRVIKDKNGRIISFSKDVFGNTVMKNDKGQTVSIGKNVFGDTEIKGENGQVKTISKDVFGNTIVKNGNGQKVSIEKDAFGSTLIKDGNGKLKSISKDVFGNTVVKTASGS--ISSNPISDDAIKFDDDGN................. 273
466 2.000e-12UniRef50_UPI00099F5767 uncharacterized protein LOC109896486 n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepID=UPI00099F5767  ali  33  315.....................................................................................................MEDDIGESCALEKDSFGHTVERDGFGASQGLERDGFGASLERDGFGASHIVERDGFGHTVERESFGASHTVERDGFGATVERDGFGASHTVERDSFGHTVERDSFGASHTVERDGFGHTVERDGFGASHALEKDGFG....... 461
467 3.000e-12UniRef50_UPI0006B3AE6D RHS repeat protein n=1 Tax=Acidovorax avenae TaxID=80867 RepID=UPI0006B3AE6D  ali  12  890...DAGGKVTHLERDALGRLVSAEDARATYTYDPLGRLTAATNPAAAIAWRYDPVGQILQEVQPEERALSHEYDELGHRTRTTLPDGRALDWLHYGSGHLHQI---GLT------EAGRTVITD-------IERDALHRESQRSQGALHSRYDYDPAGRLVRSASSSATTAYAYDALGQLVARDTLRGSQEFRYDPVGRILAALPGQGSHAFAFDPAGNL......................... 1131
468 4.000e-12UniRef50_A0A291CHC8 Type IV secretion protein Rhs n=3 Tax=Burkholderiaceae TaxID=119060 RepID=A0A291CHC8_BURTH  ali  23  802.............................................................IMPDGSTIEYCYDTEARLTGVINERGQSYQIERDALGRVVAEDYWGQRTTYEYGVNGALASSTSTGRAITYETDPLGR-----------VIRKRLADARQITGSRLE--IFEYDAIGNLVVAENPDVRVEIRYDEEGRVVEEQGDDFTIVSKYDSLGNRIARRDLGDKTRYNYDAVGN...... 977
469 5.000e-12UniRef50_UPI0009E43EE9 sugar-binding protein n=1 Tax=Neisseria elongata TaxID=495 RepID=UPI0009E43EE9  ali  13  932....AGGAVRRYAYDKAGNLIDQRSGVLHYVYDKIGRIQEARNSQGRSTFAFDPAHNILSDKSAEGNGIEYTYDALGNLIYRQLPDGENQYYQYDLENQLVRKKPAGNTWTYAYDPFGRRTSTDP--KRTHFVWDGT-RLLQEYTYKGSYTYIY........................................................................................... 1114
470 5.000e-12UniRef50_A0A0K0GJ42 RHS Repeat family n=8 Tax=Xanthomonadales TaxID=135614 RepID=A0A0K0GJ42_XANOP  ali  13  340..............................................................................IVQVEDACGNHWRFER-RDGHLVRIVESGAEVEARHGRIDRLQLHDPATGLTHYRYTDGDLVAAEDALGAPRRFVYRQHRLLQHTDRVGLSFYYDYDRQWRVVVTDSLGHVTVFAYDAVGRVAVTDPEGLCTRFDYDERGNLTLTRPDGSTLRQTFDDDDRLIAV.. 561
471 5.000e-12UniRef50_UPI0009DD2C0D hypothetical protein n=1 Tax=Cellulomonas sp. KRMCY2 TaxID=1304865 RepID=UPI0009DD2C0D  ali  14  429.........WSRTYNSLDTSTGPFGPGWSFAYNAAGELV-LRDGSGTQTRFYTPVDPAVSATLSAGAGSTMTFDGTGRLTSITDSLGQTLSITWDADARIAVTGVDGKITTFAYTAAGLLSITDPLGYVSRSEFDTSGRVISQDEMGAKTTFAYHTGAQTTVTDPSGRSRQYVYDGEGNASTVDPLGQVFASEYDARDNLIRRTPLDYVETWTYDDANHITTTDPAGNLTSYTYTVSGLLQTVT. 764
472 5.000e-12UniRef50_A0A2X7GZ55 Putative autotransporter heamagglutinin n=2 Tax=Escherichia coli TaxID=562 RepID=A0A2X7GZ55_ECOLX  ali  23  99.........................................................................................PSLEPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPSDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPVPPDDGGDTPV....................... 231
473 5.000e-12UniRef50_H3FX72 Uncharacterized protein n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=H3FX72_PRIPA  ali  26  142..............................................................................................HVFGDTPRLRRHA-TSSATRHVFGDTPRLRRYATSSAIRH-VFGDTATSSAKASRLRRKRHVFGDT-------PRLRRKRHVFGESVTSSAKASRLRRKRHVFGESVTSSAKVSRLRRKRHVFGESVTSSAKVSRLRRKRHVFGELL.... 285
474 5.000e-12UniRef50_UPI0007612AF5 hypothetical protein n=1 Tax=Persicobacter sp. JZB09 TaxID=1085624 RepID=UPI0007612AF5  ali  25  26..............................................................................GHLNYSVGHYRASLKTNIFEDLIFSDNQHNQITFKKKYLDLEHPNQMDLQENRINLDIIHQHKLDKHY--EATYSVDIFDKVLIKDNRNTEIEIGEDFHGNPYYEKINGVKFTVKKDLMGAWIAEGE-FYSATMKKDLFNQYIYEDNKGNELKISRNTYQRI..... 187
475 6.000e-12UniRef50_A0A1S6JIQ7 Uncharacterized protein n=3 Tax=Streptomyces pactum TaxID=68249 RepID=A0A1S6JIQ7_9ACTN  ali  14 1128....AASRTTSYTYDKAGNRTSTLGTTTSYTYDDAHQLTSSYDDEGNQTYTYDLAGQISEVTKDDGLRQTFRHDSEGNLVGI----GGSKSLTWDPNAPLTETTGLTTVKSHRYDPLGQVAAVKANGDVLSYTHDTLGPLDVTDSTGTVHSMAYDPFGNRELSTGTGSTIAPSY....................................................................... 1320
476 6.000e-12UniRef50_A0A0D4E2L8 Type IV secretion protein Rhs n=3 Tax=Streptomyces TaxID=1883 RepID=A0A0D4E2L8_9ACTN  ali  845.VDDQLNGTRTFALDIVGRVTAAQGWTESYAYDAMGNLGTRLTGAGRIRYEYDAQGRIIQKTNPD--TWRYSWDAEDRLTAVTTPDGQTWRYLYDPYGRRTEKQPDGRVTEFTWDGAHLAEQTTTAGDTLTWDYDGMHPIAQTEQKSRT................................................................................................ 1031
477 6.000e-12UniRef50_A0A1I4RX31 RHS repeat-associated core domain-containing protein n=4 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1I4RX31_9MICO  ali  11 1590........TVTYAYDSLDRLTSSSGEKNTYAYDPAGNRTGAKDGDFRQQATFNDANQLTSETAGRGRIASYSYDGAGNRVSQSVG-GTATRFGYNPAGQTTQVSREGRTTSYGYDGLGRRTTATEQTRTTRTSFDGLDPVQSTTTGAGTTTLIRDAVGALAEVTANGEAT---WDLLDRLTVAGATGASITSSYDDWG............................................... 1798
478 7.000e-12UniRef50_UPI00099CFBB2 hypothetical protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI00099CFBB2  ali  11 1119....AAGWSERYAYDSAGNQTEAAGHEASREY-AGTRLTR----AGGVHYEHDAQGRVVRRKTRLSRKWRYEWDAEDRLTAVTTPDGSRWRYTYDPLGRRTRLDADGKTTVFTWDGNEQTTERGDTGGRTTLTWDHDG........................................................................................................... 1269
479 8.000e-12UniRef50_UPI000D68AA66 type IV secretion protein Rhs n=1 Tax=Nocardioides sp. YIM ART13 TaxID=2173172 RepID=UPI000D68AA66  ali  13 1142.IDDTGLGASTFDLDPRGRVTSRGSLVERYAYDGAGNLTAGDDADGRTRFSYDRQGRLVQRVTRLSRVWHYTWDAEDRLVGLTTPDGARWRYLYDALGRRVAKERLGSVTTFTWDGT-TLVEQTGAGGSTSWEYDGL............................................................................................................ 1316
480 9.000e-12UniRef50_A0A1Y6BHB1 RHS repeat-associated core domain-containing protein n=2 Tax=Alteromonadales TaxID=135622 RepID=A0A1Y6BHB1_9ALTE  ali  20 2833.............................................................................................................................LGYAIDFERDSQNRIVAVLPDGRRIDYSYTLEGDLAQADFSGDVTEFEY--LSRIEIIDPNGVSTRMEYDDDGRLTAIDAEGNRIEYDHNIEGRTIVADARGNQTIYIYDDNGRVLSET. 2959
481 1.000e-11UniRef50_A0A0J9DSK5 Uncharacterized protein n=1 Tax=Ralstonia sp. MD27 TaxID=1676617 RepID=A0A0J9DSK5_9RALS  ali  16 1347.....GDLTTSYGYDAVGNLTDAKGHSTYTYYDAMGRTVAVAAPRANTVFYRDALGNAVVKIDGDDHVTFNQFDSHGNLTQTTDAGGNNHYYSYDALGHLAKVTGNDGVTHFQYDALGRQTIITPASTSTRMAYNGFGEMVLRSPDGAQEHFDYDAAGHLWRTNGDGLEKVFLYNLQGQITSKDGSGRRTDSARDLLGRVTQETLPGRVVYQTYDRWGNVVSVRNAAWITTFRYNANNQVIEE.. 1719
482 1.000e-11UniRef50_D0THP1 RHS repeat-associated core domain protein n=1 Tax=Bacteroides sp. 2_1_33B TaxID=469589 RepID=D0THP1_9BACE  ali  13  881.....GTVVVNQTYNKAGQLTRANGITTKYEYNKNGWLSKI--ADGKILMTYDKTGNMLARLDQLDRSEMYGYDKIQQLTSITTPA-RTQIFRYDALGNRLSVQEDGVTTTYTYDQNGNML----NDDSHTYQYDYNNKLVQVDAE--TASYAYDALGRRIRKTTADGTVLF-YYAGDDVIVTDRSGEVERYEYDPFGKVSSSNVEG...................................... 1154
483 1.000e-11UniRef50_A0A0D6KC39 RHS repeat-associated core domain protein n=2 Tax=Nostocales TaxID=1161 RepID=A0A0D6KC39_9CYAN  ali  2913......GETTNYTYDKANQLSNADRSLKNYTYDANGNPADTILSDGQFNYTYDKEGNLATKTNSTGTVTIYNYDFRNRLVGVTDTSGNTTQFKYDAFNRRIAKTVNGQTTYFVNDGDNLWAELNPVGEII................................................................................................................... 3054
484 1.000e-11UniRef50_R9JY64 YD repeat (Two copies) (Fragment) n=1 Tax=Lachnospiraceae bacterium A4 TaxID=397291 RepID=R9JY64_9FIRM  ali  11 1127...................VTDLDG--TEYHYDHSSHLASVI-EDGLTEYQTDQDGKILEIAGRHGEKLKFTY-QNGYLAKVADETGNEVSLLYKDKCLAAIRNAEEDSISFTYDADGNL-------------------LTITDFNGGYLTNTYDQKQRIVKQVVAGRVERVVYDEVNRETYHTGDKYFTKYTYDADGNVTEISNDKTGIRNKFDSYGRITQTDVFGNVTGMTYDSCGRMNSITY 1335
485 1.000e-11UniRef50_A0A1H6Y7Z0 RHS repeat-associated core domain-containing protein/Por secretion system C-terminal sorting domain-containing protein n=1 Tax=Cy  ali  11  778....ADGSTESFTYDATGNRISANG--ITFGFDANGNLLEKNEGDQITSYTYDPENRLTGVTLPDGRTINYAYDPFGDRISKTTPDGIEIRYFLDGDNVLQELDRNNNRVNYTYHQDG-LNSTMALSNGTTYRYEAYGKLKSQTGD................................................................................................... 961
486 1.000e-11UniRef50_A0A1L9QRF2 Uncharacterized protein n=1 Tax=Roseofilum reptotaenium AO1-A TaxID=1925591 RepID=A0A1L9QRF2_9CYAN  ali  14 3420.....GERTISYVYDEVGNRLDSLEGLTTYQY-ENNLLISETQGNRVTTYKYDNNGNLISRLENGTDKTIYTWDDENRLIGVQTPNGDSISYGYNDKNIRVSSTVNGVQTNYLIDSNSQVIEEYQQGEKSSYVY---GLDLISQAQGED-SYFYDGLGSTIALSNASSALTYVYDAYGNLI--DSTGET........................................................ 3607
487 2.000e-11UniRef50_D2UF28 Putative rhs family protein n=30 Tax=Xanthomonas TaxID=338 RepID=D2UF28_XANAP  ali  12 1430.........TNNVFDDNNRQTQANG--VAMSYDADGHLLT----DGTRTYTWDDRDHLSQISQGGTVIASYSYDALGRRTAKT-ESGATTQYLYDGRNTVQETDDNGGRTYFLTDGLGRLLTDTNGNAVQRYDYDPYGTTTQSSASNNPYQYTRDASGRFISEDPAGGVNTYAYTGGNPVMYRDPVGH......................................................... 1644
488 2.000e-11UniRef50_R9MUD0 YD repeat (Two copies) n=2 Tax=Lachnospiraceae bacterium 10-1 TaxID=1235800 RepID=R9MUD0_9FIRM  ali  15  251.....................................................................................NGEGEAYEFSPEGRLVHKDKRGSGITYSYNEKGQITSVEGAGGRLSFRYNKENNLISTDREVRLW-YRY---GKLWKINPLGFEYVYEYNENGKLSVLTPRGIVVRNEYDAKGRVLQILPDGSIVELRYDDANMRTYKEPNGNLVSYECDDKSRNIRTVY 417
489 2.000e-11UniRef50_Q5H2C8 Rhs family protein n=20 Tax=Xanthomonas oryzae TaxID=347 RepID=Q5H2C8_XANOR  ali  13  340..............................................................................IVQVEDACGNHWRFER-RDGHLVRIVESGAEVEARHGRIDRLQLHDPATGLTHYRYTDGDLVAAEDALGAPRRFVYRQHRLLQHTDRVGLSFYYDYDRQWRVVVTDSLGHVTVFAYDAVGRVAVTDPEGLCTRFDYDERGNLTLTRPDGSTLRQTFDDDDRLIAV.. 561
490 2.000e-11UniRef50_UPI0004178AE5 hypothetical protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI0004178AE5  ali  12 1135.....................DTNGNQTQLSYHEDGRLKSVVDGAGRRLNFFYEDFRITKIKAPGDLEVEFFYDAQTRLVNRIIRSQQTEKYGYDPLHRISITDANGHNTRYQYNQID-----YPDNTQAQFSYNGRARTTVTDNRGNETRYTFNRYGSLTITSPAG-TIEHTWADLDLLSRTNENGVKTTYTYDEHGNILTEKVSGKADHNTYVLLGNRTQQDREGRLTRFNYDKRGNLLTVTH 1421
491 2.000e-11UniRef50_A0A100JDH5 Putative deoxyribonuclease RhsC n=8 Tax=Streptomyces TaxID=1883 RepID=A0A100JDH5_9ACTN  ali  10 1133....AENWTETYAYDSAGNETRPEGRGTR-VYEG-----TRVLAAGRIRYAYDAAGRVLRRKTRLSKTWHYTWDDENRLVACTTPDGARWTYTYDPLGRRTRMAEDGHVVAFTWDGT-RLAEQTDTGHQVTTTWDYDG........................................................................................................... 1279
492 2.000e-11UniRef50_F2JRQ5 RHS repeat-associated core domain protein n=1 Tax=Cellulosilyticum lentocellum (strain ATCC 49066 / DSM 5427 / NCIMB 11756 / RHM5) Ta  ali  11 2004.............YDALGQLIDKTGNSYSYTYDGAGNIVEETKAQGTVAMTYDKDNRLSTY---NGKKV--IYDQDGNLTY--GPLNGKWEFEYDARNRLIR---AGDTI-YEYDGENNRIAVIEAGKRTAYVVDSNYRTIAQIEEGEVTWYIY-GKGLLAQEQGDHYFI-YHFDNRGSTTATNSKGEVTRFSYTAYGELV............................................ 2203
493 2.000e-11UniRef50_A0A1I4QSX3 RHS repeat-associated core domain-containing protein n=1 Tax=Rugamonas rubra TaxID=758825 RepID=A0A1I4QSX3_9GAMM  ali  11  985..TGFDGKTTSYTYDRAGQLSDSAGQRTRYAYDALGRLVAVTDALGQTTHVYDELGNRVQTVLPNGRQVRRGYDPQSRLVEMTLRMGRERRFEYDRAGNLTSRDETLGTFTYTYDPLGQLLSAGQRDLDEVFAFDPAGNLLERSAWERQTSATHNLLKRY-------RDTSYEYDGQGNTVRKSFGQAGSIYSYDAENRLTRAVKTGHSAQYIYDAFSRRIA....................... 1352
494 2.000e-11UniRef50_A0A1H0QY40 Uncharacterized protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1H0QY40_9SPHI  ali  42  117........................................................FLGTVSEGDGGKKAYGKDISGNTVIKDDRGVTIGTVKKDIFGNNVEEYNDGTKRVYEKNIFGDTVVKDERGTTITRKKDIFGNVEETDAQGKKKTYKKDIFGNTVVTDESGKTITYKKNIFGDTVFET............................................................. 246
495 3.000e-11UniRef50_A0A1V2QXB0 Type IV secretion protein Rhs n=1 Tax=Saccharothrix sp. ALI-22-I TaxID=1933778 RepID=A0A1V2QXB0_9PSEU  ali  1047IVDPAGSR--RLTLDRQGRVLAVQGQSERYGYDAIGNITRVVDSAGRTSYVHDQQGRVVQRRHRTGRVWRFTWDAEDRLTSVVTPDGGTWRYQYDPMGRRIAKDATGKVTDFTWDGARLVEHAHSSGATSTWEY............................................................................................................... 1209
496 3.000e-11UniRef50_A0A0P6X984 Uncharacterized protein n=2 Tax=Bellilinea caldifistulae TaxID=360411 RepID=A0A0P6X984_9CHLR  ali  11  394...................................................................RSRYTFDGSGRLQSWRDERGFGFDYTY-TEGQLTRVSESGRFLQFEY-QNGRLAAVDSANRQVSFGYNASGDLTENDVRGQVWQYAY-QDHRLTTVIAPGNIVHYQYNAANERIVHNPDGSTTVLTYDANFRPIVRDPYNRSIEYQWSANGNLTVRDAAGNETHLEYDPVNRLVQLT. 621
497 3.000e-11UniRef50_A0A0Q8RK34 Uncharacterized protein n=2 Tax=Duganella TaxID=75654 RepID=A0A0Q8RK34_9BURK  ali  14 1054.......FTLTHAYDELGNRIHPNGRIVDIERDKLHRETERLAGNGNTEKRYDPQSRLTAISLHKGGQVNYGYDRAGNLSQVDDELRGVTRYTYDPVGQIRSAVQPGLTELFEFDPAGNLLVTHNLLRQYAYQYDEQGNTIRKSNDAGELSFAYDSENRLLHVNADSATVHYRYDGFGRRIAKTEQGGVTFYVWDG-DQLCHEVRDDKSVSYLY............................... 1334
498 3.000e-11UniRef50_UPI0004AD9BD0 hypothetical protein n=1 Tax=Bacteroides neonati TaxID=1347393 RepID=UPI0004AD9BD0  ali  31  31..................NDVYSMVNQKKMRVTKDILGNFTVEDNQGNRKKITKDIFDNITIEDNNGKRTRVTKDIFDNITIEDNNGKRTRVTKDIFDNITIEGNDGKRTRVTKDIFGNITIEDNDGKRTRVTKDIFGNITIEGNEGNRTNVTKDILDNLTIYDD................................................................................ 177
499 4.000e-11UniRef50_UPI000DE9BF82 hypothetical protein n=1 Tax=Arenicella xantha TaxID=644221 RepID=UPI000DE9BF82  ali  19 1276...............................................VSSEIDERFLVESIVDRNGNAMNYEYESYNQVSKVTDASARTLEFTYDKDYRLTQVDPDGNSEAYTYDKVPNLTSTDAVGNTTSYGYDGNGNRRVTDLNGNSTLYTLNEFGNPIIEEPLGKRTTYSHDEQGNVTRTDRNGNSTENSYDDNGNLASTDAEGNTTRHTYSSQGRRTTLHPNGGVTEYDYDQYGNVKSISF 1618
500 4.000e-11UniRef50_UPI0003652E42 hypothetical protein n=1 Tax=Actinopolyspora halophila TaxID=1850 RepID=UPI0003652E42  ali  12  333............................................................................................................................PPGVRTQFARDGGGFRAVT-PDQRELLFA--ADGRLLSIDQRGQGLEFGYDGGSLRTVTDAAGRTVRVEHHSNGRLAKLTPDERYVSYSYDSEGRLSVRDAEGGTTTYGYDSADRLTTVT. 453
501 4.000e-11UniRef50_UPI00048A664A hypothetical protein n=1 Tax=Chloroflexus sp. Y-396-1 TaxID=867845 RepID=UPI00048A664A  ali  14  503..........TFTYNSQDQRSDLLGFGWNFPYNVRLQRVAVIHPDGRTLYEWNGA----AYQAPAGVYDKLERNNNGRFLETITGLGILTEWQ----------DRRGNTITLSYDLSNQLTITDAVGRTIEVESDEQGRISSVLPDGRRIDLRYDSRGDLVTITPERGVYRFVYDERHRITVIDPEGITLINVYDDRDRVVQVDANGFHSFLRYDPTTRTTLIDNLGNRHYYIYDQNYRIIAET. 763
502 4.000e-11UniRef50_A0A1T4Y1K7 RHS repeat-associated core domain-containing protein n=3 Tax=Agreia TaxID=110934 RepID=A0A1T4Y1K7_9MICO  ali  13 1557.......VTRSYTYDPLDRLTSTDGSKAGYAYDANGNRTSETDATGKSTSSAASFNSINQVSTTGSTPSSYGYDANGQRTSSTVG-GVNTDYSWSDAGRMTGVSRDGRSTTYGYDGLGRQTDTTALGQTTTSVWSGTSIVQQSNPASGTTAQVRDALGGVASTADTGTRWNLL-DNLGSVAAQAVGGSVTQLAYDDFG............................................... 1762
503 4.000e-11UniRef50_A0A089HW18 Uncharacterized protein n=4 Tax=Paenibacillus durus TaxID=44251 RepID=A0A089HW18_PAEDU  ali  16  492..........................................................................................TYTYRRDGKLYRIDSNGNRIQLSY-HGSLLTDIATEGAKLTLTYGSGGKIVVTDHTGRHADYEYDAVNHLTAILPDGAKIAYTYDEKHRMTGIKNPNETSENEYDDQDRVVRQRDFAGVWDMQYIPDSNKTVTDALGRKTVYEYDERYRKTSVTY 653
504 4.000e-11UniRef50_A0A1C6Z1G6 RHS repeat-associated core domain-containing protein (Fragment) n=2 Tax=Hafnia alvei TaxID=569 RepID=A0A1C6Z1G6_HAFAL  ali  17  90.........................................................LTSIVSPDGNRTRFAYNIHGLLTQTILPDDRRLTRSYDALGRLTAESDALNRTVYADDASSQPTITDAGGGQKSLTWTRSGQLAYTDCSGNTTEYRYDRWGQRSEIRPAGLTLRYAYDARGRLITENSAGERTQYHHNPAGDLITTEPDGSQTDMTYDDNGRLLTRTHGGATQQFAYDAADRLI.... 281
505 4.000e-11UniRef50_A0A1G1FPX3 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=A0A1G1FPX3_9BACT  ali  29  22....................................................................................................................................................DTRCRTDSFGNTTCRDDDGNTLRGRTDSFGNETWRDDDGNTVRGRTDSFGNKTYRDDSGNTLRGRTDSFGNETWRDDDGNTIRGRTDSFGNRTYTD. 117
506 5.000e-11UniRef50_A0A0P9CQG1 RHS repeat-associated core domain-containing protein n=2 Tax=Thiohalorhabdus denitrificans TaxID=381306 RepID=A0A0P9CQG1_9GAMM :_  ali  15  335....................................................................TRERYDGQGRLTALQNPQGKEQTLSYTAGGQVTVTDPHGQELRIALNPAGTLRITDARGRTTEYHYKDGLILTRVDPDGTATEYEYDDQGRAIASERGGGAERVEYEGDDTTTLTNALGKRTTYRFETLHEQSRATAHTEATTYAYDANGYLIATDAKGHSTYYTRDENGLELSRT. 553
507 5.000e-11UniRef50_A0A0S4K3C1 Rhs-family protein n=2 Tax=Janthinobacterium sp. CG23_2 TaxID=1706231 RepID=A0A0S4K3C1_9BURK  ali  11  615.....GEVITDIERDRLHRATSRTGALTSFQYDPVGRLLAQV--AGHLRYEYDESGNLLAVDDKRNGRKTYSYDVIGRIMSAVQPD-LAERFAFDPAHNL-----LDETVA----SAGRV-----EGNRVRYDYDAHGNLTEK-LNGRHTRLEWNAAHQLVKSNPTVQTVKYAYDPFGRRIAKRDRFGMTRFVWDG-NRLLCEARGKWERTYVY............................... 835
508 5.000e-11UniRef50_A0A0C2HYA6 Uncharacterized protein n=2 Tax=Geoalkalibacter ferrihydriticus TaxID=392333 RepID=A0A0C2HYA6_9DELT  ali  13 1250.....GGWLVSFAYDGANRVTTQNGRVIQYAYDPGGLLIEERDPRGRVTYAYDPGNRVVSRSYVNGAFATYSYNANNWITQLNHGAGRSEAYGYDAIYRLVVGDLVGAQTAYDLDLLGNWNSKTTDGLTQNRSHNQVNELIAIDGL----ALAYDANGNLI----EDERHTYVYDDENRLVTRNSDGQIVSYQYDALGRRVAKTDLSGVTLYFHDDA-RVIEESAAAVVERYTYDAYG....... 1588
509 5.000e-11UniRef50_R5M6X7 RHS repeat-associated core domain protein n=1 Tax=Clostridium sp. CAG:149 TaxID=1262776 RepID=R5M6X7_9CLOT  ali  13 1388.........STYQYDGLGRITQVTGQTVSYTYDGSDQLESITYPDGTSVYRYDKNDNLTEVIGRDGESTTYEYDAINRITQIHRPNGISTYNTYNARDQIVTMDDCGWVVSYTYDDRGFIIGEDPHGGQRTFEYDEDGKLTEKEENQGTYTYEYDMGNRLSYTKKRNGTVEYTYNLSNQPVAKLYDGKKHTYGYDADGNLVSENGTKGTLSYYYTVENRLKAVYEKDNLLAMAYDGDGNRT.... 1695
510 6.000e-11UniRef50_UPI0003132E10 hypothetical protein n=2 Tax=Verrucomicrobium spinosum TaxID=2736 RepID=UPI0003132E10  ali  14 2596..............................................................................LVMARDLSGNITTYKYEDVWNAPQTTGLNGV----YD--DPTEQTNALGKSKRFEYDPRRMTKVTDEEGRESRYLTDHLGRRTRESALAQQTDFEY---GNRIVRSASGDITRFIPDSAGRVASEDGPDLVTVYEYASNGNVSATDPRGKTTYFEYDRRNRLKKVTY 2790