current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681243|ref|YP_211387.1| hypothetical protein (BF1751) [Bacteroides fragilis NCTC 9343] (Range: 1-157), from B.fragilis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# E-value Template Links and tools%idFirst MDKEQFKSIVHPVMKANSFRRKGNSWYKTTAECIVVFNLQHSLYGKMFYINLAALLRKGDDLLFPKEYQCDIRMRFPIMEIEGYSTQMILDLESTIDEQLRSRLIENIINISIPILQKLESIDGIIELYGEKPELNNIYPFSSILYRKEMNNKLKAILast
1 2.000e-30UniRef50_A0A0S7ZYE8 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0S7ZYE8_9GAMM  ali  19  10...AIIKEGLAPLLKNNGFKKKARNFYREYSDRVEVINVQASQWNGKFTINVGVYYPEPPVSGAPKEYDCTVRERIGLLTPENKDHWWHIDG-SVNDLEVAENVANQVEKICFPWLSEMSDLENVKNYVVKNKA------FVAAGIALFQGYREEA. 166
2 4.000e-29UniRef50_A0A2N2MES2 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-6 TaxID=2013729 RepID=A0A2N2MES2_9CHLR  ali  24  10...ELIKLGFAPLLKTYRFRKSGRTFYRQVDEIWQVLNVQSSQSNEKFTINLGIYHPKSFSTGYPKEYECTIRKRIGHLMQSQGDYWWEIDPST-NLEVLAKQVNSTVEEFGLPWLETHCDLRVIANTLSEQPS---IMSAAAALALGD........ 162
3 2.000e-28UniRef50_C6X3T9 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=C6X3T9_FLAB3  ali  23  11...KIIKNGFHEVLKPLGFKKKENNFYLKLDRIGQIINVQKSVWGNDFTINTGIFVPEYWLPDYPTEPECLIRKRIGTI-RNQHDTWYHIK-ETTDEEQLIVEMRKNLTEFILPYFDRLNSTEKMLQELEKADMM--MTPLGKLIVYGELNQFDKA. 173
4 3.000e-28UniRef50_A0A160IQS8 Uncharacterized protein n=1 Tax=Fictibacillus phosphorivorans TaxID=1221500 RepID=A0A160IQS8_9BACI  ali  22  9..KQIVKEIIAPTLKNHRFKKKGNNFVRTFSEFSWTINVQSSSWNTSFTINTGISYYQYVPPKFPLEVDSVMRLRISELKDQHEDIWYKLTPTTNLDD-LTEQIKQDIEKIIIPYFQQFQSLQDVIQGLEKREVQGYHEPHVLAVLYHECGDREAA. 176
5 4.000e-28UniRef50_UPI00034D5903 DUF4304 domain-containing protein n=1 Tax=Lysobacter antibioticus TaxID=84531 RepID=UPI00034D5903  ali  18  9...AVVASGLAPLLKSHGFAKAGRSFHRRHGDRWQVVNVQASSGNSRFTLNLGLYIPEIPLAGKPKEYECTLRERIGALMPQARDHWWTLAPDSD-PALLAPELADAFAAHGLPWLEGYADLAKVAARLAEAPTILAAAAALAA------GDREAA. 165
6 4.000e-28UniRef50_A0A257I1P5 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A257I1P5_9BACT  ali  20  11...KIIKDGFHEILKPLGFKKKANNFYLKLDTIGQIINVQKSAFGNKFTINTGIFVPEYWLPDYPTEPECLIRKRIGNL-RNQHDTWYDIKERTDE-QQLIDEMKKNLSNFILPYFERIDSTEKMLQELDKADMM--MTPLGKLIVYGEFKQFDKA. 173
7 5.000e-28UniRef50_A0A177XUT8 Uncharacterized protein n=3 Tax=Vibrio TaxID=662 RepID=A0A177XUT8_9VIBR  ali  29  6..KKCLESILKPTLKEEGFRKKGSTWWKHIEGYIQVINIQGSQYSKQFYLNLGVYISAVGDKEWPSESDCHIQVRLDSLVNPNLVHT-LLNYETALEHTDRKEISELILVKGLRWLDQCSSFEGAKAEY............................ 131
8 6.000e-28UniRef50_UPI0009DD1151 DUF4304 domain-containing protein n=1 Tax=bacterium JKG1 TaxID=1128421 RepID=UPI0009DD1151  ali  18  12...ELIKRYLHPELRQYGFTRKARTWNREYNSFNQVINVQTGKNSGDFTINMGVFVPSVYRPSFVRETDCTVRTRLGCLLDKKVDKWWSFDQTTDIV-LIGKEITDLLVNYGLPFLEQFDSLESIHNFLIIRCKSKQSTPLEHIYLAVVKAQLGDT. 173
9 3.000e-27UniRef50_A0A1Y3CY40 Uncharacterized protein n=1 Tax=Acinetobacter sp. ANC 4169 TaxID=1977879 RepID=A0A1Y3CY40_9GAMM  ali  22  13MFKDLINKDIAPLLKQYGFKKKNFTWNRSVNGVIQVINFQLSRYSDHFTINLGVFHPQLWGPKFITEFDCFPRERIGYIKNNNKDLWWTITNETNVIE-LSREIKNIIEDKCIPFLDKMLDYHAVSNFYLCFPKLLPIDKIYLAIIKNILRDLD... 180
10 2.000e-26UniRef50_C5BI70 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=C5BI70_TERTT  ali  27  4.DSKLIKEALGAPLKDAGFKKKSDSWYWANDEVVLLVDLQKSQYGDQYYVNGGVALKSLGAAEFPKEHHCHIRFRLTAVEEESKQIESVFDLENSLSDQRRKEVSRLVRDVALPILQGCSSESGIAETVKSGR-------LAKAMVHKQVKDL.... 152
11 6.000e-26UniRef50_UPI0008981344 DUF4304 domain-containing protein n=1 Tax=Marinobacterium georgiense TaxID=48076 RepID=UPI0008981344  ali  24  9...EVIKLDLASFMKSEGFKKSARNWHKQEGDNWLVVNVQSSSGNGAFTINLGVYNAEIPLTGKPKEYEATVRERVGVLAH-GVDHWWKIEKESELSH-IAQEVVEEMKNYGVPWLNTHQSVSAIAESLEQQPTL---ESFSAAFLAAAVLRLQKAI 172
12 7.000e-26UniRef50_A0A2W2C5T8 Uncharacterized protein n=1 Tax=Rhizobiales bacterium KCTC 52945 TaxID=2219703 RepID=A0A2W2C5T8_9RHIZ  ali  26  2MDKVLFKKSFGNVLTEHGFRKKGQSWYLYGPDCIVVLNLQKDDFSALYFVNFGVWLLSLGDAQYPPENHCHVRSRLERLFPLHRELILDACTLSSDPSALAPFI-ALLHSDVVPLCQRCLSIEGLKEEVAAGRVPHY.................... 137
13 7.000e-26UniRef50_A0A1S2LTI2 Uncharacterized protein n=1 Tax=Anaerobacillus arseniciselenatis TaxID=85682 RepID=A0A1S2LTI2_9BACI  ali  22  10...QIIKDAITPLIKTKGFKKQGRNFFKDLGKIGWCFNIQSSLYSHQFTFNVGIFVPSAYEPKFPKEYHCIVRKRISELKDVSKEAWYSYN-ENVISDKLFKQLKADMEGYILPFFN-IDTIDELINFMLDGERWGPQGKAMLIIILKQNGFEQKA. 171
14 9.000e-26UniRef50_A0A101DGE0 Uncharacterized protein n=1 Tax=Desulfonauticus sp. 38_4375 TaxID=1635258 RepID=A0A101DGE0_9DELT  ali  18  12...QVISAGIHPILKEQGFKKQGRAFYKRVADLYHVVHVQGSLWNGRFTINLGLSSPEIAAEWFPKSPASHFYERIGSLLPVKADHWWSIGLDTDLAE-LAQEVGDALRNYGLKFLEAFRSTQDLLGALERDELPLSLFGAPTIVLLHRAGRVDEA. 183
15 1.000e-25UniRef50_Q2IMU8 Uncharacterized protein n=3 Tax=Anaeromyxobacter TaxID=161492 RepID=Q2IMU8_ANADE  ali  18  50...EVIRNGLAPMLKALGFRKAGRTFRSAAPRCVLVVNVQASHWSTQFTVNVGAFYIGLNDTSGPTEYQCHVRQRLGRLTPAQRDVWWDLKVGAPWTQVSV-EVTEAVREHGLPWLRAMTDLDMARSHAEARSGPHI-----AAGLALLAGRRDEA. 211
16 2.000e-25UniRef50_A0A2M9DYQ5 Uncharacterized protein n=7 Tax=unclassified Xanthomonadaceae TaxID=191676 RepID=A0A2M9DYQ5_9GAMM  ali  17  11....IIKLALATPLKAAGFKKQARVFRRSRDDGVEVIDIQGGKYNGEFTVNLGLYLPDAPPLEKPQEHQCHFRQRIGALLPQKDEDFWWSMDTASSDEALAHTLQQAVLNHALPWFAAF-TPEAFQAAQLPGGAPMPLDPLHAASFYLLLGEHDKA. 177
17 3.000e-25UniRef50_A0A285PHC4 Uncharacterized protein n=2 Tax=Cohaesibacter gelatinilyticus TaxID=372072 RepID=A0A285PHC4_9RHIZ  ali  22  1MIDQIVSQYIAKNLKANGFKKKRLTWNKRIGEYVQVVNVQKSQWNTEFTINWGISFDYVYQALWGKETDSFPRFRVGNLPIVDKEIWWNCDPDTGI-EPIGAEIIKQMEEVILPNLEKLSNYKEICNLYLQTFHIPPIEKVQLATILHSLGKYEEA. 170
18 4.000e-25UniRef50_UPI0009E900DE DUF4304 domain-containing protein n=1 Tax=Hydrogenophaga sp. Root209 TaxID=1736490 RepID=UPI0009E900DE  ali  20  4.....LETAIAPFLKVSGFKKKAKTWRRHCPDVIQVLNLQKSPYGDNMYVNLGVYVRSLGEEQNPPENRCHVQVRLERVTQSEREQ---CVVAANANEVPTQALIEAILIDGVAWLNDLATLSGIRRYLESGGSKKGLVLHEAANLAAQAK...... 146
19 5.000e-25UniRef50_UPI000255B18F DUF4304 domain-containing protein n=1 Tax=Mesoflavibacter zeaxanthinifaciens TaxID=393060 RepID=UPI000255B18F  ali  25  10..NEIVKSCFHERLKPLKFKKKANNFYRDLGEIGQIINIQKSMFNISFTANIGIFSPIYWDPAYPTEPVSIIRTRIGRF-IDGKDKWWDLD-ERANVENIKSELTETLENKILPYFEKIKSNESLIKFIET-EYQNYNSTYVKFVMYGELGMKDK.. 174
20 5.000e-25UniRef50_UPI0009E8456A DUF4304 domain-containing protein n=1 Tax=Thiohalocapsa sp. ML1 TaxID=1431688 RepID=UPI0009E8456A  ali  16  11....LLRNALTPFLKCEGFKKSGLIYSRDCGNLSAIVALQKSRWGGDFTLNFGVHVPGVGELYKPRIEDCALYVRVGMLTPEQVDRWWEINADMNEAEKERSELVDVCKDFGLPFLRRFETLQSIAAWLEAGDYARYVFPMAKAQRLAYA....... 171
21 2.000e-24UniRef50_UPI0009E3E6AA DUF4304 domain-containing protein n=1 Tax=Pannonibacter phragmitetus TaxID=121719 RepID=UPI0009E3E6AA  ali  16  1MNASHLINLFDRKLKPKGFRRKKATWNRGRDAFVEVIDVQTSKDGDSVTLNAGVLSLSRDAEPFIEEPFCTVRARIGQLL-DNKDLWWEVG-----DTRAIDDMTDRLERQIFPFLERMRSLGGMRDWLASTGVPSPLPSLCFAVLQSQLGDMDNA. 160
22 2.000e-24UniRef50_G0J061 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=G0J061_CYCMS  ali  26  13....IIKEVIAPVFKANGFKKNGNNFYRDLGEVGQVFNVQQSQWNSKFVFNLGLLDKEIQNPKFPKEYDCEIRLRHGQLVNKG-DVWYNLNKR-INLEKLKAQIENDLEKFVLPFFDKYQQPKKWIEFF-DWEFEPLTGPIGKFLIIEKYGQRTKA. 172
23 2.000e-24UniRef50_A0A1V2VF25 Uncharacterized protein n=2 Tax=Herbaspirillum TaxID=963 RepID=A0A1V2VF25_9BURK  ali  19  21..........APLLKSLGFRRKAHHFFRVAADATCHVSFQSSQWGSSFTLNLAIASGEVPIVEPAKQRIGHCGTRIGHLLPRQEDYWWKIS-DPSEVPQIADEVRSAVEKYAIPYLEKAITLQGVSELSGCHPGVRSFPTHSKANALRLLGREQEAI 177
24 3.000e-24UniRef50_A0A2J0UPC4 Uncharacterized protein n=5 Tax=Stenotrophomonas maltophilia TaxID=40324 RepID=A0A2J0UPC4_STEMA  ali  14  1MTIKTLVARIDQLLGPLGFERKGALWNRRRGSVVEVIDVQVSKGRDTATINAGVLQVDAFEKAWVEEPFCIVRARVGEIVGV-HDLWWPLN-DGQIPEKVAA----TLETHVLPFLERSRTQEAMEAYLEAEHGRYPLPKIYLAILKHQVGDVKSA. 157
25 3.000e-24UniRef50_A0A2P8D0X9 Uncharacterized protein DUF4304 n=1 Tax=Taibaiella chishuiensis TaxID=1434707 RepID=A0A2P8D0X9_9BACT  ali  21  13....IIKLAFQDTLKPLGFKKRSNNFYRVKGELGNVVNIQYSREMIRFTINVGIFAPKHWYPTFPPHYECILNKRIGKLKKENDS--WSDVHEDIEIEFLIKEMQDNLNNHIIPFFNEIENYDDVLLQLETNR---PRPDLDRLILLAELKYTGKA. 173
26 4.000e-24UniRef50_A0A2V8N800 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8N800_9BACT  ali  21  1MTKSEFQEPVTTLLRARGFTKSGRTYNRTADDLIYVVNFQMGSYYGQFAVNLGVYLPCVAAITQSPDYHCEIRERLGSLANSGKDVWWN---TSEPPELLGQLITELVVTFGLPFLETFNSYSDVLNYYDGHGTLPFHNELAAAIICYHLGERAKS. 186
27 4.000e-24UniRef50_A0A255X7N2 Uncharacterized protein n=2 Tax=Ralstonia solanacearum TaxID=305 RepID=A0A255X7N2_RALSL  ali  27  3.DSKIIKMALGAPLIEAGFKKKSDSWYLGNDEVVILVNIQKSQYGYQYYVNCGISVRSLGGVEFPKEQNCHIRFRLTAILPEEKRKEFEFDLESESDHWRSEEISRLVKNIVLPILQRCSYREGIVEAVRSGA-------LANAMVYKEIKE..... 150
28 4.000e-24UniRef50_A0A235CK63 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A235CK63_9GAMM  ali  23  1.............MKENGFKKSGRTFLKELDDGWHIVNIQASSGNGKFAVNLGVINNAISEPSKPKEYDSTVRERLGILVH-GEDYWWEISDQTDISD-LANEISEAMSSHGFPWLQKYSNLADISDKLKQQPS------LQSIAAALLMGDELEA. 145
29 4.000e-24UniRef50_UPI00082EB113 DUF4304 domain-containing protein n=1 Tax=Rufibacter roseus TaxID=1567108 RepID=UPI00082EB113  ali  23  10..NRILKEGFQEVLKPLGFKKKGNNFYLQLEELGQAINAQKSRWNTKFTINVGVFLPDYWQPTFPSVYDCYSHKRIGQL-RNQLDTWYDVDASTDE-EKLIVEMKDNLVNYVLPYLNRVKTKEDFFYLFKKERE....................... 153
30 6.000e-24UniRef50_A0A0G3A1N3 Uncharacterized protein n=3 Tax=Archangium TaxID=47 RepID=A0A0G3A1N3_9DELT  ali  32  4............ELRGAGFKARGTSWYKHGPDALLVVNLQKSLYGPQHYINLAAWVKHLGDAEFPKEYQCHVRVRATSLPTHNAEHALNLGDESMDTEQREAFIARFMREEAIPFLESLGTWEGIRAAVNAG-------KLKKGLIYKEVQALLQA. 143
31 1.000e-23UniRef50_A0A1S6FFL5 Uncharacterized protein n=2 Tax=Sphingomonas sp. LM7 TaxID=1938607 RepID=A0A1S6FFL5_9SPHN  ali  17  1MESK-FKQVLAATLKAAGFTKRGTSFRRKYDDNIAIIDFQKSTDNSKFTINLGVISSSRWDPEKLPVWEAPLRERIGTLAY-GEDRWWTVTSNEPVS-AIENEVTNLIETCAVPFLDQHQSDNALIAMWKRGNSPGLTE.................. 150
32 1.000e-23UniRef50_UPI000CF5FE9D DUF4304 domain-containing protein n=1 Tax=Pseudoalteromonas sp. T1lg21 TaxID=2077095 RepID=UPI000CF5FE9D  ali  19  58...EVISEGTKQYLKENGFRKTGRCFYKSGDIFIYVIDFQSSQYNDPFTINVNVVFPYFHEPKNPSKAAAVISRRVGHLMNDNGDSWWEVSSET-NAQELGMDIRKILSSSALPFLLEIDSVNKVLELVRNGEKPAYNPDIITAIMHKYNGNKDLA. 223
33 1.000e-23UniRef50_A0A086A8T5 Uncharacterized protein n=2 Tax=Chryseobacterium TaxID=59732 RepID=A0A086A8T5_9FLAO  ali  19  1MDIKEIIKSITPFLKEKGYSKKGNSFHLKSDNNFGIINFQKSQDGNKLTINFGVYSDDYDNSKVPDVWSSQWQARIGDFLPDGHDFWWKIQPEGNLCE-IISNIIDLIQNIILPEIDKRLTDEGLMKSLIKGDFTRSTETFKYLTIFLKAKGDIEAL 171
34 1.000e-23UniRef50_UPI0009DE8A2D DUF4304 domain-containing protein n=1 Tax=Methylibium sp. CF059 TaxID=1500261 RepID=UPI0009DE8A2D  ali  18  11MNTKALSKHFYPVLRKAGFRGSGSTLRRINEPLICVVNVQGSSGGDRCYLNLGAHLSFLPEAGKLLEYECAFRSRISP--PEGQTFGWSYGTSEQEAEENALLVVEAWATEGTAFFGRFNDYESLVKLVAEFERAHPAECLLIARIAEHLGEVGRA. 177
35 1.000e-23UniRef50_G8DC59 Uncharacterized protein n=2 Tax=Arthrobacter TaxID=1663 RepID=G8DC59_9MICC  ali  32  1MRGNVIQTAFDDFMKSLGFSKKSGSWYRTSDDVVSVVELQRSQYGPWYYVNLAAWLRALGEEKAPKEHKCHMRTRLDNLVGAGERLTSLLDLEVAMPDERRSMLTEFLREHLRPALDAMSSLEAL................................ 127
36 2.000e-23UniRef50_I3XEZ8 Uncharacterized protein n=1 Tax=Sinorhizobium fredii USDA 257 TaxID=1185652 RepID=I3XEZ8_RHIFR  ali  16  57..ERVIGQELAPYLRSVGFLRHGQTWNRRTDGVVQVISVQRSMNNSRFTVNIGVTPGTRPTNARVAEHDCRARQRIGFLRPERQDHWYRYQPDAASVQLAVAEARADIEAYALPYLSQTS..................................... 179
37 2.000e-23UniRef50_A0A1M7B940 Uncharacterized protein n=1 Tax=Labrenzia suaedae TaxID=735517 RepID=A0A1M7B940_9RHOB  ali  29  8.....FSNIISNQLKGLGFKKKNRNWYFENDEVILVANLQKSSYGSQYYLNGGVYLRELGNEIFPKEYRCHIRFRLTSLEVERADIVFNLEDRGVSQQQREEAVVDFMKSVFVPELQRYSTKDQIISSLRKGSTKRYF................... 144
38 3.000e-23UniRef50_A0A1N7API3 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1N7API3_9FLAO  ali  22  1MDIKELIKKLTPFLKSLGFSKKGNSFHLELDKNYGIINFQKSRESTKFTINFGIYSYDYNNLSKPEIEQCQWNSRVGAFMPNSPDYWWIINFTDDLNT-YTQDLVDNIQNIIIPEINKRLSDEGLINSWLNENNAG-TTEIGRFKYLTTL....... 160
39 3.000e-23UniRef50_M6UCQ5 PF14137 domain protein n=8 Tax=Leptospira TaxID=171 RepID=M6UCQ5_9LEPT  ali  20  14..KKISKEGFYKILKPLGFKRKGNRFCLMNDEYGKVVDLQKSQWNSKFTINIGFFFSEYWRPSFPRIEECFLTKRLGEL-RNSNDIWYDIDFNSD-ADLMINQIYENLNLYILPYLNRFVSKKSLLEILEKEDF--HLRPYALLIIYGELGEMEK.. 177
40 4.000e-23UniRef50_A0A178JE47 Uncharacterized protein n=1 Tax=Vibrio europaeus TaxID=300876 RepID=A0A178JE47_9VIBR  ali  29  6..KKCLESILKPTLKKEGFRKKGSTWWKHIEGYIQVINIQGSQYSKQFYMNLGVYISAVGDKEWPSESDCHIQVRLDSLANPNLVHT-LLNYETALEHTDRKEISELVLVKGL............................................ 115
41 4.000e-23UniRef50_A0A1B9RTD9 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1B9RTD9_9RHIZ  ali  19  10...EVIKLGFADLLKAHEFRKSGRNWHRADGENWLIVNVQASSGNGKFTINLGIYFAATPISGKPREMDSTVRERLGTLAY-GRDHWWTIEA-GSNLNSISDDLVEKMRSFGMPWLESHRDLSHIAAALRDSPSV----LSASAVLLA--GDKEEA. 165
42 5.000e-23UniRef50_UPI0009B906CC DUF4304 domain-containing protein n=1 Tax=Ralstonia pickettii TaxID=329 RepID=UPI0009B906CC  ali  25  17.....VEAQLAPGLKALGFKKKARTWTRETPDAFQVVNLQKSAFGEQVYVNVAVYLKALGDETSPPEHRCHIRARLERIAPESAEEIRSLNASLPISAV----LLSALLDHAVVWLERVSSWPGLDSFVES.......................... 139
43 5.000e-23UniRef50_UPI000DD31396 DUF4304 domain-containing protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DD31396  ali  12  2MSKKHIFQTLSSILLGKGFKFSDGAWVRDSGNLREVIGSQFSSKTGSVTFNVGIADRDVWKIYWDEHIPCIAKRRIGEILPSGTDRWWKID---EFNEASASEVVDA----ALHFFDELSSREKLLALIKSRKFLVIAEKPYIPIILHLLGQSESAL 158
44 8.000e-23UniRef50_UPI000D6FCBF0 DUF4304 domain-containing protein n=1 Tax=Pseudoalteromonas sp. meg-B1 TaxID=2203192 RepID=UPI000D6FCBF0  ali  23  6..SKKLQEVLKPHFKALGFKKKGASWGCAGDELAKWFNIQCSRNSDSIYFNVGIYFQATQEIAYPKELDCHLRFRVEQLLSSDDEIKEFYDLSNLNVEAKVEKIANIIANKLIPFFNHHNSVADILNSELVKPYMYW.................... 144
45 9.000e-23UniRef50_A0A2T0LAP8 Uncharacterized protein DUF4304 n=1 Tax=Planifilum fimeticola TaxID=201975 RepID=A0A2T0LAP8_9BACL  ali  20  10....LIRNTIHPTLKERGFKKRNHHFYRPLADVGWTFQVQSSKYNTQFTLNMGIYVPQWARSDFPKEYQSLWRERV------RGDHWYELTP-GTELAALRREIARDLQEQVIPFFERLSGLPPLLEEMLEAYRMGRLSVYAIAILLTLSNRREEA. 167
46 1.000e-22UniRef50_A0A1H5PJZ3 Uncharacterized protein n=1 Tax=Salinimicrobium catena TaxID=390640 RepID=A0A1H5PJZ3_9FLAO  ali  26  11....IIKEVITPIFKNFGFKKIGNNFYRDFGETGQAFNIQKSKWNSDFVFNLGLIDKSIYKEKFPKEVDCEIRVRLGYLTDVTNE-WYKLNSNTELPE-LKSKIKNDITKYVIPFFENFRNPENWLEIFEWKNEP-YTYPLSKFLIIKKYGNTEEAV 171
47 1.000e-22UniRef50_W4CP39 Uncharacterized protein n=2 Tax=Paenibacillus sp. FSL R7-277 TaxID=1227352 RepID=W4CP39_9BACL  ali  18  8..KDVVKETIVPLFKGEGYKKQGNNYAYLNPAFSAVVNIQSSKWNTQFCFNTGIYVEEYPKPSFPTVTSSVLQIRGTELTNN--DNWYKLTPDS-SVEELKRRITKDISEYILPHLQQFEKVKDVIRVMELREKAGTYEPHHLTALYRLTGDMEQA. 170
48 2.000e-22UniRef50_A0A246U490 Uncharacterized protein n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A246U490_9RHIZ  ali  21  10...EVIKHGFADLLKAHGFKKSGRNWHRADGENWLIVNVQASSSNGKFVVNLGVYAAAVAALAKPKEYNATIRERLGSLAY-GEDHWWAIESDS-SLDLISADLVEKMLSVGLPWLDTHRDISHLAAALQNSPSLLSVS------AAWLIGDKDEA. 165
49 2.000e-22UniRef50_A0A085BE94 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A085BE94_9FLAO  ali  24  21..NEILKNIVYPFFKELEFRKNGNGFNKNISELTQVVNIQKSRWNHQFTFNIGFFATEIYTPKFIREYDCQISTRLGQLV-KGNDYWYEL-HKNTTKENLEMEIHSHLNDYLRPFLEKNIDLISLKDLILNDENINLTTEISKIQILIKVGEIERA. 184
50 2.000e-22UniRef50_A0A0M0LLA9 Uncharacterized protein n=3 Tax=Bacillales TaxID=1385 RepID=A0A0M0LLA9_9BACL  ali  22  8..KQIIKEDITSLFKAKGFIKKGNNFAKIFSDFAWTVNIQSSKWNTKFTFNTGIFTDKLFGPKFPTEVNSVLRLRISELKNE-PDTWYKIGLSSDL-DEVKREVQCDLQNVIFPHFDKFQTIEDVIQGMKRKEEQGWEEPHFLTILYKTYGYNNEA. 171
51 2.000e-22UniRef50_A0A1Y0TC11 Uncharacterized protein n=3 Tax=Bacillus cereus group TaxID=86661 RepID=A0A1Y0TC11_BACTU  ali  19  9...QIIKHTIVPTMKNEEFKKSGKNFYKGLQELGWCLQLQSNKWNTIMRINTGIFIPFLYELEWPKEYDCIGRKSVGELKSLKQDYWYQIDTSTDI-DQLSQKIKNDLENTVLPYFEDYQTLHGVVEGIQNKKLSPGGFLNY-AILLAMIGEIETA. 170
52 2.000e-22UniRef50_UPI000B4AADF7 DUF4304 domain-containing protein n=1 Tax=Kineosporia sp. R_H_3 TaxID=1961848 RepID=UPI000B4AADF7  ali  15  5MSEQLIVGHVAPALKSAGFRKRRHAFNRASDGITHVLSFQAGSFDGKFTINLGVHVQGMPAKDWVNEYECHLRKRLGELSH-RQDHWWDV-----LSPNAAADVASAIESAGLPWLDLHGDAEAVINRWRDVGSLPPAGPLEVACLLIHRGDL.... 179
53 2.000e-22UniRef50_L1Q396 Uncharacterized protein n=10 Tax=Capnocytophaga TaxID=1016 RepID=L1Q396_9FLAO  ali  25  15....VVKEGFTPLLKPLSFKKKALNYYRRLAEVGHIINIQKSSYGDRFRINIGIFEPKFWVPDYPTEPVCIIRKTIKDLRG-RKELWYEVD-ENTNEQELIKRVQEDIQQYILPFFKQYNSVEKIFYSADS-----IFPPFGALVFYGEHGYIEKA. 174
54 2.000e-22UniRef50_J2KEA9 Uncharacterized protein n=3 Tax=Burkholderiales TaxID=80840 RepID=J2KEA9_9BURK  ali  20  2...KEVLKKVAPGLRAIGFRGSGQNYRKREGDFVFVINFQGSRWGDNFYVNLGAHPVFIPDLSKLKEHECMLRRRVGDDWPWQMTDERSVQLEAEILSANAQTLRNALET---------DSPDDLLRKFGAGTSRARAT-LHLSRAAARLGHIELA. 155
55 3.000e-22UniRef50_A0A1F8P1R4 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_50_11 TaxID=1797642 RepID=A0A1F8P1R4_9CHLR  ali  21  10MD--QIVGQISEFLKPHGFKKRNRTFNRTQDGLCQVFNLQMGIRSGEFTANLGIFIPEVYRPNFINEYECAIRARFGEFT-QTEDKWWEIAPYSSS---IVEELIDLLQTYGLPFFIRFPDRQSIIDHLNEKYHVSNSPKLDIALILENLGKHEDAI 173
56 5.000e-22UniRef50_A0A1G6Y9K1 Uncharacterized protein n=1 Tax=Algoriphagus faecimaris TaxID=686796 RepID=A0A1G6Y9K1_9BACT  ali  17  40...QICKETIIPFFKENGFKKKTLHFARQTNDITQCFNVQKSQWNSYFTFNFGFYNSDIVQNEFPKTYDCFIQNRLGTFSHKR-DHWYTI-ARNIDPSKTAEQIKTDLETYLKPIFENYTTLEKLKQFIDKDEISPTLSPYYLIAFYMLTDQKEK.. 204
57 5.000e-22UniRef50_A0A2S8GGL3 DUF4304 domain-containing protein n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8GGL3_9PLAN  ali  18  1MDRTTFMKALGPILRANGFKGSGATLRRIKEPIVHVFNVQGSAGSAQCYLNLGAHLTFLPDVKNLKEYECEFRGRYDP--PAGEQFGWSYGQNEAEMNENIAFICDHWQMYGEAFFEKYSDPADFVALIQAVDAPHPAKLLTLAKIAERLGDH.... 165
58 8.000e-22UniRef50_A0A089K5E5 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A089K5E5_9BACL  ali  20  8..KEVVKETIAPLFKVEGFKKQGNNFAHVCSNISATVNIQSSKWNTQFFFNTGIYIEEYPKPSFPMEINSVLRIRGTELT--KNDSWYRLTINTK-VEQLKRMIMKDITEYILPHLRQFESINDVIKVMELREKDGIYEPHYLTVLYCSIGDMEKA. 170
59 9.000e-22UniRef50_A0A2A4TQU5 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4TQU5_9BACT  ali  20  11...KIVKESLAPKLKELGFKRRGRAWNRVTENFVQVIDVQSSRYSGSFTINLGIFSPKIYELRYDEKPPAFISSRVSTDDVGFSEIWWDVNLLTDLS-ALGAEVLSRIDAMALPFFVRFDSLEKVDEWWDED......................... 149
60 9.000e-22UniRef50_A0A2R7KA98 Uncharacterized protein (Fragment) n=1 Tax=Pedobacter sp. HMWF019 TaxID=2056856 RepID=A0A2R7KA98_9SPHI  ali  20  1MDKKILISEVDNVLRPLGFRKSGQTFFYNKDGNIGIIDFQKARRSSFFTINLGVYFDNFDVKSKPLISDCHWRKRIGFLLPAKKDYWWEINANTSLP-GLIAEIINVLRSLAIYEIQKYISDEDLEKSWMEG......................... 142
61 2.000e-21UniRef50_A0A1G2YKS1 Uncharacterized protein n=1 Tax=Planctomycetes bacterium GWF2_42_9 TaxID=1801958 RepID=A0A1G2YKS1_9BACT  ali  21  10MLNRLIDKYVTPVMSAQGFRKTQLVWNRDKLDFVHMLDIQKSRWNDQFTINIGVCLRRVWQIYWVRECDCFPCIRVGYLIANPKDIWWSLTSPADI-DLIGAELQNILSNKCIPFLNKLNSI-HVIKALAEDPAFRKFPALYYAILKHLAGERVEAV 180
62 2.000e-21UniRef50_UPI0003F7A867 DUF4304 domain-containing protein n=1 Tax=Rheinheimera baltica TaxID=67576 RepID=UPI0003F7A867  ali  20  20.....VQTYTAPLLKRHGFKKKDLTWNRSKDGLIQVINFQPSRFSRDFTINLGEFNPFIWRNCWAKESDCFPRIRIGQLPGEAVDQWWTC-HESTNGEVLGSEINKVLEEKCLKFLDDMLNCEQVARFYSSHNHLMPIEKIYLAITKSCLGDI.... 182
63 2.000e-21UniRef50_A0A2R7T3W1 Uncharacterized protein n=1 Tax=Pelomonas sp. HMWF004 TaxID=2056841 RepID=A0A2R7T3W1_9BURK  ali  29  4.....IEIAIASPLKVLGFRKKSRTWWRTTEDTICVLNLQKSPFGERLYVNLGVYLRVLGSDLNPPENQCHVRVRLERIASDQCWNE-IASAEATIDPS--EGLVAAILGDGVSWLNQVSTLDGIASFIRTGG........................ 128
64 2.000e-21UniRef50_UPI00054F4567 DUF4304 domain-containing protein n=1 Tax=Haloferula sp. BvORR071 TaxID=1396141 RepID=UPI00054F4567  ali  22  12.....IRQHLQPLLKADGFTGSGRNFRKLGGGFIQALNVQGSRYGGQFAINLGLHPVETPELKNFKEVNCEFRRR---LNETGSDQWWSHDNTEASMDAAVQAAAEVYQRIGRPHLALLSTPEGIPGFFKSHPN-YITTNFRLALALARSRKL.... 171
65 2.000e-21UniRef50_A0A2U8E382 Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E382_9BACT  ali  13  69...RQISKQCAAALAPHGFKLQSPHLHRLMPDLYHAINFQSSQWGGRFTINLIVHWTNLPFPKNPGSAPWPILRRLGQQLPAGNDKWWDVNADT-NLDALFTEISRALIKHALPFFAQYPDSQAILDRVRTGGFVHSQRPLIAAILLVEKRQPEAA. 236
66 3.000e-21UniRef50_A0A0W8ELK0 Uncharacterized protein n=2 Tax=Solirubrum puertoriconensis TaxID=1751427 RepID=A0A0W8ELK0_9BACT  ali  19  13....LVSKVIWPHFKARGYRKAGNNFRCLHADGSKILNFQKSRFYDHFTSNVGMYLPEVDESSTFTEPDCFIRKRIGFLKPDRRDLWYDILPITNTAE-LHKAVEDDVVSYILPFLNQAQSRPDMLQLIIDQPQLAHAPT--AIRVFHANGYLAEA. 169
67 3.000e-21UniRef50_A0A2A2AIW1 Uncharacterized protein n=5 Tax=unclassified Comamonadaceae TaxID=83494 RepID=A0A2A2AIW1_9BURK  ali  21  10...AIVRQALAQPLKERGFERQGRSFRREGGGRIAVLQVQGSKWNGRFTVNLGIWQPMLGQPQRPKEYECQTRQRIGFLLPERQDHWWRLDAHTD-DAAIAQTLRQAVLEHGLPWFEA....................................... 131
68 4.000e-21UniRef50_A0A2U2HG63 DUF4304 domain-containing protein n=1 Tax=Massilia glaciei TaxID=1524097 RepID=A0A2U2HG63_9BURK  ali  23  50....EFSQKLAPVLKARGFKKTGATWYRNLDRMIQVLNIQKSPYADNFYVNVGIYLKALGDELRPPEARCHFRFRAESVLGADERFELNRLLDFTQKADRYQDIQILLEKSALLWLDENSTEQALWKLLQ........................... 178
69 7.000e-21UniRef50_A0A2T5FZI5 Uncharacterized protein n=1 Tax=Sphingomonas sp. FW-11 TaxID=1735121 RepID=A0A2T5FZI5_9SPHN  ali  16  16....AVVEAIKRVLQPAGFSKRGRKFRRFSEGNLALIELQRSVRSDQFTINVGIVSERGLDLKKVGCSHAHLNERIGFFLSDPQDKWWELD-DSTEASGAICEITALIREKVLPFLDRHLPDAGLIDLWKTGRSPGLTEG-QRVRYLSQL....... 168
70 7.000e-21UniRef50_K2JLG1 Uncharacterized protein n=1 Tax=Gallaecimonas xiamenensis 3-C-1 TaxID=745411 RepID=K2JLG1_9GAMM  ali  17  12.....IGKGLAAFLKAKGFTKSARTWHRQAGSSWQLVNLQASQGNGRFALNLGVYHGDVESRCKPKAHQVTHGARLGSPDLQG-DHWWSIRPDLA-PASVADELVALLERQGLPWLDAHLEPAVLAKSLAAQPSL---QSFSAALLAGDLRRVEAAI 172
71 9.000e-21UniRef50_A0A2M9EMA6 Uncharacterized protein n=1 Tax=Xanthomonadaceae bacterium NML120232 TaxID=2032575 RepID=A0A2M9EMA6_9GAMM  ali  23  50....IIKLGLGDALKSLGFKKQARNFRRIEPDGILVINIQSSLYNGVFTVNLGRYLPDMAREDKPKEHECHARIRIGRLLPGEADYWWQVDARS-NLDALAAELKEAVILHGIAWFESPDSM................................... 178
72 9.000e-21UniRef50_F7STZ6 Uncharacterized protein n=28 Tax=Proteobacteria TaxID=1224 RepID=F7STZ6_9BURK  ali  16  5MTRKLLTRHLYPVLKAEGFEGSGQTLRRIRGPIVHVFNVQGASGGKACYLNLGAHYDFLPCEGGIEESHCVFRERIDP--PPGPAFGWAYGPDAASAEENVAFIVSEWTRQGHAFFAGHDAYPTSCERLLRQTDPDAIHPARTLNLARIARHLGDT. 169
73 1.000e-20UniRef50_A0A1Q6A0T4 Uncharacterized protein n=1 Tax=Mucilaginibacter polytrichastri TaxID=1302689 RepID=A0A1Q6A0T4_9SPHI  ali  21  10..KTLVKIGVAPKLKELGFKKSNFNFNRPLDELVQCINIQRSQWNHNFTFNIGFYNEKIYRSNFIKVTDCFIWGRSGSLIYNR-DHWYELNLEKSYSD-VFSEVINDLENYIIPLFEKYSKLNTLTHFLVAK......................... 149
74 2.000e-20UniRef50_F5LQ00 Uncharacterized protein n=39 Tax=Bacillales TaxID=1385 RepID=F5LQ00_9BACL  ali  22  9....LIKQDVKPFLSKHGFAKKSLNFSKTTDGLIYLFNFQKSSGNSMFYVNCGIYSAELAQITAPQEVECHFRARIKEIARAVPDR-FAITPDT-NRDDLRKTLLSGLEE-VIHFYETMTSARSIVDYYISGPFLHLGEESFHLLLAAAAKRYLKAL 172
75 2.000e-20UniRef50_A0A0T6YM16 Uncharacterized protein n=1 Tax=Sinorhizobium sp. GW3 TaxID=647869 RepID=A0A0T6YM16_9RHIZ  ali  31  7.....LKRTLDELLKDYGFKPKGNSWYFRAEETISIVNLQKSQYGDQYYVNFAVVFRALMGDEFPKERHGHIRFRLDDVISQDLSGQDVLDLESQLTEQARRELFAGIVRPALEILARCESPIEIAHALKDRQLREWWCTVAALDFL.......... 150
76 2.000e-20UniRef50_UPI0009DB1C7F DUF4304 domain-containing protein n=1 Tax=Caulobacter sp. AP07 TaxID=1144304 RepID=UPI0009DB1C7F  ali  17  13.....IVSSVTEELSPLGYKKSGQLLRKVVGENAAIIEFQKSRGSTRFTINLAIVCPERTSLTKAKAMDGHFRIRIGEVLPGNADLWWNVVADSDGG-ALADEISSALIKHAVPNLEPYLDSRELLALWKSGSSPG-LTDVQRLRYISEM....... 164
77 2.000e-20UniRef50_UPI000B86ECF5 DUF4304 domain-containing protein n=1 Tax=Geodermatophilus sp. DSM 45219 TaxID=1881103 RepID=UPI000B86ECF5  ali  11  53..KRMLRQEIAPALRDLGMTGSSANFVLPDPDHYLLVGFQGSRSNTRFTVNLAVISKAAWRERWRPWWGKPTYMRLGELMPKHDDVWWGLTPDSGTAT-LAAEVVQAVQQFGLPWLSQ-------VRHWRNGASLP..................... 191
78 2.000e-20UniRef50_A0A1I0YZT8 Uncharacterized protein n=2 Tax=Rhizobium sp. NFR07 TaxID=1566262 RepID=A0A1I0YZT8_9RHIZ  ali  17  10...EVIKIGLIDLLRLHGFKKGGRNWHRAESDNWLIVNVQASTSGGKFTINLGVYVTAVAIVGKPMESQATVRERLGVLA-DGSDSWWTIEQSSDLN-AIAADLGDKMLSLGLPWLNAHLDISRVAATLENTPS------LRAVSAAFLAGDRDGAI 166
79 2.000e-20UniRef50_A0A2W5MK82 Uncharacterized protein n=1 Tax=Starkeya novella TaxID=921 RepID=A0A2W5MK82_STANO  ali  15  9....EFKNIVAAALKQRGYSKDGTIFRKIVDNNHIIVQFQKSASNSPFTVGLAVVSHEHERRTAFREADGHVRNRIGTFQAQPSDRWWTLS-STDRADAIIEELI-LLLSNGVDFFEKNASDEALIALWESGRSPG-LTDIRRKMLLAELKVLLST. 170
80 2.000e-20UniRef50_G9A4H7 Uncharacterized protein n=12 Tax=Rhizobiales TaxID=356 RepID=G9A4H7_RHIFH  ali  16  1MNERVIAQELAPYLGSVGFLRHGQTWNRRMDGVVQVIALQRSMTNSRFTVNIGVTPDIRPTRTSVAEHECQARQRIGFLRPARQDHWYRYLPDAASVELAVAEARADIEAHVLPYLSQRS..................................... 127
81 2.000e-20UniRef50_A6C112 Uncharacterized protein n=2 Tax=Gimesia TaxID=1649453 RepID=A6C112_9PLAN  ali  26  3.TTQHLKNAMHAELKPRGFQRKGSNWYLSGAQVIAVLNLQKSQYGGTYFLNLGFWLQQIEHNDFPRAHQCHITARASSLWPEGPRIADLLNLDDYPCDDRLDQLRRFIADKLVPVFKAGVTLEGLNQLLAEDDEFQITLAARNALGLA......... 159
82 2.000e-20UniRef50_A0A0S7XRI5 Uncharacterized protein n=1 Tax=Coxiella sp. DG_40 TaxID=1703354 RepID=A0A0S7XRI5_9COXI  ali  20  8..KRIIEKHVLPFLEELGFRRFGDSFKIIVSGNIGIIDFQKSNKSTFFTVNLAVILHSLYEIEKLREENGHWRERLGYLLPERSDVWWEVSKDTDM-DAIGHELVLIIKDYAIPEIMQYISDENLMNLWIEGKSPGLTYLTVLLKLKGYNKFLQKAI 178
83 2.000e-20UniRef50_UPI00036049F5 DUF4304 domain-containing protein n=1 Tax=Teredinibacter turnerae TaxID=2426 RepID=UPI00036049F5  ali  20  10...AIINLDLKALMKTKGFKKKARNFYKELDGVFLLVNVQGSMYNDNYTVNLGVFFPEIYEMTVPSIPDCSITKRLGHLKPEKTDYWWQLTPES-NLQQLATNLSVSVEQYGLSWLQRNSSISGASAELK-----GQNPFTAAATAFIEGNRAEAA. 168
84 4.000e-20UniRef50_UPI0004BE6D63 DUF4304 domain-containing protein n=1 Tax=Micromonospora parva TaxID=1464048 RepID=UPI0004BE6D63  ali  16  9..RAMLRDDIAPALRALGFKGSGSRYSLPDPGSWALLGFQSSRFNTTFTVNLCAVSRLVWESRRREYGHFVWSCRLGHLMPENRDVWWELDQDA-EAKDVASEVVAAISAHGLPALRE....................................... 140
85 5.000e-20UniRef50_E4W3D7 Uncharacterized protein n=10 Tax=Bacteroidaceae TaxID=815 RepID=E4W3D7_BACFG  ali  84  24.......................NSWYKTTSECIVVFNLQHSLYGKMYYLNLAALLRKGNDLPFPKEYQCDVRMRFPTMQIEDYSTQMILDLESDINEEKRTALIERIINDSILILQKLESIDGIIELYDEMPELNNIYPFSSILYRKEMN...... 151
86 5.000e-20UniRef50_A0A127VFT4 Uncharacterized protein n=1 Tax=Pedobacter cryoconitis TaxID=188932 RepID=A0A127VFT4_9SPHI  ali  22  1MDKKILLSEISNAIKDLGFKKKGSNFYYNSDGNIGVINLQKSKDSSSFTINIGVYFDQPGIKSKPLVADCHWRQRIGFLLPEQKDYWWHIN-DNISLDYLITEVTNVLISIAIPEIKNIL----LIKIWKK.......................... 137
87 7.000e-20UniRef50_A0A1L3KYI3 Uncharacterized protein n=2 Tax=Sinorhizobium americanum TaxID=194963 RepID=A0A1L3KYI3_9RHIZ  ali  17  206MDERVIGEDLAPYLRTVGFLRDGQTWNRRTEGVVQVISVQRSMNNSRFTINVGVTPDTRPANTRLAEHECRSRLRIGFLRAERQDHWYRYRPRDPASVRRAAEARADVEAYVMPYLSQ....................................... 330
88 7.000e-20UniRef50_UPI0005C6728E DUF4304 domain-containing protein n=1 Tax=Flammeovirga sp. OC4 TaxID=1382345 RepID=UPI0005C6728E  ali  22  10....LIKEVFKPAFKTAGFRIPGTTFKKQEKDFLKIFNVQNSAWNVSFYLNIGFFFPIVNEPKNPKEHDCIFRIRTDSLT--GRNHAYDILPETDLNE-LRTLLQTDLNDYVIPFFERYNELEDCLNLKNEFQDLHSSAEPYIGLTMMRNGKKD... 166
89 9.000e-20UniRef50_A0A1L8PV72 Uncharacterized protein n=1 Tax=Rhizobium sp. 58 TaxID=1798804 RepID=A0A1L8PV72_9RHIZ  ali  18  5..EQAVGRQIAAKLKADGFARRGQSFNRRRGCEIQVISLQRSRNNTRYTVNIGVTPDLGAPDAWVEASACRWRMRIGMLRPERQDHWYDYRPDDPENDAAIAETLADIEAYALPCLSE....................................... 125
90 1.000e-19UniRef50_A0A1H4BT62 Uncharacterized protein n=2 Tax=Chitinophaga terrae Kim and Jung 2007 TaxID=408074 RepID=A0A1H4BT62_9BACT  ali  19  5...RLLLAEVGAFLKAQGFSKKGNTCYIQKEGNFGLINFQKSISSTKFTINIGVAINGFIISGKPSITDCHWKMRIGFLMPVKKDFWWEIDGVTPVG-RMAEDIITNLQSLVIPEILRNISDKDLIEEWIQGRREG-ITEFQRYVYLTILLKF.... 164
91 1.000e-19UniRef50_A0A2N5CZ51 Uncharacterized protein n=1 Tax=Caulobacter flavus TaxID=1679497 RepID=A0A2N5CZ51_9CAUL  ali  19  31.....IREHLAPLLREDGFTGSGRTFRRRVAGLIHVVSVQGSSDGGRFAVNLGVQPLAIPDPRKITETDCVFRRR---LSRSGADQWWPHDGTRTGMDVAVQDAASVYAAVGGPAFAALS..................................... 147
92 1.000e-19UniRef50_A0A1C7NSP8 Uncharacterized protein n=2 Tax=Pararhizobium polonicum TaxID=1612624 RepID=A0A1C7NSP8_9RHIZ  ali  13  16..........APALRKLGFTGSGKTFRRLVDDMMWVINFQGNRHGGSFAVNLGLHPLAIPDSKTFTEPLCEFRRR---LSPSGIDYWWHYT-DRSSLEIAVMDATRLYETVGHTFFEKHTDQNAPLRTLTIEEFTAGHHELE............... 150
93 1.000e-19UniRef50_A0A2W5U8E0 Uncharacterized protein n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A2W5U8E0_FLAPS  ali  19  47..EEIYKETIVPLFKERGFRRKGQNFIRVTNDITQAANLQKSRWNHRFTFNIGIYNENINKIEFPNVTDCFFQDRLGTYTHK-KDFWHEITPKTDISK-LKNDLSHDLQ-LLFQLFEDYTSLESMKSFIDNER---QISPSTKIIFFMETGQKERAL 207
94 1.000e-19UniRef50_N1WM09 PF14137 domain protein n=2 Tax=Leptospira TaxID=171 RepID=N1WM09_9LEPT  ali  21  24..................FKRLGNHLYRNSNDLIHCIHFQYSQWNGKFTINLAIVYKFWTGNSLPKNPAWPIQVRLSSLLPEKFDKWWTVDLNTNLVI-LTKEIIECLQAYALPFFSKYSSINELFDELKFDKSIPGIFESQRPLLLAMI....... 165
95 1.000e-19UniRef50_A0A139CFT5 Uncharacterized protein n=1 Tax=Methanolobus sp. T82-4 TaxID=1794908 RepID=A0A139CFT5_9EURY  ali  18  7..KKLLKNEFSPALRNLGFKGSGFNYRKITNEHIYTATVQSCTWGEGCWIELGVTTDFLPDTKKVTPYKCEFRKRLKSPTSTINDSMWPYGNTEDEANLSIEEMIQVFETEGIAYFDKFKTVEDIVTDIPRKNGLYSMTEVRLALTLARLGNKNEAI 184
96 2.000e-19UniRef50_A0A2W7A9Q8 Uncharacterized protein n=1 Tax=Chryseobacterium sp. TaxID=1871047 RepID=A0A2W7A9Q8_9FLAO  ali  19  8..KKQISKTLSQSLKELGFKGSGFSYRKESEHFIFIIGIQASQYGKKCCVEIGIHPKEMTDLKTLKYYECEFRARLTKNQIKKWWNWWDYSNSEKTNIKTAENIILTIKNEAVPIIETFQNEDYILDNLEISDLSNPTKKLAGLNVIG......... 169
97 2.000e-19UniRef50_A0A1N0AST6 Uncharacterized protein n=1 Tax=Mycobacteroides abscessus subsp. abscessus TaxID=1185650 RepID=A0A1N0AST6_9MYCO  ali  15  14....ILADRVRPHLKARGFTKSGRTFRRKRYPLWDTINFQGSRWNSVFFVNIGVGSTEIDAAQQQSDPQPIFDRRWERVVPELPDQ---VTFDQHSDVQLLADGICDGLTQVVAVTDRFTTTAELVDWAVTHNKLHRMQQVCRYLATTGNLSLLSA. 171
98 2.000e-19UniRef50_M3I444 tRNA(Ile)-lysidine synthase n=69 Tax=Campylobacteraceae TaxID=72294 RepID=M3I444_9PROT  ali  25  1MKTKELIAQVKPLFKDNGFTKNGLNFYKNTPHFIYVVNFQKSSGNTRFYVNCGIHGAFIDAISKPKEYECHFRDRISSIIDSKIPYYEI--NENTDAAALCENLISDL-TAIFRFFDAVKTERNLIDFMLERNGLAVIDQLFEYLLIKHEQEIL... 163
99 2.000e-19UniRef50_A0A2E7P6K5 Uncharacterized protein n=3 Tax=Herbaspirillum TaxID=963 RepID=A0A2E7P6K5_9BURK  ali  24  4..KTKFKKIFGEVFSGSGFAKKGQRWFLPGKDAIVVVSLQKSDFAEKFYVNIGIWLRALGESEFPQENHCQIQVRLGSLFAEHVSLIDKACSLELAEQSDIDELLTILRERLVPFCRLSLTLEGLRQHAEAK-------LFVGALIFKQARDLLE.. 149
100 3.000e-19UniRef50_A0A238YWE1 Uncharacterized protein n=1 Tax=Maribacter sedimenticola TaxID=228956 RepID=A0A238YWE1_9FLAO  ali  18  10..EEIIKTCFHEELKPLGFKKKSNNFYKGLSEFGHIINIQKTMFGSKFTVNTGLFSNVFWKPKYPTEPVCVVRKRIGQFL-DGNDKWYEIE-ENTDTTKIKHELVHVLKTKILPFFSKVDNDFNLIDFLENEYKDYDVNLL-KFIMYGEYR...... 170
101 3.000e-19UniRef50_R6I4B5 Uncharacterized protein n=1 Tax=Ruminococcus sp. CAG:177 TaxID=1262952 RepID=R6I4B5_9FIRM  ali  19  10.....IQEIVYEYLKPLGFRKFGRTMHRVEEDISQVIHFQNGCPREKLWINIGIRVPECAEKKFKHEYECNIRTRLGFLI----DGEDTFYDLRKSPKMIATDIIERIKKYVIPVFDVLNSRKSILLYRANYPSFNRLITLEEAMIYGRSGDIEKA. 174
102 3.000e-19UniRef50_A0A1N7LS96 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1N7LS96_9BACT  ali  18  36.....IQREIYHFLKPLGFKKKGRTFNRQTEDIYQVINIQSGRYYGKFTINLGVMVKEIYELESHNDYDCQIRERLTHLTIKQ-DHWWTISDDNN---KTAKEVIDGLSSHGLDWLDNFENRDKICRNLLEGGSPRAKLDVALIELHRDRAKAEK.. 206
103 4.000e-19UniRef50_A0A1H7BIE4 Uncharacterized protein n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A1H7BIE4_9BURK  ali  19  1MNRKLLTQKLYPVLKAEGFQGTGQTLRRIEGPLIHVFNVQGASGGKACYLNLGAHLAFLPGPQEMEEAGCVFRDRMEP--PPGAAFGWAYGTSKAQAEENVDFIVSEWAGPGRAFFARHASYPRSFEQMLRETEPSRIHALHLARIAAHPGDRERA. 168
104 4.000e-19UniRef50_A0A2S8BEN5 Uncharacterized protein n=3 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A2S8BEN5_9MYCO  ali  12  16..EQLLSTHVRSFLKPRGFTKSGRTFRRARGPLYDLINFQGSKWNGVFFVNVGVGSTDMWPDSRKPPREYVLDRRWERLVPQLPS---EVGFDETTDLELFADLLIDGLARVLTCIDAIDTTRALAQWAIDHNLLHHMEKTCSYLA........... 167
105 4.000e-19UniRef50_A0A2V1IPE0 DUF4304 domain-containing protein n=1 Tax=Muribaculaceae bacterium DSM 103720 TaxID=2094237 RepID=A0A2V1IPE0_9BACT  ali  16  87.KRKFIFDKIADFLKEDDFKKRGNHFFKSNGSIGYCMNIQNDKWNNRFTLNLGIYTERFWLEHFPKEYECAVRERIGDLLPTNEDRWYSITSDTD-VMNLWDDIEHDLTDYVMPFFTGYNTESDVV............................... 225
106 6.000e-19UniRef50_A0A1N6GF93 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6GF93_9FLAO  ali  24  1MKEKIINGTVKPLLKSNGFSKKGLDFLKKKDDLIFIINFQKSRGNSFFYINCGIHSTIIDQIIDPKEYECHFRSRISTIIQSETDRYSIV--EETDLEISAENISSDLKA-VINLFDSIKNTNDLTDLMIAKNGLNNYEELFEFLLLTDNWKELK.. 165
107 7.000e-19UniRef50_A0A0J1G8N5 Uncharacterized protein n=2 Tax=Robinsoniella TaxID=588605 RepID=A0A0J1G8N5_9FIRM  ali  18  42..KVLIRNIFEETFKPLGFRRNGQNFRLQDNGLCKIVNFQKYRYNCSFTVNIGLYFEKNMQNKNFCESQCQIKIRP-YHEFYGEEKWWSVN-DDHNFDQFTNEVRSFLENRALPWLNEFEKKEDVIAEMLDKKYNYYLLHYDNACLLAECG...... 199
108 8.000e-19UniRef50_A0A2V7FK29 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7FK29_9BACT  ali  14  12....LVQTQFTGVLRPLGFSKAGRTYNRPSEGLVQVINLQIWRPDDKFTVNLGVWIPEVAEHHLIREYDCQVRGRLGQFVEPATDLWWPLNDSWPDSASAA---LTLLGAQGLAWLETFATRDGIIAGWNR----ASDARIVIAIIEAKRGRAPRA. 179
109 9.000e-19UniRef50_UPI000367B798 DUF4304 domain-containing protein n=1 Tax=Kangiella aquimarina TaxID=261965 RepID=UPI000367B798  ali  16  9...KHINETFIPLLRQDGFKGSGQNFRRVKGDVIHTINLQNNKYGGSCCLNVGVHFKQMPNLNKIKEVDSEFRFRVAP--EGKSDYWWKFRGNGGSTKKSVEHLCETYKVVGRAIFSRYGSVESVLEIFESEELSNGIIPSRVALALARINQH.... 175
110 1.000e-18UniRef50_A7GXC0 Uncharacterized protein n=4 Tax=Campylobacter TaxID=194 RepID=A7GXC0_CAMC5  ali  26  8....LINQTAKPLLKENGFTKKGLNFFKKQNELIFTINFQKSSANSPFYINCGVYASIFDTPLYPKEYECHFRERISTILKENDG--YFIDQNTDMNE-LGKKLTQDL-NLAVKFLDEIKSADELMKILLAKGGLNLIDTIFEYLLASKNEKI.... 162
111 1.000e-18UniRef50_A0A246BYQ6 Uncharacterized protein n=1 Tax=Mycobacterium peregrinum TaxID=43304 RepID=A0A246BYQ6_MYCPR  ali  13  52...QLLSQQVRPVLKQRGFTKSGRRFLRQRGPLYDLIDVQGSKWNHGFFVNIGVGSTEIDNPGNPNRPEYVLYTRWETLLPGMPRET---TFDQSTDMVFFAELFIGALRRLLDVIDPIDSSPGLAQWAVQRNLLNRMEKVCAYLAATD........ 203
112 1.000e-18UniRef50_UPI000D744B59 DUF4304 domain-containing protein n=1 Tax=Kangiella spongicola TaxID=796379 RepID=UPI000D744B59  ali  18  16..KELMKISLAPALRESGLKGSGQTYSIKSDEYWALIGFQKSLYSDKFTINIYVVPKQEWEESREKYWQIGWSERIGTLMPSKLDHWWEFNSQTNESELVR-QVVEAISKYAVPAMQS....................................... 146
113 1.000e-18UniRef50_A0A1K1LME2 Uncharacterized protein n=1 Tax=Prevotellaceae bacterium HUN156 TaxID=1520830 RepID=A0A1K1LME2_9BACT  ali  14  1MAQKYINDFLCNKLSLLGFKRKGQHFIRKCDDFTQTLSFIHSSHSRDYTILVSIRNSQMEKIGHDTEFGGGWSVNIGYLTPCENYKEWFVENSAPNDQEIIDDIISNIETYAIPFLNKYSDIKELIHGIEEGRFLSFQSEYKLPILYYLNGEYDLAV 168
114 2.000e-18UniRef50_UPI000783FB25 DUF4304 domain-containing protein n=2 Tax=Paenibacillus TaxID=44249 RepID=UPI000783FB25  ali  23  10....LMKQDVKPFLSERGFVRKGLNFNRKTDGLIYMFNFQKSAGNSMFYVNCGIYAAELAQIQSPKEAECHFRARIGDLAGDMPDR-FAIHPDTCMNE-LRNTLLGGLDE-AIHVYDTMTSARSIVDYYMSGPYLHLSEESFHLLL........... 158
115 2.000e-18UniRef50_G9S217 Uncharacterized protein n=1 Tax=Tannerella sp. 6_1_58FAA_CT1 TaxID=665949 RepID=G9S217_9BACT  ali  19  16....IIKEGIAPILKSAEFKKNGNNFYAHVGELDWCINMQKDRWGWQFTINIGVTWGDYAMCDFPLENSCPIRTRIGNFI--GKEDYWFILHPNQDCSPIKDLICSILQNRVLPLLKQHQCLNDLWDLIEDNHSIHTF................... 160
116 2.000e-18UniRef50_UPI0003B5E118 DUF4304 domain-containing protein n=1 Tax=Patulibacter americanus TaxID=588672 RepID=UPI0003B5E118  ali  28  5.TSKEVRAAFAACMKRAGVERKGALWYVRSSEVIVVFSLQKSQYAASFYWNVGFCLTDGGHERYPRPNDAHIRAREGMFAAEEQHISALLDAESDVPEERREGLCHFISERVLPFCADASTVDALREMVASGPLAH..................... 143
117 2.000e-18UniRef50_E8TEP7 Uncharacterized protein n=23 Tax=Rhizobiales TaxID=356 RepID=E8TEP7_MESCW  ali  27  5..EEAIVQALVETASHYGFRGRAKNFYREWPETICVLNLQKSSWGPQFYINAAVWFARLGPERRPKEYNCHIRWRVNSQMEDEQSFEQALNLEHPLPDDQRLSLIKDVDAYGFRLLSRCDSEEAALRVADE.......................... 137
118 2.000e-18UniRef50_UPI000D3DF0D0 DUF4304 domain-containing protein n=1 Tax=Sphingobacterium sp. M46 TaxID=2152717 RepID=UPI000D3DF0D0  ali  20  32....IVEKDIYAKLKPVGFKKNGRMFRRLDDGIIQVINLQSGQYYGKFVVNLGVCIESLYNKKYYKEYDCQIRDRLGTLL-TGQDYWWTITDDNN---KITQEIIEGIETIAFKWFSGLETKEKIIS--NNGHLPYDATPRAKLDIALIVWFDDKA. 200
119 2.000e-18UniRef50_UPI0004813B37 DUF4304 domain-containing protein n=1 Tax=Caulobacter sp. URHA0033 TaxID=1298862 RepID=UPI0004813B37  ali  13  11...KELLDGIGRKLKTQGFTKSGNAFRRVASGNSAIVEVQRSQSSTRFTINVGIVCEYQPDVSKAGSMHAHLRKRIGEFLPKPTDQWWDLDGFTDT-DVLATELGPLL-DVATHFLLDHADDAQLIALWESGRSPG-LTDHQRQRVLGELK...... 164
120 2.000e-18UniRef50_UPI0004196CAD DUF4304 domain-containing protein n=1 Tax=Gelidibacter mesophilus TaxID=169050 RepID=UPI0004196CAD  ali  17  1MTNKEIKNIVAPIFKRLGFKKSGTNFYRKTDDIIQVFNFQKSSMNFEFVGNIGFIEPETYLPKFPKCTDALIEFRLGTITHDGLDYWYKIQNDNRSAALIIQLQKDLIL--IENLFENHKTLLSLEKFFSDRKISGFYGELGQFALFKKIGK..... 171
121 3.000e-18UniRef50_A0A1Y3WRT1 Uncharacterized protein n=1 Tax=Alistipes sp. An54 TaxID=1965645 RepID=A0A1Y3WRT1_9BACT  ali  19  15....IIKEGIAPILKSAEFKKNGNNFYAHVGELDWCINMQKDRWGWQFTINIGVTWGDYAMCDFPLENSCPIRTRIGNFI--GKEDYWFILHPNQDCSPIKDLICSILQNRVLPLLKQHQCLNDLWDLIEDNHSIHTF................... 159
122 3.000e-18UniRef50_A0A0R3N6R0 Uncharacterized protein n=3 Tax=Bradyrhizobium TaxID=374 RepID=A0A0R3N6R0_9BRAD  ali  16  8.....IKEHLAPVLKDDGFVGSGRTFRRISGDLIHVVQVQGSRYGGQFAVNLGIQPASIPDLTKIRPELCEFRRR---LSEAESDQWWNHAGSKESMDAAVRAAASVYATIGRKLFAEMSGPESPLHNI............................ 135
123 3.000e-18UniRef50_A0A1D9PEL2 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1D9PEL2_9FLAO  ali  18  4MMSKDYKKVITRELKEQHFKKKGNLFSFSNGDLTYFIGVQSSQSSTKLTVNASVSISKLDDTSLPIEHQRHYNRRIGFYLDDKQDKWWTVE-SIDSAIKAANEIAEIIGEKVIPNFETIRSTSDLVTLWRNGGWLG-ITEGQRKHYLSLLENFEK.. 167
124 3.000e-18UniRef50_A0A1I0SAC4 Uncharacterized protein n=2 Tax=Chitinophaga arvensicola TaxID=29529 RepID=A0A1I0SAC4_9BACT  ali  26  1MTKTLVSGAIAPLLKKNEFRKKGLDFYKTTQDLVFDVNIQKGKQQAYFYINIGIYSPELDENGQPKEFECHFRRRIADLINAGQDR---YMADTTTAAQITTDL-----DLAMDVLDKIRSANDLVKLMCERGGLENYEKLVSYLALTDNHTLLKT. 160
125 4.000e-18UniRef50_A0A1V3DDA6 Uncharacterized protein n=10 Tax=Xanthomonadaceae TaxID=32033 RepID=A0A1V3DDA6_STEMA  ali  23  5.TKRAL-SIVYASLKDAGFVRSGPTFTRCRENFIDVLSPQIRSDGKALALNVGVLARFMDRTTNLNETDCDVRCRAAP--PGNSDHWIAVEKD---ADLLRTEVDALLTESALPFFSKFQDIDSICEAL............................ 131
126 5.000e-18UniRef50_B7VDY1 Putative integron gene cassette protein n=2 Tax=Bacteria TaxID=2 RepID=B7VDY1_9BACT  ali  19  9..RDLLKCIVAPRLREYGLKGSGQNYAIKSDSHWALIGLQKSMFGDKFTINLYVVPKEHWDATRREHWPVGWVKRIGYLLPKGQDHWWPLDANTELN-GLADEIVDAICNKAVPAMQE....................................... 139
127 5.000e-18UniRef50_UPI000DD3F33A DUF4304 domain-containing protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DD3F33A  ali  12  11..KSDVIKYLSNELESKGFYYRNYTWQKVREDFVDVIQYQYSRRTKMFTFNVGIVDVSAWIVYWFDEATCTVRVRIGELLAGGLDKWW-------DAEKFGAAEASEVADGALSFFSQLSDRQSLLKHLESRSYLVAAMKPYIPILSHLLGDTERAL 166
128 5.000e-18UniRef50_A0A2T4V2N8 Uncharacterized protein n=1 Tax=Vitiosangium sp. GDMCC 1.1324 TaxID=2138576 RepID=A0A2T4V2N8_9DELT  ali  23  16..........KPIAKAGGFKKKELTWRRRHGETIQVLNVQRSHGNTSCYVNVAISFDALYCLGNPREYECHYRQRMEHLVPGAPPAW-SVDANTDEA-ALTARLSADL-ARAIAFLDAVDSPAKLLQHLDEGSGL-----FLRAQLRYVTGDPDGAL 166
129 5.000e-18UniRef50_UPI0004228A33 DUF4304 domain-containing protein n=1 Tax=Flectobacillus major TaxID=103 RepID=UPI0004228A33  ali  14  1.MKDLIKRLFKETTIP-GYNKSNLTFFKRKNNFTYIINIQPSRNNEYFTINIGVYCPEIHQLIWPVETECTFRTRVNYFLNSKKDFWLELSNDNEVFYKTQNFITSLIEEKINPFFDFVIDYNALRKIMIDWEGSDSQYPLFKIQLA.......... 155
130 5.000e-18UniRef50_A0A0Q8UBM5 Uncharacterized protein n=4 Tax=Phenylobacterium TaxID=20 RepID=A0A0Q8UBM5_9CAUL  ali  12  1MTRPSYTTALDRALQPLGFAREGRDWRRLRGEIQDWVNLQKSWIDGSMTVNLFAKNLETERIMRSIACDEELGVRQSGQRIDGRDRWWKNNPNGP------AEVAKAVQVYGIPWFERVQSLEDEASKWYGRGTTGSWSKTVLAVTLFRLGALEEAL 158
131 5.000e-18UniRef50_UPI000D557CE2 DUF4304 domain-containing protein n=1 Tax=Anderseniella sp. Alg231-50 TaxID=1922226 RepID=UPI000D557CE2  ali  15  17...RALTRTVDTLLLPEGFNRSGVIWTRLRNTFFDVIDIQTSRYDHHFTINVGVCDPQIFSQIWGRETDCIVESRIGYISGQT-DVWWDLR-----DQQAVNEVSRVLEREVIAFLEGQQNHKDMLDWLLKTKTLKQMYPLERAVLYHSVGELD... 172
132 6.000e-18UniRef50_UPI000DE9737D DUF4304 domain-containing protein n=1 Tax=Bacillus taeanensis TaxID=273032 RepID=UPI000DE9737D  ali  21  8..KELVKDTIAPIFKKEGFKKSGNYFYKKNEELGWCFHIQLDQKGNTFTFNVSIFVPGNDLPKFPKVEQGVYERRITELRNVKGGYWYRLNNEYIDIIKLKELIISHITTYIFLYFHDLSDVKSVIQALENQTRFENRHHLAAMHTYYGDRNKGKQL 174
133 6.000e-18UniRef50_UPI000B894FE6 DUF4304 domain-containing protein n=1 Tax=Opitutus sp. GAS368 TaxID=1882749 RepID=UPI000B894FE6  ali  18  21..................FKKLGATWVRDCEEVFCVLNVQTSQWSELYYFNVGVSVKALFTGAKPSFYDCHFGERIPQGDEVEVYGDLDFSGERPSAAERIERLADMIPASAVAWFSRHDSAEKLRARASDSP........................ 136
134 6.000e-18UniRef50_A0A1H4D6P3 Uncharacterized protein n=1 Tax=Arachidicoccus rhizosphaerae TaxID=551991 RepID=A0A1H4D6P3_9BACT  ali  25  5...KTFKKTVGDFLFGKGFTKKGNFYYLSFENLIIVIGFQKSNFSNGYYINIGVITELNPNLLTPKDVDGDVRARFSIVLNEKKV--DLFDLDNLNEDELINAIDDNIRCYV----DGITSVEKLKLLLKENPVMLYQTKLVAKQLLK......... 144
135 7.000e-18UniRef50_A0A2R2W8U6 Uncharacterized protein n=1 Tax=Frondihabitans sp. 762G35 TaxID=1446794 RepID=A0A2R2W8U6_9MICO  ali  20  19..RETLRTMVGPALRRQGFLGSGSTWRRRNPHGWAVVNVQKSAWGDRAYVNLAIVPTARPLPRQPTEWHGVWRARLDPLPTDHRWGRDWDFGDGTRADDFGSALVDRLDSYGVPVLERLLDRDRFLSMLRD.......................... 162
136 8.000e-18UniRef50_A0A1A5SVY5 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1A5SVY5_9RHIZ  ali  25  5..REIIVQALVETASRYGFRGRATNFYREWPETICLLNLQKSSWGPQFYMNAAVWFTRLGKERRPKEYNCHIRWRVNSQMEDEQSKAFTLNLEHPLPDDQRLSLIKDVDAYGFRLLSRCDSEEAALR.............................. 133
137 8.000e-18UniRef50_UPI000948A075 DUF4304 domain-containing protein n=1 Tax=Alteromonadales bacterium BS08 TaxID=1895005 RepID=UPI000948A075  ali  19  9..KELLKNTVAPALRENGLKGSGQEYSIKSDDYWALIGLQKSMYSDKFTINIYVISKLQWDEGREQYWQLGWSERIGTLMPSKLDHWWEFNNQTNKRE-LARQLVHAIMEYAVPAMQS....................................... 139
138 9.000e-18UniRef50_UPI0007CD78EE DUF4304 domain-containing protein n=5 Tax=Rhodococcus hoagii TaxID=43767 RepID=UPI0007CD78EE  ali  16  35.........IAPLLKSHGFRKQKLTFTRDRDGLGDVVNLQRSAGNNNFYVNCGVYSAEFDREERPKEVDCQYRRRIEHIAP-GVGPHVTVTTDTDVP-AVAEQMRVALVA-ALDVMGRLGSPDDVARAVDSD----IDFDVFRYRLASEVGAREQ.. 185
139 9.000e-18UniRef50_H8KTP6 Uncharacterized protein n=1 Tax=Solitalea canadensis (strain ATCC 29591 / DSM 3403 / NBRC 15130 / NCIMB 12057 / USAM 9D) TaxID=929556  ali  22  1MDSKIFKKTVANFLIGKGFSKKGSYYYLFFKDLAIVVGFQKSNFSNDYYINIGVISELNSNLLTPRDVDGDVRARFSELEGKKVD---SFNLDKLTVDMLINAIDENIKHYVL----EITSIEKLKLLLQENSIMLYQTKLAAKQLLKL........ 144
140 1.000e-17UniRef50_A0A1N6NVG7 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1N6NVG7_9FLAO  ali  24  12MDSKEFKVIFGEIAKSYGFIKAFSGWYKKNAESIAILELQKSNFGDYYQLNIKVFVQKVFNRTYEPNKDLIKSSLGHVNSSETKPYSRILNFDDHMEDNIRIELVELFNNHIVPFINKTSSISGILNLEEAGEIF...................... 147
141 1.000e-17UniRef50_D5SPU7 Uncharacterized protein n=2 Tax=Planctopirus TaxID=1649480 RepID=D5SPU7_PLAL2  ali  20  14...EIVKRAVTSVLKPLGFRKSAMNFHRRHEKVIQVVNLQLSQSSSHFYVNVGVAFDEICQLEKPNEYECDFRGTRDRLECDNLPKQWSVQADLD-VELVERQLKAAMEQLAF----EFASLDGVAAYRTHRWFDRFRPKQENAQVLYILGDMDGA. 173
142 1.000e-17UniRef50_A0A101XZP0 Uncharacterized protein n=4 Tax=Paenibacillus TaxID=44249 RepID=A0A101XZP0_9BACL  ali  11  7..RKLIKKYLAPALHELGFSGTDHHFVRDQNHVIYTIVIQADKYGGSCVVELGVHFDFLPNSSKLTVYDCEFRTRIIHLNKKANEVWFRYGDTEDESKAVLDKMKGMIVSQGTMYFSQFRDFPNPINSITTKELSHRTKRLDRARTHAFLGNTEEA. 190
143 1.000e-17UniRef50_A0A2H9ZQH3 DUF4304 domain-containing protein n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A2H9ZQH3_9ACTN  ali  20  1MINSVLLEAFNEVFKSLGFRKKSANWYRVSGDLYCIVGVQESRWDESCYVNVGFTPAVNVKAGWLPESKCLVRFRADAITSISREDLDLLSGEAAKADDLRVGLLEKIANPAARAVDPVENMQNLKSLLR........................... 133
144 1.000e-17UniRef50_A0A1I5GCH4 Uncharacterized protein n=1 Tax=Variovorax sp. PDC80 TaxID=1882827 RepID=A0A1I5GCH4_9BURK  ali  17  9...KLLTRQLYPVLQAEGFEGTGQTLRRIAGPVIHVFNVQGASGGKQCYLNLGAHLDFLPTPTEIEESHCVFRDRMDP--PPGPAYGWAYGSSMAETEETVAFIVSEWSRPGRAFFARHGSYQGFVQMLRETDAIHARTALHLARIAVHLGER.... 166
145 1.000e-17UniRef50_A0A2S8FYT4 Uncharacterized protein n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FYT4_9PLAN  ali  19  52..NELMRRSVTPVLKPLGFKKSSANYHRRLGDVVQVVNLQVSHGSTSFYINVGLAFDAVCKSEKPKEYECDARGRLETLVADVPDVW---TCEPGNVDEVAPQLSVAIEA-----LSRDLNAIDSVAAYREHRWFDQMRSL-NAQIFYLLGDFDSA. 209
146 2.000e-17UniRef50_A0A1I2WJ35 Uncharacterized protein n=13 Tax=Neisseriaceae TaxID=481 RepID=A0A1I2WJ35_NEIEL  ali  13  13.....IVKDLHTLLKPLGFKKKGNHFHRQTEHGVQLIHTQKSQWNDKFTFNIGLTCPLLQNDPRFHEYDCLTHERIGRLLPEQERHDLWFEADDGSGSTVVHEVQTMMQKLVLPYFAAHTKPQQLYPLIGNR---------YAMRLAVKLGEAEQA. 171
147 2.000e-17UniRef50_UPI0006DD001E DUF4304 domain-containing protein n=1 Tax=Flagellimonas eckloniae TaxID=346185 RepID=UPI0006DD001E  ali  22  1MTNQEFKAELDQLLKPHGFKKKGNKWTSETEELEKIIELQKSNFSNSYYLNYGFNFKDLDY----TEVTMHIWNRFGSKRKENKIFIKTLDLESPNPTERIQNLKLFISSLLLPEINGINAKEDVVKKLKSRKHLNDVFLRVK.............. 141
148 2.000e-17UniRef50_UPI000A38D1DD DUF4304 domain-containing protein n=5 Tax=Streptomyces TaxID=1883 RepID=UPI000A38D1DD  ali  20  19.....VVRVIGEAVKPLGFQRHGHSWYRVTSNLYAVINVQKSRWDESCYVNIAFSPASQAENSWLPESKCQVRFRLDSLKSVTPEGLLLLGADSVTEVEFRSSLAEKIGAPVALFMSGITGLGDLKDAL............................ 145
149 3.000e-17UniRef50_H1Z992 Uncharacterized protein n=2 Tax=Myroides odoratus TaxID=256 RepID=H1Z992_MYROD  ali  22  1MEKKELVSILNEVLAPIGFKKKGDYWVINGDEITKMINLQKSQFANSFYINYGYILKSVPLNGLMMH---VFKGVGSTDKIEQQRITRLLDLSNNIPEERANELKKLLYERLITNIQEVSTEEDVLNQLKKRPHLNDIPLVIKKYF........... 144
150 3.000e-17UniRef50_UPI0009043B0D DUF4304 domain-containing protein n=1 Tax=Hymenobacter sp. PAMC 26554 TaxID=1484116 RepID=UPI0009043B0D  ali  15  10...QLVKATLWPKFKALGYKKSGNNFRYYNPDGWRIVQFQKSQSNSTFTVNIGFYLKIFERYPKFQEVVCAVRKRYGKLKSSPSDSWIELTDTSDMAK-ISQQLVDDFTQYVHPYLFSIKGREDIYAFLIAGHHSDY--PAAQIETMFHAGYQQEAL 172
151 3.000e-17UniRef50_A0A1B8W860 Uncharacterized protein n=4 Tax=Bacillales TaxID=1385 RepID=A0A1B8W860_9BACI  ali  16  8..KRLLKETFEQELIKYGFNGTGGKYRKPNNHFIYTVNIQADKYGGSCCVELGVYIDFIPNPSKVSSYDCDFRWRLSDL--EDEDLWWSYGETEIEALENIGHMTEIFVEYGLRYFEYFTSIEDIEQSNKNVKRWGELPTDIRLALHLYVNNSEQAI 182
152 3.000e-17UniRef50_A0A0H3IBU8 Uncharacterized protein n=5 Tax=Pectobacterium sp. (strain SCC3193) TaxID=1905730 RepID=A0A0H3IBU8_PECSS  ali  20  4MDEKSVVSKINSVFKRNGFIKKRNSWRKSEKDVAIIIALQKSRYSNNFTFEVGICVDQSRDVAKLTHYTCGISFRFNKIPGFDTINIDSALDLDSDDTFFFSDMIVFLEKYGVNFIEHFLDLSYLKLLYNDGFFKDKMIDNISELILSE........ 152
153 4.000e-17UniRef50_F2IIV5 Uncharacterized protein n=1 Tax=Fluviicola taffensis (strain DSM 16823 / NCIMB 13979 / RW262) TaxID=755732 RepID=F2IIV5_FLUTR  ali  16  47..KKSITKYLTPKLRELGFKGSGGNFKKTSGHYIHTIQLFGSKYGGEGYVEIGVHLDFLPDSTKIKTIDCFTRH---SLHLENGKQMVDYGANESETKESIELIYKMIIEDALPYFELFNDFPSPFDKISLSDLTTDNSEFDKYRLSGKMGQKEEA. 214
154 4.000e-17UniRef50_UPI0009EF637C DUF4304 domain-containing protein n=1 Tax=Mitsuaria sp. 7 TaxID=1658665 RepID=UPI0009EF637C  ali  16  11....EFKKSLAEALAPLGFLLHGNSLSREKNGVRILIELQRDKYGTRFTLNVGLMSRGVETPTVIPESDWHWRSRLGQLLPDRTDRWWEIS-DDDSEKSVREEVVDGILAYGLPKLEPLADVDQLIMLWKSGQGAGLTEYRRRRNLARLLGRTEEAL 179
155 5.000e-17UniRef50_UPI000647A885 DUF4304 domain-containing protein n=1 Tax=Methylibium sp. YR605 TaxID=1500265 RepID=UPI000647A885  ali  12  1MTPAELKRALQTVLRPLDFRKMSSLFQLDRGKVVHLIEVQGSNDNKKFTVNVGVFYPDVRDITKPSIALAHWQTRLGSLSPENKDLWWHVASPGEAATAAADIADRT-QKFALPALAQLADLSALAVLWKSGRSPG-LTEFQRVELLSRLQEHLS.. 166
156 6.000e-17UniRef50_UPI0009FA6E0F DUF4304 domain-containing protein n=1 Tax=[Polyangium] brachysporum TaxID=413882 RepID=UPI0009FA6E0F  ali  13  1MSSVELRAAVQSLLRPLGYRKSASLFARQSEDVVHLVEVQGSRHSTKFTVNVAVFYPDVRDVTKPSIAGAHWRKRLGRLSRENEDVWWRVSTIEQ-AEAVAHDIAVRLEQYAI............................................ 125
157 6.000e-17UniRef50_A0A0Q6NTH5 Uncharacterized protein n=1 Tax=Devosia sp. Root105 TaxID=1736423 RepID=A0A0Q6NTH5_9RHIZ  ali  13  9...KRLDDAIDPILKAEGFGSRGRTFNRKTEDIVHVVQVTMTRSDGTFSVGLGVYVPEYWQPTKVGEIDCCVRRDLTELWPFGRTGVWPIDG----PAELYGDIATYLERYAMPFFERHAERQAMIAELQDGPGAGGPPRVVAAIILTELGRVDDA. 186
158 6.000e-17UniRef50_UPI00054E5AFA DUF4304 domain-containing protein n=1 Tax=Edaphobacter aggregans TaxID=570835 RepID=UPI00054E5AFA  ali  20  5.TEKLFRKELRPLFKENGFRAASQNFILESAQCWVIVNFQKSRWADHFYVNVAACSKRWPAERVPPYYGCDWQWRVEHFGPDKDIKQWTLRDEEGLEQTLV-YLRHLFQEFVLPATRTMTTEAGLTEH--SGGFEYPQLKTRAVILAA......... 161
159 8.000e-17UniRef50_F1TJJ6 Uncharacterized protein n=20 Tax=Rhodococcus TaxID=1661425 RepID=F1TJJ6_RHOHA  ali  17  35.........IAPLLKSHGFRKQKLTFTRDRGGLTDVVNLQRSAGNSHFYVNCGVYSAEFARVERPKEVDCQFRRRIEHLAP-GIGPHVTVTADTDVS-AVAEQMRAALVA-ALDVLGELDGPDAVARAADSD......................... 164
160 8.000e-17UniRef50_A0A0B7HLT2 Uncharacterized protein n=5 Tax=Capnocytophaga TaxID=1016 RepID=A0A0B7HLT2_9FLAO  ali  22  16.......KAIYDLLKPIEFRKKGNSFYRIENTICQLINIQKSIYNNTFTANICVKHLET-DENIPSVTHFPIRERIGNLKESG---DFWYTFDEIQDIFIRKQILKDIEKYALPFLNKFKNKEDIENFYE........................... 146
161 8.000e-17UniRef50_A0A2V3TY84 Uncharacterized protein DUF4304 n=2 Tax=Chelatococcus asaccharovorans TaxID=28210 RepID=A0A2V3TY84_9RHIZ  ali  23  8.DRKELKASLGVILKPEGYRAQDLNWRKTTDDAILVVNVQRSMWGQEAFINLGVFSRRLGDHASPKAFQCHLTARIGQLAPEMDEKLQRITYRSIQSDAMLTAIDQTMRSRILPLLDVASTYEGQRHVIASINRANNI................... 149
162 9.000e-17UniRef50_A0A257LAQ4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium B1(2017) TaxID=2015582 RepID=A0A257LAQ4_9BACT  ali  18  7...KLILSFVSEYLEPFGFKRKGNTFYILKNNNLGLINFQKSSKCSIFTINLGISSTNDSLKLKPDIDDCHWKKRIGFLLPQKQDYWWEINSNTSIDSLLV-ELTTLFSTLVIPEIINNIADECLEQQWIQGESAG-ITELQRLIYLTTLLKVGK.. 167
163 1.000e-16UniRef50_A0A2A8MIV7 Uncharacterized protein n=1 Tax=Bacillus sp. AFS001701 TaxID=2033480 RepID=A0A2A8MIV7_9BACI  ali  23  1MDIKEFKKFVDEVLLTKGMKKRRSNYYFDNEEIISVLGLQKTSYTNGYYLNFGYVIKDLNTKEHPNYTDGNIRLRFEFKINRK--LTDLIDIYNVEKELLIEQFHKNINNYILP-IKKISDLQKLIKK............................. 125
164 1.000e-16UniRef50_UPI00094E05E8 DUF4304 domain-containing protein n=1 Tax=Prevotellaceae bacterium Marseille-P2826 TaxID=1852368 RepID=UPI00094E05E8  ali  20  1MDRKKIVRVIKEELSGFGFSQNGKEWFLGSDEVVFVLALQKSSFDDCLYFNVGIYIYSLSMITRPKERECHIRTRLEDLFVHQIGRTPPNLYYTDTDEDFEKSLRILLKQFLCPLLSPLTNISGLKELYRNNVFSKSLISREAREIISNL....... 152
165 1.000e-16UniRef50_V6S444 Uncharacterized protein n=1 Tax=Flavobacterium cauense R2A-7 TaxID=1341154 RepID=V6S444_9FLAO  ali  17  10....IIKEVIAPALKKIGFKKSGNNFFQEGERFTKVFSITNSSWNDQFNLDIGILFHIANEIKVSNTSSCHFE--ISVLQLNGSDQLFKIGPETEIS-NFRKYVDDTINDYVIPFLNHYSNIEDCTDLYSKYTSHGWDIKPFIGLTLIEKGNIE... 165
166 2.000e-16UniRef50_A0A0H3J444 Uncharacterized protein n=3 Tax=Clostridium pasteurianum TaxID=1501 RepID=A0A0H3J444_CLOPA  ali  20  11..KSIFKNHITPKLKNEGFKKTGNTFYRLREEFIDVVNVQFGRSNSYFTYNIKVVIPSFFDIYRDKKLDCIVDYRLGTVMGFKTDYWYKIRYDWMNIEQITNTVLEDIDSIVLKFFNMIQDVDDLAKLISNSKIKIDIQQFFLSVYLIEKGKVDQGI 221
167 2.000e-16UniRef50_A0A084DEC9 Uncharacterized protein n=5 Tax=Burkholderiales TaxID=80840 RepID=A0A084DEC9_9BURK  ali  17  12....VIRESLAPSLRADGFAGSGRTFRRVRNAWVQVVNIQGAREGGRFAINLGLQPLAIPDPKRLTESLCEFRRR---LAERGADQWWSHAPAAESLRAAVSAAARVYVETGRPLLDRLATPDMPMNTVTPDDFAHGRYDFRMALALARLRQ..... 171
168 3.000e-16UniRef50_A0A1I3P2E5 Uncharacterized protein n=1 Tax=Planctomicrobium piriforme TaxID=1576369 RepID=A0A1I3P2E5_9PLAN  ali  21  6....IFTTTFGRSLKPAGYKKRGDTWYKFNKDTICLVNIQKSDWGNEWFVNLAVWINGIEKPERPLHNHCQLQVRWEVLAPERKNLLMRLYDNSLSDADRIPILTEMLENTVIPFLERASSFKGLKSIISDDRIKNHFWEIAMPFL........... 169
169 3.000e-16UniRef50_J1KP14 Uncharacterized protein n=1 Tax=Flavobacterium sp. F52 TaxID=1202532 RepID=J1KP14_9FLAO  ali  22  1MDAKEIKIYLKPTLKDFGYKTSGQTWWKDKGEFYTLINLQNFSWNTNFCFNIGIVLKSEIKDKKPKIYDVIVHLRENSYLSDKNDKHSFRNKTGYLLEDFYKELKSDFENFVLPKLEKLNSLQDCIDTFGKIPFFG..................... 153
170 4.000e-16UniRef50_T0PG39 Uncharacterized protein n=1 Tax=Clostridium sp. BL8 TaxID=1354301 RepID=T0PG39_9CLOT  ali  26  1MDKKIFKKALEEVFRKFGFQYESNAFYHDDGSIITVITLQKSNFSNSFYINFGFLIKEEPDMIYPKEYDSDVFGRFT--LELNGECCQSIDLDTVIIDDLLSAVTQFMNINIKPVLEGC-----LAKYFEINPKAVHTMSLRAKKYFK......... 142
171 5.000e-16UniRef50_A0A239WEP2 Uncharacterized protein n=1 Tax=Chryseobacterium taklimakanense TaxID=536441 RepID=A0A239WEP2_9FLAO  ali  18  12.....IKTYLKPTLKEHGFKTSGQTWWKSKGDFFLVINLQNSQWNSKFCLNIGVALTEDKEKKKATYVDLQVRERQQIKKSQGGWLGYKIT-DKTNLSEFITDFKIDLEDNILKILNSFETLHDCITFYQKFGFWGDNLKRQ............... 163
172 5.000e-16UniRef50_A0A1Q6S2L6 Uncharacterized protein n=1 Tax=Oscillibacter sp. CAG:241_62_21 TaxID=1897012 RepID=A0A1Q6S2L6_9FIRM  ali  19  20.....IEAAVYAHIRPYGFRKYGRTLHRFVSDISQVIHFQSHGMGGLLCVNVGIRIPECSDRVFQPEYDCTIRSRLGTVSG-GQETWYDLREKT---DRIVKRIADETDRHVLPAFEVLSSREAILQHRREYPLLDNMSSLEECMIYGHLGDIEKA. 184
173 5.000e-16UniRef50_A0A1T5GJ12 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1T5GJ12_9SPHI  ali  14  4MNASEFKKLLAPRLREKGWKGSGFNFYRTTDNIVHILGIQGAWYGGSVCCETAIHFDFIPDPSKVSYASCMVRQRLSP--KGGGDYHWTFRDNEHDNINSLNQIFEALETFGEKFYQDFNNFPSPFDKIKPNDFLERVVLLDKYYVYNEF....... 164
174 6.000e-16UniRef50_A0A1M6W165 Uncharacterized protein n=1 Tax=Hymenobacter psychrotolerans DSM 18569 TaxID=1121959 RepID=A0A1M6W165_9BACT  ali  15  12..TRLLSGKLWPEFKKRGYKRHCGNFRYYDAAGWKIVNVQKSAFNISFTINTGLYLRERANEEKFLEPDCLIRKRIGSLAGNDLDLWYNLDGQTVWSD-VEAVVTQDVHQVVLPYLDGIRSVEDIMHQLFRERGPGVFAGIRALFVYGRKAE..... 172
175 6.000e-16UniRef50_W2ESW2 Uncharacterized protein n=1 Tax=Microbispora sp. ATCC PTA-5024 TaxID=316330 RepID=W2ESW2_9ACTN  ali  10  9..RQMLRDDFAPALRELGLVGSGPLYRLPHDRHWALLGFQKSAFSTRFTVNLSVVPKERERSVRTFYGLSMWHSRIGRLLPGGHDHWW--DVGTAPDPAVVDQVLDGVRDFALPAMRRQLDR................................... 139
176 7.000e-16UniRef50_A0A1I6BP57 Uncharacterized protein n=2 Tax=Siccationidurans arizonensis TaxID=1227077 RepID=A0A1I6BP57_9BACT  ali  14  15....VVAQVLAPLLKTRGYRKSGSLFRFYDPSGWKLVAVQKSAHRVRFRLNLGVYLPETEWAFRFTVPLCVVRTSVGRLDGSHRDVWYEAS-EQIPPEALCQQVAHDLTAHVLPFLDQFTSRQTVLAHL............................ 152
177 7.000e-16UniRef50_B7GLX8 Uncharacterized conserved protein n=8 Tax=Bacillaceae TaxID=186817 RepID=B7GLX8_ANOFW  ali  30  1MERKEFKKIVNDCLLANGFLKKGKYYYKESPEVICCLGLQKSNYSNCYYVNVGIVIKEINKLELPRDVDGDIRCRF-YFKVEGKEVDCLDLDRINESSVIVSSLEANISEIINP........................................... 114
178 8.000e-16UniRef50_A0A1D7Z0E7 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1D7Z0E7_9GAMM  ali  21  2MDRKSVISEINLIFKRNGFIKKGNSWRKSEKDVAIIIALQKSRYSNNFTFEVGICVDQSRDIDKLTYYACGISFRLNKIPGFDKINIDGALDLDSDNAFLFSEMIVFLERNGINIINLFFDLSYLKLLYNDDFFKSKMIDDISRLILSE........ 150
179 9.000e-16UniRef50_A0A017RTF8 Uncharacterized protein n=2 Tax=Fervidicella TaxID=1403538 RepID=A0A017RTF8_9CLOT  ali  22  11..KQLIKENISPIMKAAGFKKSSNNFYKDLGDIGWCFGVQSSSWNTIFTFNTAIFVPALYKPMFPKEYQGIYRRSISKLLNEDEK---WYRLRTISEYNGLKSIVEHIQEFILPRLKEITDINALLEGITQSKYDEN--PICIAILQKMIGKQIES. 171
180 1.000e-15UniRef50_A0A2T3CVV9 DUF4304 domain-containing protein n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2T3CVV9_9RHIZ  ali  24  7.....IVAAVGAQLRPLGFRKNARSWCLENPETLLFVNVQKSQFGNQFYLNCSVVFRSISTVDRPKEYHGDIRFRLESLSPSEADLCELLNLENGLSDEERQAKFADLVDRALPLLLRCR..................................... 124
181 1.000e-15UniRef50_A0A2W7HW98 Uncharacterized protein DUF4304 n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2W7HW98_9PSED  ali  15  1MTDKIVRSIVAPILEQEGFSKSEQGFFRERMQFADYLSIQVKSDNSAVALNAGVQPLFENALRRLSEVECFIRTR---LVLQGMDDYWV--SLSQEPQQVADELVILFKKQGVPFFELFDSSEKLIRMLTINDIESGSLPTC............... 148
182 1.000e-15UniRef50_N8WVE9 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=N8WVE9_ACIGI  ali  20  1MDKKVISKLFYPILKAQGFIKNGDVFRQVEGEVIRIVDIQHSIKRHCFQVNLGIHLISLGDIEKMRDFDCAWRSSILPYLINDHDNDWSYTSNEQDANEMVQFLVSEWNRQSQNFFNQL...................................... 134
183 2.000e-15UniRef50_A0A1Y6FY86 Uncharacterized protein n=4 Tax=Bacillales TaxID=1385 RepID=A0A1Y6FY86_9BACI  ali  16  11....ALKKVVVPELRERGFKGSFPHFRRISVNKIDLITFQFDRYGGGFVIEVGVCSPEGVIHHWVTAHDLHPDRRLRLTGNNGE--WFSYDLENDIYENVADKVLTQLNK............................................... 125
184 2.000e-15UniRef50_UPI0009BB12D2 DUF4304 domain-containing protein n=1 Tax=Anoxybacillus sp. UARK-01 TaxID=1895648 RepID=UPI0009BB12D2  ali  22  14MDKSEFVKYLDELFKAHSFKKKGNRWSFSNDEIIKVIELLKSRYGNFYYIYYGFIIKNLELDGCKE----HVSHGLGSLDEKENRIKELLDFEISIPDEDRKELKKFIEREIFGMFDKIHTEKDLLMELKKRDHLNDIPLIVKKYF........... 157
185 2.000e-15UniRef50_A0A0P9Q552 Putative anthranilate synthase component I n=9 Tax=Pseudomonas TaxID=286 RepID=A0A0P9Q552_PSEA0  ali  17  1MEREKIKEHVIPILRSMGFKGSPPHFRRNTGQQIDLITFQFDRHGGGFAIEVAVSPAEGVTMPWIPPAHLHPNKRIRLGAVMGGDHWFRYDNKGNSTTRFADTARE-----VQPYLS........................................ 119
186 2.000e-15UniRef50_R5A8C2 Uncharacterized protein n=2 Tax=Clostridium sp. CAG:1013 TaxID=1262769 RepID=R5A8C2_9CLOT  ali  23  1MDSKEFKKFCKDEFTKHGFRKVKNEFYRQGNGVLCSLHLQHSDFGPLYYINICFYIGTFADKDYPTRYDYDFCGRFSAMTKKSHFLSSGIEYNYYTEDELRPYIEKGFKEMIYPALEH--GKKKIIPLLEQKEFIPNI................... 142
187 2.000e-15UniRef50_UPI000A011143 DUF4304 domain-containing protein n=1 Tax=Duganella zoogloeoides TaxID=75659 RepID=UPI000A011143  ali  19  2..........GSFIRARGFKGSGQNFRKIENDYVFVINIQGSRNGDVFFVNLGAQPAFVPAEPTIKEHECIMRMRVGSEWHWSLSGESVFDLTCAIDAAQ-SEFFGRVRTLRTAIFE--DSVEQLIQKFSAGTTNARAA-LHLSRAALALGRRDSA. 148
188 2.000e-15UniRef50_B4CZT6 Uncharacterized protein n=1 Tax=Chthoniobacter flavus Ellin428 TaxID=497964 RepID=B4CZT6_9BACT  ali  20  1MDSKVVNKTIAPILESVGFSFSARTSWRYHPERIDVINFQSFNSSYSFSVNLGCYIKEKNGNKRPEEYHCHFRRRFLQKELERKDIWF-IDDEARYLPQAISDVRGQIKEVALPWFTQFADLREVLRVLE........................... 156
189 2.000e-15UniRef50_G2Z5P2 Uncharacterized protein n=1 Tax=Flavobacterium branchiophilum (strain FL-15) TaxID=1034807 RepID=G2Z5P2_FLABF  ali  24  2...KEIKKIFTEELSKFGFKLKKD-WYFKNEELIIVVNLQKSNYSDIYFFNVGIWINQISTEEFPKENKCHIRFRAERLFSEIPNDLHILNFEEKLNDRLGKT-RKFLSDYLCPSLNNFKSVENICEMYRNGQFSYGYIR................. 140
190 3.000e-15UniRef50_A0A1I1TVX7 Uncharacterized protein n=3 Tax=Actinopolyspora TaxID=1849 RepID=A0A1I1TVX7_9ACTN  ali  17  10...EMLRDDVAPALRELGLKGSGKRYRLPSREYLAEIGIQSSLSSSSFTVNVSVHLPERPSPNTMYSTSCQWQQRLGKLV-DGQDRWWVLDAEGESRQEVAADLVAAVRDAGLPALRA....................................... 141
191 3.000e-15UniRef50_A0A2R7NPC4 Uncharacterized protein (Fragment) n=1 Tax=Chryseobacterium sp. HMWF028 TaxID=2056862 RepID=A0A2R7NPC4_9FLAO  ali  23  1MDIKEIIKSITPFLKEKGYSKKGNSFHLKSDNNFGIINFQKSQDGNKFTINFGVYSDDYDNSKVPDVWSSQWHARIGHFMPDCHDFWWKIQAEDNLCE-IISDIIDNIQNIILPEIDKRLT.................................... 133
192 3.000e-15UniRef50_UPI00083B91EF DUF4304 domain-containing protein n=1 Tax=Phenylobacterium TaxID=20 RepID=UPI00083B91EF  ali  16  1MSGASYIKALDRALTPLGFVRESGDWVRRRGEIQDQVDLQKSSIDGGVTVNLFAKNLETERILKPCEKQLQFGQRIGEL-IDGRDRWWKNDPEGP------AEVTEAVLLHGIPWFECVRSLEDEASVWGTTGFWRKPNLTVLAVTLFRLGALEEAL 158
193 3.000e-15UniRef50_UPI0009DEFA63 DUF4304 domain-containing protein n=1 Tax=Methylibium sp. YR605 TaxID=1500265 RepID=UPI0009DEFA63  ali  17  15....IVKTGLAPMMKRHGFRKTGLTFTRRQGSVAHFLNLQLSQWNGRFYVNAGVMFDDREQPERPTYPDCDFMVRWEALD-KRLPPSVEVGAESD-DVALAAWLATQVETFVLP-LNAVSSTED----FAKTGWIDAVPWGFPARWHFVTGRRDEA. 170
194 4.000e-15UniRef50_G8M232 Uncharacterized protein n=1 Tax=Clostridium clariflavum (strain DSM 19732 / NBRC 101661 / EBR45) TaxID=720554 RepID=G8M232_CLOCD  ali  26  1MNKKEFKKALTKVLFEYGFEIKGNIFRAETSELIVVVATQKSNYENSYYINFGFLIKSNPEILNPKDNQCDVFGRFT-LVISGKEC-SSINYELVNIDEFCDAFKKSMNEKIKPVLEY-----GLKKYFEINPLAINTATLKAKQYL.......... 141
195 4.000e-15UniRef50_UPI0009B6BD4E DUF4304 domain-containing protein n=5 Tax=Salinispora TaxID=168694 RepID=UPI0009B6BD4E  ali  22  15..KKVLTAILTESLAERGFRRRGDSWHRLGPDLYSVVHLQPSRWDSSFYLNLGFAPAGRVVRGWLPESKCLVRFRVEAIKKLSPGDLRLLNGDA............................................................... 106
196 4.000e-15UniRef50_A0A0D8BY04 Uncharacterized protein n=1 Tax=Geobacillus kaustophilus TaxID=1462 RepID=A0A0D8BY04_GEOKU  ali  29  1MERKEFKKIVSDCLLANGFSKKGKYYYKESPEVICCLGLQKSNYSNCYYVNVGIVIKEINKRELPRDVDGDIRCRF-YFKVEGKEVDCLDLDRINESSVIVSSLEANISE............................................... 110
197 4.000e-15UniRef50_A0A1Y0N3V5 Uncharacterized protein n=2 Tax=Curvibacter sp. AEP1-3 TaxID=1844971 RepID=A0A1Y0N3V5_9BURK  ali  24  1MDAESFIASIHPLLKASGFKKSNATWRKDQGESVAVFNVQKSPWGGAYCLNMGVYFHALGSEASPTESKCHVQRRLDVDSPEAATEWFHARASLQGAALLAEA...................................................... 108
198 5.000e-15UniRef50_A9VN10 Uncharacterized protein n=168 Tax=Bacilli TaxID=91061 RepID=A9VN10_BACWK  ali  16  8.........LHAALKPLGFKKKRHTFSKADNGFYKIIHIQKSQFGDDFYINIGVHPIGLPQKENISIFDCILRTRIEPIHMKQNQLLHNVSHETIDIPNY--------LSTIFDWFQTWASYKNLIK.............................. 125
199 5.000e-15UniRef50_D2QTA5 Uncharacterized protein n=1 Tax=Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896) TaxID=504472 RepID=D2QTA5_SPILD  ali  15  1MTAKVIKTVIKPLFRSQGFKADRLTFYKSMEEFFIVSNLQNFSWNTDFCFNVGIALTADPLKKKALYSDLTVHLREGSFLPYYTKNGYSIDSETDINE-FGAFIRHDFSEYILPELSKWKTLEDGICYFDQYGFWGIHLRKTAA............. 162
200 5.000e-15UniRef50_UPI00077B1EC5 DUF4304 domain-containing protein n=1 Tax=Bacillus cereus TaxID=1396 RepID=UPI00077B1EC5  ali  16  3.........LHAALKPLGFKKKRHTFCKAENGFYKLINIQKSKFGDDFYINIGVHPIGLPQKENISIFDCILQTRIDPIHMKQNQLLHNVSHETINIPDYFSTI--------FDWFQAWASYENLAK.............................. 120
201 6.000e-15UniRef50_A0A0L6CH20 Uncharacterized protein n=1 Tax=Luteipulveratus halotolerans TaxID=1631356 RepID=A0A0L6CH20_9MICO  ali  14  10....AVRDVFGPNARAHGFKGAFPTWRRSTPGDWAVVHIQTSMWNTECIVNLAVAPEPWWWRDFDNEITGDVRTRLQPTGTSAEFERWWRVTDEVSATDAVQDMVRQLEQTGWPLLDALLSPGGCLAAVEQGDLFPSHFLRARAMLIVDCG...... 180
202 6.000e-15UniRef50_UPI0003B33AF7 DUF4304 domain-containing protein n=1 Tax=Aestuariimicrobium kwangyangense TaxID=396389 RepID=UPI0003B33AF7  ali  19  4....LVQSTVDAYAKSRGFVKRAGSWYLKREDIILVLNLQKSNYGRQYFLNIGLWLNVLGTEQAPQEQHCHIRSRLSRIAADAGRAGDLMDADKLEVQADAKQLTSELASALDPLISLASSMRELAGQAGAEFLSRALVTGSAQRALADAG...... 151
203 6.000e-15UniRef50_A0A161SL97 Uncharacterized protein n=1 Tax=Agromyces sp. NDB4Y10 TaxID=1775951 RepID=A0A161SL97_9MICO  ali  19  8.....VQATFDEFGAKLGLEKRARTWYRRSPGMVGILNLQKSQWGAQYYVNVAFWFTALGAEEFPNEREAHVRSRLDAVLGQADELTALLDLDAPIREDRVTELLRVLGGELAPLFEKFTSVAAF-------RSPAGRELLMRALVRREAQ...... 149
204 6.000e-15UniRef50_A0A089KS77 Uncharacterized protein n=17 Tax=Paenibacillus TaxID=44249 RepID=A0A089KS77_9BACL  ali  19  6..KEIITNDIKPFFKQHGYRKKDLNFHKTEAGFIYKINFQKYPYNTMFYINCSVHSAELIPFQSKQPEDAHLNARIRELCPAAPQH-YTLTPETD-RETFTAELIRHLEE-ALSFMHAMTSARDIADYYMDRTALYMSEEIFRLLLHS--GDQETA. 167
205 7.000e-15UniRef50_A0A1H7SM74 Uncharacterized protein n=2 Tax=Rhodococcus TaxID=1661425 RepID=A0A1H7SM74_9NOCA  ali  18  19..........VPLLKEYGFRKRKLTFTRERDGLVDVINLQRSAGNSHFYVNCGVYSAEFDRVQRPAEVDCQYRRRIEDIA-TGIGPHVTVHADTDVP-AVAEQLRAAL-TSALAVMGQLGGPDDVAHSVGSD......................... 147
206 7.000e-15UniRef50_A0A2P8N1N9 DUF4304 domain-containing protein n=11 Tax=Stenotrophomonas TaxID=40323 RepID=A0A2P8N1N9_STEMA  ali  14  14...ELLESELFPRLLQEGFVRKGLTFRRIRTPLIHVVECQAGSSGQWCYLEMGAHLDFLPQPATIEESGCVFRERL-AGDGASTGGGWVYGASEQESTTSVKALCSAWESAGSHFFAAHDDYQAMLDS-ADLEQARAIELLTLARVAANLRRKEQAL 176
207 8.000e-15UniRef50_A0A161SUT4 Uncharacterized protein n=1 Tax=Microbacterium sp. T32 TaxID=1776083 RepID=A0A161SUT4_9MICO  ali  24  4..RNVIQTTFDEFGRAAFTTKKSGSRHRQSAETIVVLHLQKSNYGPRYYVNVAVWLLEAGPATAPKPWECHVQTRLGRVVPRGVDDRELLDLDAPIADDVREELLGVWREHLLPVREAAATLNGLR............................... 130
208 8.000e-15UniRef50_A0A1A1X9D8 Uncharacterized protein n=2 Tax=Mycobacterium sp. ACS4331 TaxID=1834121 RepID=A0A1A1X9D8_9MYCO  ali  13  1....MLSHDVRKFLKAEGFSKAGYTFRRSRAPLWDSINFQPSKWNYGFFVNVGVGSTEIEDAQRFTAPLSIFDRRWENVVPDVPD-EVTFDAGTDMP-AFATELCDDLRRVLTSV-EGFTTTAELVQWAVAHNKLHRMQPVCSYLAANDDIDMLSA. 158
209 8.000e-15UniRef50_UPI000D89BB87 DUF4304 domain-containing protein n=1 Tax=Mucilaginibacter sp. OV119 TaxID=2135470 RepID=UPI000D89BB87  ali  15  7..KKIIITELSNTLKPLGFKRAGHIFSSTTDDLVYYISTSSTASQLKFTINIDIRSKELYESILPFNAQDHYRFRIGWFIEPQIDKWW-LAHDNQSAMLAAEEINTLIVQKVLPEFSHLKSVKDIYALWKQGKGTGITE.................. 149
210 9.000e-15UniRef50_A0A1G7YFH8 Uncharacterized protein n=1 Tax=Flavobacterium omnivorum TaxID=178355 RepID=A0A1G7YFH8_9FLAO  ali  20  13....LIKEIINPTLKNLGFKKNARNYKKSVNDIVQVFNIQKSQWNSTFTFNIGFFNSEIFFETYPKEYDC--------FLNVGFAKWYKMN-KSISYESLKNEIQSEIETNAVEIFTDYESLKSLSGLIKKKNITENTMGILNMFFLMKTNNAEDGI 168
211 9.000e-15UniRef50_UPI000558C10F DUF4304 domain-containing protein n=1 Tax=Actinospica robiniae TaxID=304901 RepID=UPI000558C10F  ali  18  64..TAMMRSRVRPELKRLGFTGSGKTFTLPSPDHYATLSFQQSRGNSWFTANLSVISHAEWSATQPPDPDCGWSERLGEVSHHGYDYWWSVWAGFPTDD-VADDLIVAIRDH.............................................. 187
212 9.000e-15UniRef50_H5X7V0 Uncharacterized protein n=2 Tax=Saccharomonospora TaxID=1851 RepID=H5X7V0_9PSEU  ali  17  16...RLVKSMWGPALRELGFTGSGRVWTLADPIDWAMLGFQTSTASTKFTINLLVVGKAAWDDARAQHPWYSARQRSGPLIC-GADHWWHLAGDGSNEDEIRDEVLCALRAVIVPKL......................................... 143
213 9.000e-15UniRef50_A0A2G6YA71 Uncharacterized protein DUF4304 n=2 Tax=Bacteria TaxID=2 RepID=A0A2G6YA71_9BURK  ali  14  9..KDVVARGLAPMFKAHGFRKSGLNFWRSAGAVTHYFNVQLSQWNGVFYLNAGVMFDEIFVPPTPKYEHCQFMVRLECLDTALPAF---YGVPTDTPEAFAREIASVVERYVQP-LAAVHNVKD----FDALGWARAVPWSFPALIAYAVGHLEDA. 166
214 1.000e-14UniRef50_A0A136LZG4 Uncharacterized protein n=1 Tax=candidate division WS6 bacterium OLB20 TaxID=1617426 RepID=A0A136LZG4_9BACT  ali  21  2...QAITKAITDILAESGYRKKGNFWWFEDDVLNKVIHLQKSNYSNKFYLNYGFVIKALDLGRLIS----HVYDRFWSKDQNETDRDQLLDLELWIPEERLSELRQLIKEKLLPQLNSINTEAELLGYIKRRQTLNDIPLVVK.............. 139
215 1.000e-14UniRef50_A0A150WMS5 Uncharacterized protein n=1 Tax=Bdellovibrio bacteriovorus TaxID=959 RepID=A0A150WMS5_BDEBC  ali  16  12...EILSNDFHPILKRLGFEGKGQKYKRIKEEVVEFLEIEGSKWDGVCYVEMGIFPLMFLDTPWITFADCPIHFRLKS--KSGSDSWSYGKGDDSQAKESVKRLVQAYSENGEPIFQRADSLSKLSNKIEDFGIFNTNIPPLMAQVHFHLGNLDLAV 184
216 1.000e-14UniRef50_A0A259PGX3 Uncharacterized protein n=2 Tax=Micrococcales TaxID=85006 RepID=A0A259PGX3_9CELL  ali  17  53..RDALRDVVGPNARAHGFAGSAPTWRRSTAGDWAVVNVQSSSFSSHCVVNMAVAPEPWLRWKFVNESLGLYRDRLHPTTPPGVDGWWEVT-DRQSAVAAASDVVTQLEASGWPVLERLLVPGGMLDQVRKGDLLGVFFARAEALLVMDLGEELEA. 230
217 1.000e-14UniRef50_E6TNN7 Uncharacterized protein n=14 Tax=Mycobacteriaceae TaxID=1762 RepID=E6TNN7_MYCSR  ali  15  18....VLSGEVMPLLGSRGFTRSQNTFRRSRGPLYDVINFQANWNNSVFFVNVGVGSVEIDQPHVHPPEGFLLDRRWEHLVPDAP-YEVRFDLRTDMS-AFGANLCTNL-ERVIDEVERTTSTRELVEYAVTNNLLIAYEKTCCYLAATNDTDTLNA. 176
218 1.000e-14UniRef50_J2UZI1 Uncharacterized protein n=1 Tax=Phyllobacterium sp. YR531 TaxID=1144343 RepID=J2UZI1_9RHIZ  ali  26  2....ELVAIIDDELSNCGFKKRQTTWYFKTARGVLVLDLQKSAYGHQFYINLASAPIEVETIGYPKEYKCPLRLRLDSAYPQLSDLKLVLDLENLSDEGRTAVIRRVVSEYSVPFLMKLDGMQKIKRSLHDGSLDRAFVALAL.............. 145
219 1.000e-14UniRef50_A0A1W6MGV7 Uncharacterized protein n=1 Tax=Nonlabens spongiae TaxID=331648 RepID=A0A1W6MGV7_9FLAO  ali  19  1MNAKEIKGYLKPKLKESGFRTSGNNWWKLYDDFFILINLQNSQWNSKFCFNIGVGLTENMNDKKPTYFDLAVELREESYLSERQDGWLYLVTDKTDLTDFTNELKTDFEIDILPKLEMLKTLDDCLLFYDKHDFWGDNLRRQIAEI........... 166
220 1.000e-14UniRef50_A0A0G3LXF5 Uncharacterized protein n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0G3LXF5_9FLAO  ali  20  1MNSKEFKQVFGEIAKKNGFLQAFGGWFKDSPECIAILELQKSKYGDYYQLNIKIFMQKSFGRTYLPTKELIKSPMGDVNGGVPQSFKEVFDFDRVLNDERIEKLNELFIDHIIPFTTRTSTKIGIKELESRGEFLPPAVKQELEKLLS......... 150
221 1.000e-14UniRef50_UPI00083AB433 DUF4304 domain-containing protein n=2 Tax=Acinetobacter TaxID=469 RepID=UPI00083AB433  ali  22  1MDKAQLRNQFYPILKTQGFTQKADVFRQIDGEIIRIVDIQHSVKRHCFQVNLGIHLRPLGEIETMREYDCAWRNSIFPNLINDYDSDWMYGSNEQEAIEIVQFLVSEWNRQSQNFFNAL...................................... 134
222 1.000e-14UniRef50_A0A2S9FKK4 Uncharacterized protein (Fragment) n=1 Tax=Mycobacterium sp. ITM-2017-0098 TaxID=2099692 RepID=A0A2S9FKK4_9MYCO  ali  16  21.......NDVVPALRPHGFTRCKNTFRRSRGPLYDVINFQANWNNGVFFVNVGVGSAEIDQACPGHDPALHLDRRWEHLVPDAP-YELRFDLTTDMR-AFAARLCENLR-LVLDEVERLQSTRELVEYAVTD......................... 153
223 2.000e-14UniRef50_A0A0M1IV55 Uncharacterized protein n=1 Tax=Clostridium sp. L74 TaxID=1560217 RepID=A0A0M1IV55_9CLOT  ali  12  1MNSKELREVVKPELKRAGYSGRGQTYKSMRDDCCLAIHISGSHFGYTFWFEIEAFKKDLPEEYLRCWQGGIDSMREDPLLPNKIDGYQDYKPQDMDMEDIKNRIGNDLRQYILPQLDEIKNYKDWEQKRQEWNERYYSKRICLLRYYHMAH...... 174
224 2.000e-14UniRef50_A0A0Q9MX27 Uncharacterized protein n=1 Tax=Arthrobacter sp. Soil761 TaxID=1736400 RepID=A0A0Q9MX27_9MICC  ali  30  1MSRNVIQTTFDGFMKGAGFSKHSGSWYRDTDDVITVAELQKSQYGLQYYVNIALWLRPLGEAKTPKEQACHVRTRLSLLVGSAD......................................................................... 84
225 2.000e-14UniRef50_UPI000DE8F490 DUF4304 domain-containing protein n=1 Tax=Blastococcus sp. TBT05-19 TaxID=2250581 RepID=UPI000DE8F490  ali  14  8..EEMVKGRIAPALRDLGMRGSGQNFRLPNEDGYALLGFQKDSWDGRFTANVAFHSARGWQDARDREPDLQWSERIGHLMDPPHDHWWTIPTESDVPV-VADHVIAVVRGTVLPQLR........................................ 141
226 2.000e-14UniRef50_A0A223DZ99 Uncharacterized protein n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A223DZ99_9BACI  ali  19  1MDKSEFIKYLDDLFKSHSFKKRGNQWSFSNDEIIKIIRLSKSRYGNFYYIYYGFIIKNLE----LGRSTMHVSHGLGSLDDKENRIMELLDFDLSIPDEDRKELKKFIEREIFGMFNKIHTEEDLLMELKKRDHLNDIPLRVKKYF........... 144
227 2.000e-14UniRef50_A0A257H8W6 Uncharacterized protein n=1 Tax=Burkholderiales bacterium PBB4 TaxID=2015566 RepID=A0A257H8W6_9BURK  ali  19  11...ELVSKQLAPFLKERGFRKKGQRFYHRIGSCIQLIELDRWKYNEGSTISVGVFFPSVWDDEWPPIQNCLVDMSVPPQNGQGLDNYWDIDATLPM-DATAERIKRSIEVDGLAWLNANSTIPRLTELSGKNVWLSSVYLLCAAVELRDKQLAEAAL 187
228 2.000e-14UniRef50_A0A1T4YF76 Uncharacterized protein n=1 Tax=Prosthecobacter debontii TaxID=48467 RepID=A0A1T4YF76_9BACT  ali  15  7...EALKSVVVPDLRVRGFKGSYPNFFRDRGGHIDLLTFQFRSSGHSYVCEISVAIYKDTEPKKLRTNQTRIRLRLGS-SPDRGVNDHWFCVETVDAVKAAHEVVALIESQGEPW.......................................... 125
229 2.000e-14UniRef50_A0A089LK36 Uncharacterized protein n=4 Tax=Paenibacillus TaxID=44249 RepID=A0A089LK36_9BACL  ali  20  6..KEIITNDIKPFFKQHDYRKKALNFHKTEAGFIYKINFQRYPYNTMFYINCSIHSAEQPDNLPALDFKSHFTARIRAICPTAPDI-YTLTPETD-RETFTAELIRHLEE-ALSFMHAMTSARDIADYYIDRTSLYMSEEIFRLLLHS--GDQETA. 165
230 2.000e-14UniRef50_A0A1G9V058 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1G9V058_9PSEU  ali  19  8..KELMRTRFAPWLREAGFRGSAGKFALPSESHWALLGFQRSVYSDRFTINLLCVGREQWESMRAAEPFLGERARIGALTPSGEDKWWHLRPRRD-VEHVVADLFHDLGEYAVPWLR........................................ 138
231 2.000e-14UniRef50_K9E3F6 Uncharacterized protein n=1 Tax=Bacteroides oleiciplenus YIT 12058 TaxID=742727 RepID=K9E3F6_9BACE  ali  30  11MDSKEFKKRFGKIAKSYGFKSAYGGWYKENDECISLFWLQKSSYVNEFYLNLRAYIQGAFDRHYSINKE--IMKSSFGHVIDQITGNSIFDLETMSDEERTKRLEATFSDVIVPFTTQTLSKVGIIKMFEEKR........................ 143
232 2.000e-14UniRef50_A0A2A5AMN0 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AMN0_9BACT  ali  22  1MNTKVIKNRVWSCLKEWGFSTSRLAWNYFDEDFIHVVNFQFSSYNADFVLNLGIFIKSKNNVLKPNEYECHFRYRMTRTIPQDYDDIWYIDPKGKELDRVFDAVLNEIKNVAIPWFKKYSSHKKMFDIATLKERSGDNT.................. 174
233 2.000e-14UniRef50_UPI000854E2F6 DUF4304 domain-containing protein n=4 Tax=Listeria monocytogenes TaxID=1639 RepID=UPI000854E2F6  ali  20  1MNKTEFKKIVGNKLKESGFSFEQKAYYLRTDIMIICVEFQKSNYSNTYFINYGFLVKRSPTIEYPKANTSDVFGRFTFYDKGLLKKEYEIDF--IEKKEVIDSIQINIDNNIKPVVEK-----GLATYLETTKPTNLFIKLEAKQYLGLEQELE... 148
234 2.000e-14UniRef50_A0A2I8EXQ4 DUF4304 domain-containing protein n=1 Tax=Paraburkholderia terrae TaxID=311230 RepID=A0A2I8EXQ4_9BURK  ali  16  8MDRA-LKARFVPALRQLGFKGSLPHFRRQRDDRIDLLTVQFDRHGGGFIVELSQCGVEGITTHWGKFHDLHPSQRHRLGSPENKDHWFRFD-DGTQPTAVADLLCAHIDE............................................... 124
235 3.000e-14UniRef50_UPI0007168FA7 hypothetical protein n=1 Tax=Algoriphagus resistens TaxID=1750590 RepID=UPI0007168FA7  ali  24  1MDTKEFKKAFNDFALKNGFATEFGAWFKESEECVLALILRKSSYSKLYYLRIKVNFKLAYGRTFKKEKDWVKHDVADIMHGPSNDFQDLFVLENNTDPQRIEKMEKLFLNHINPLTNKILTREGIIELHKTEDLF...................... 136
236 3.000e-14UniRef50_UPI000689F31C DUF4304 domain-containing protein n=1 Tax=Flavobacterium daejeonense TaxID=350893 RepID=UPI000689F31C  ali  29  1MTNEEFKNIFNVYLKDQGFKRKGNFWKFQTPEIEKVVHLQKSNFSNLYYVNFGYNLQNLNFNGVL----MHVSTRLNQSEG--------FDLENNICFVNRQKIIEEIQENLIPILNSINSETDLINHIKSLKNTNHIFLKVK.............. 132
237 3.000e-14UniRef50_A0A1Y4GDM1 Uncharacterized protein n=1 Tax=Cloacibacillus sp. An23 TaxID=1965591 RepID=A0A1Y4GDM1_9BACT  ali  17  56....AIEGAVYAGIKKFGFRKHGRTLHRVSEDISQVISFQCGQDTDRMWVNLGIRVPECSEREFFKEYECTIRSRLGFIDG-GVEKCFRV---TDGTEAAANEILCDVLNKVLPVFDILSERRAVLTRRRDFPSFDNQILLEESMIYGHLGDVEKA. 221
238 3.000e-14UniRef50_E8N7T6 Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II n=4 Tax=Microbacterium TaxID=33882 RepID=E8N7T6_MICTS  ali  14  33...AMIKDTISPALRAEGLIGSGGRYSVKSDTHWALVGFQKSAYSDQFTVNLMVVRRDEWLAQAAENSYFPVKKRIGSLVGDGADKWWRL-FGGQDVDLLAADVLTDLRDAGLPWLRE....................................... 162
239 4.000e-14UniRef50_W4EKD2 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=W4EKD2_9BACL  ali  14  12.....LKKIVIPILREKGFKGSFPHFRRIKENKIDLLTFQFDKYGGGFVIEVAVCPPDGVTHDWGKKVPSNKVTAHDLYNRLRLNGGEWFRYDAPSSDEGIFDILANGVLNCIPEAENY...................................... 125
240 5.000e-14UniRef50_UPI000411AF61 DUF4304 domain-containing protein n=1 Tax=Gelidibacter mesophilus TaxID=169050 RepID=UPI000411AF61  ali  15  1MNAKDIKTYLKPTLKSQGYQTSGQTWWKNMGVFFTVINLQNFSWNNDFCFNIGLALPDHPAKKKLTYNDIFSHKRDSYFVPYKNKTGYQLTADT-NVQEFIEEMRKDFEKGILPLLNDLKTLKDWASFHEKFP........................ 151
241 5.000e-14UniRef50_A0A2V9A6T2 Uncharacterized protein n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2V9A6T2_9BACT  ali  19  10MDNKEIKSVIRPLLQDAGFSFTLRTAWRYSGEKIDVVNFQSFNSTYSFCVRLGCSLDAIPQRARPEEYECHLRKSINQRNLKRTDIWY-VDPTGKNLEVVIADAKKAILEIGLPWFSRFGDMKEVLRTLLEDSENN..................... 171
242 6.000e-14UniRef50_A0A0C1L4D5 Uncharacterized protein n=1 Tax=Flavihumibacter solisilvae TaxID=1349421 RepID=A0A0C1L4D5_9BACT  ali  19  1MNKSDLIKIISETLGDEGFKKIKSMWYLESEECFAILELEKSPWGGQFSILLDVIVKQLDNSNVPEPINGNISWELGQYQVDREIVKKNFDLEDDSIPERKAFIQEILKYRAMPFLKKVSTIEGIKHEIINNKMIRHHT.................. 142
243 6.000e-14UniRef50_A0A1H6RI99 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1H6RI99_9BACT  ali  17  1MTAKEIKTFLKPTLKSFNYQTSGQTWWQDKGDFFTLINLQNFSWNNDFCFNIGIVLKVTMKDKSPTYHNLTVYLREGYYLPPNRSVHYRVNGQTDFN-AFMNELRIDFIDHILPALEELNSIQSCVDNFGDVPFWG--EHLKKVLTLPELNLHDRT. 172
244 7.000e-14UniRef50_UPI000DCB0183 DUF4304 domain-containing protein n=1 Tax=Mucilaginibacter rubeus TaxID=2027860 RepID=UPI000DCB0183  ali  17  34.....IRDSLKPLLKAEGYKTAGNKWWKFNGSFFNFIELQNFSWNSMFCFNFTTGLTDIKNGNKPTIHDGIPHIRESYFEVKKNEYWYHIDDITDL-DRFTKQIIADFELLILPKFNSLTNKESIVDFY-SDEFWAPRIKQSLALGYKDVR...... 187
245 8.000e-14UniRef50_W5WHB6 Uncharacterized protein n=1 Tax=Kutzneria albida DSM 43870 TaxID=1449976 RepID=W5WHB6_9PSEU  ali  14  26.......EVVGPAARGEGFSGSAPTWRMTNAGDWAVVSVQTSRYSTHCVLNTAVAPAPWLAWQQVPESLGLYRRRLHPTTPAARDGWWEITGDDDARTA-ATDMVTQLATDGWPILRQLLHREAMLDQIRCGDHSPAYFARAEALLLAELGQLDQAL 199
246 8.000e-14UniRef50_M2UYT3 Uncharacterized protein n=2 Tax=Rhodococcus TaxID=1661425 RepID=M2UYT3_9NOCA  ali  17  12......RDHVRPLLKSLGFRKRALVFTRSRGELTDVVSLQRSAGNIRFYVNCGVHSSEFAVADRPREVDCQFRCRLDELAPGAP---QWFEIDDEDAAASLGPLLAGYLDTAARALGTVTTADELAHRI............................ 141
247 9.000e-14UniRef50_UPI0009EB98BD DUF4304 domain-containing protein n=1 Tax=Brevundimonas sp. AAP58 TaxID=1523422 RepID=UPI0009EB98BD  ali  10  11...RSVIKGISLTLRRHGFTRRGTAYRYLSEGNSAIIQVQRSRSSDNFTLNTGVISGRAPDVSKSVEMHAHLRQRIGCFLSPPREKWWEIGATSDVAV-VLDEITPLLDDAAHYVITHIAD-EQLIALWESGRGPG-LTEFQRLRNLSDLK...... 164
248 9.000e-14UniRef50_A0A1N5WSM3 Uncharacterized protein n=2 Tax=Micromonospora cremea TaxID=709881 RepID=A0A1N5WSM3_9ACTN  ali  16  9..RAMLRDDIAPALRALGFSSR---YSLPDPESWALLGFQSSRFNTTFTVNLCAVSRLVWESRRREYGHFVWSCRLGHVMPVDKDVWWNLD-EDAEAKGVASEVVAAISAYGLP........................................... 133
249 1.000e-13UniRef50_A0A2E6VC88 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A2E6VC88_9FLAO  ali  20  1MTNKEIQKLVHLELKADGFKKKGRTHNKTENGLIQVVNFQMAKYYGNFAVNIGVFVPELYESTFIQEYDCEIRERIND-KASGKEYWFSLGADYP---KTAEFIIRKLKSDVKNWFDRFDERRKIVSELTESNEFSPREKLCGAII........... 175
250 1.000e-13UniRef50_A0A1M6MTH1 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1M6MTH1_9FIRM  ali  17  1MTSKELKEIVKPLLKKAGYRSSGRVYYSQRGNCCLALCLKGSHYNSTFEGEVTESIKKGWWMEYTSISEAVLLPDMGYLHPYRRGMEYQIDPQDMNLEDIVLHIREDLEHYILPELAQVESLAGWERKREEWKQRGCTERVRLLRYF.......... 170
251 2.000e-13UniRef50_UPI0009FF7874 DUF4304 domain-containing protein n=1 Tax=Chthoniobacter flavus TaxID=191863 RepID=UPI0009FF7874  ali  11  1.MIAALKAAVLPAWRNRGFAGSFPHLRRDRGDQIDLITFQFDRNGGGFVIELGQCKPEDFTREKVRAWDAPLRTRIQPQPGSSPQDWFRFRYATTPDAEIATSVLS-FTEAIENLFQRF-DPEAVAAH............................. 135
252 2.000e-13UniRef50_A0A022KTA7 Uncharacterized protein n=1 Tax=Brachybacterium muris UCD-AY4 TaxID=1249481 RepID=A0A022KTA7_9MICO  ali  14  13......KQIIVPALRDRGYKGTAPTWRR---------------------VELG-----EGMPRTVTEPLGLIRGSLHSQSPAPTDSWWEVS-DGSSAAAVAQHVLATLREYGLPRLERLLDLEGLIEQLETWDERGG.................... 116
253 2.000e-13UniRef50_A0A2A5NS45 Uncharacterized protein n=1 Tax=Curtobacterium sp. `Ferrero` TaxID=2033654 RepID=A0A2A5NS45_9MICO  ali  17  21..RDALRDVVGPAVRAHGYCGTSPTWRKTSDGDVSVITVQSSAWNGSCVVNLGVAPRPWLDRDRPGASECLWWCRHPQTSIDPHREQWWCYHDEPSAQQVAEAIVTALESTWFATLDALLVPDEFRRRLLAGD........................ 169
254 3.000e-13UniRef50_UPI000464030C hypothetical protein n=1 Tax=Methylophilus sp. OH31 TaxID=1387312 RepID=UPI000464030C  ali  17  11...EVFKSLHYEILKPLGFKKDGLRSQINEGDLSRAILCWSNQPGNEFQIFATVTHYDYLVFRYPQHSESFSSRLIGQNYPKGSTRFWSLGFETSQATEICTEVKHVVSNYGLAILQQFRTLEGVLEFYQNQPNPLLKYEEYSWLLMYLNKKVESAI 183
255 3.000e-13UniRef50_A0A1G1SKC7 Uncharacterized protein n=1 Tax=Exiguobacterium sp. SH31 TaxID=1843183 RepID=A0A1G1SKC7_9BACL  ali  11  14..NKVIREHLSPALREQGFQKNTRHNWKFNEHNIWVIDVTTGWPSMSVFVECGIYYPFLNTGDFPRVHHCYLRLSLDSTLDQSAYTQWWIEPDGSNVDDVVMNIRDVVLNQAIPWFEKYVDWSLVMEQFKNNHSPSFFQELKGKI............ 190
256 3.000e-13UniRef50_A0A0Q9LXH4 Uncharacterized protein n=2 Tax=Paenibacillus TaxID=44249 RepID=A0A0Q9LXH4_9BACL  ali  11  7..RKLIKKHLAPTLNEFGFIGTDHHFVKDTNHVINAIVIQADKNGGSCVVDLGVHIKEYIPSSKLTVYDCEFRTRKNVLRNKEREIWFRYGHTEEESKTVIQEMKDMILSQGTSYFSQFN..................................... 141
257 3.000e-13UniRef50_A0A2N3YQU1 Uncharacterized protein DUF4304 n=1 Tax=Flavobacterium lindanitolerans TaxID=428988 RepID=A0A2N3YQU1_9FLAO  ali  23  1MEKKDLERILSEILKPADFKKKGSYWTLNNNEITKIIDLQKSQYSNRFYINYGYIINAIPLGNLKR----HIYNRLGSNKSTNEEIINMLDLEYQIIDSERERLKDLLYENLMLNIISINNESDILEELKRRPHLNDITLSVKK............. 142
258 3.000e-13UniRef50_UPI000D100882 DUF4304 domain-containing protein n=1 Tax=Janibacter sp. Marseille-P4121 TaxID=2058291 RepID=UPI000D100882  ali  18  25...RVVRDHLAPIIRARGYKGRGPTWRRSSSEVVHVVQVQRSTYNGPFYLNGAVYAGVLDDIDAPREPDCQLRWRADDVGGAAR----SYDLEPGADAAALAALAVADLTLLLEALDRIRSVDDLVDVARTQSLAAYE---AVYGWYLRTGRPAEA. 180
259 3.000e-13UniRef50_A0A1X0AZC6 Uncharacterized protein n=1 Tax=Mycobacterium branderi TaxID=43348 RepID=A0A1X0AZC6_9MYCO  ali  13  34..RDLVKSDFAPALRSVGLRGSNGRFKLPSTVCWAQLGFQKSWFSDRFTVNLSFVTTDEWERKRVRYWLGQTVERIGWLTPQRADKWWSL-IRGADPAPVRDDVLADLITYAVPWLRS....................................... 165
260 3.000e-13UniRef50_UPI0009DB5B71 DUF4304 domain-containing protein n=1 Tax=[Clostridium] sporosphaeroides TaxID=1549 RepID=UPI0009DB5B71  ali  19  5MYLKKLLTEVHASLKVLGYLKKRKSFYRNYNGFYHLINFQSGAHGNYYFVNIALHPIGCPNHENPPESSCAIRCRIDKFMSESEDVCRSFNLPGLPLEAVKKIVVELLQTKVQAWLLSWSSYEKYIN.............................. 142
261 3.000e-13UniRef50_R9ICQ5 Uncharacterized protein n=2 Tax=Bacteroides sartorii TaxID=671267 RepID=R9ICQ5_9BACE  ali  12  5..RREIKNCLAKRLLPFGFKGKYARFVRTKANTVQIIGLGFSNGSRNVTADMNVLYPNINEIDLMKAYQGMVTGTMGMLMPERGYKEWHFRKEDDSLDATIDEMISDIVQYGFPYFDELLDGEVLLDKLLSDPSQNRYVDKLIPVLYHLRG--EDAL 176
262 3.000e-13UniRef50_A0A1C5RK39 Uncharacterized protein n=1 Tax=uncultured Eubacterium sp. TaxID=165185 RepID=A0A1C5RK39_9FIRM  ali  12  6...KDIMESVYAELKPLGYKKDGQNFRLQEDGLCKIINFQRDRWNTKFTMNTGIYFEKDVQNKKFKEYECLIRNRL------LSDKWWHIDADAD-CDAVKEDVVGSL-DLVQEYFNEFKSREETIKRILNNESDTIVMKYDTAKMLADMG...... 156
263 3.000e-13UniRef50_A0A0S2M1M5 Uncharacterized protein n=4 Tax=Arthrobacter TaxID=1663 RepID=A0A0S2M1M5_9MICC  ali  23  15.....IETTFASVLKARGFRKRGRNWFRTTTDDYQIVNLQKSPWGGDFYVNLGWSLPD-ATKAFRSEIQCDLRLRAEPITLERSDGLDTGVSERIPEETFIRQLTDVIVVPVADLMDRTPSLVHMVPFLMTKPWFATLALRKELELLGH........ 175
264 4.000e-13UniRef50_A0A2S6IUL0 Uncharacterized protein DUF4304 n=1 Tax=Kineococcus xinjiangensis TaxID=512762 RepID=A0A2S6IUL0_9ACTN  ali  16  25....ELSAVFGKPLKDLGFRRRRRSWYRLGPALYSVLNLQASEWDSTVYLNLGFSPAASVVGDWLPERKCMVRFRAERILEVPLEGIRLLDGEAVGAQAWRDAVAQQVAGPVVGMLDRVVDLPRLRHALDAEVSPHVMVRAEVRQLL.......... 170
265 4.000e-13UniRef50_UPI0002719C57 DUF4304 domain-containing protein n=2 Tax=Burkholderia sp. BT03 TaxID=1144309 RepID=UPI0002719C57  ali  13  6MDSA-LKTHFVPALRQRGFKGSLPHFRRQRDNQVDLVTIQFDRHGGGFVVEIASWSVDGFTTYWGKFHDLHPNQRYRLGSPGSSTDDWFRFDQGVSPTVVAKRLCEHLDE............................................... 122
266 4.000e-13UniRef50_A0A2R7YRF3 Uncharacterized protein n=1 Tax=Nocardioides sp. IB-3 TaxID=2133958 RepID=A0A2R7YRF3_9ACTN  ali  13  41...RLMRESFAPALRSAGLKGSGGRFELPSETHWSLLGFQKSSHSDEFTVNLSVISRQVWEEQAPTRAHWADQTRIGLLTPSGEDLWW--SLDRGEDPRVVEEVVSTLLDLAVPWL......................................... 169
267 4.000e-13UniRef50_A0A2S9ABJ0 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A2S9ABJ0_9MICO  ali  14  1MDRKELRRQFFPLLTAAGFARMGDVLRRELDGVVHVVEVQHRPRSAVFQINIGAHLPDAVPVASMREYDCAWRGSIVSGFRNSSDAEFAYGRTDAEASESVAFLVSEWQRQADAFFGPLSDFPAGFHEQARRSSDGDLHPAQLARVALLVGDRGLA. 172
268 4.000e-13UniRef50_UPI0009B741AD DUF4304 domain-containing protein n=1 Tax=Salinispora pacifica TaxID=351187 RepID=UPI0009B741AD  ali  21  1MAAKELTAILAESLAERGFRLRGDSWHRLSPDLYSVVHLQPSRWDSSFYLNLGFAPADRVVRGWLPESKCLVRFRVEAIKKLSPGDLRLLNGDA............................................................... 95
269 5.000e-13UniRef50_UPI000C24696A DUF4304 domain-containing protein n=1 Tax=[Clostridium] celerecrescens TaxID=29354 RepID=UPI000C24696A  ali  16  1MNSKELKEVVKPLLKKAGYRSSGKVYYSQRGDCCLALCIKGSHWGYSFYFEIMAFEGAVTEDIKKGYWITQIMEYWGYLHPYRDRIGYKIDPQDMQLEDIKSRIQDDMERYIIPELAQVENFSDWERKQKEWIQRGSSERIRLLRYFTMAHSL.... 174
270 5.000e-13UniRef50_A0A1N6CQZ1 Uncharacterized protein n=1 Tax=Sphingorhabdus marina DSM 22363 TaxID=1123272 RepID=A0A1N6CQZ1_9SPHN  ali  11  8...KLVIEHIWPILKEHGFQRDGENFRKANEDVYHFVGLHRLRSGDRYYAMAYFSSPVIIEDFHKRFPESIPMANANRHYISPEDKMYFCRYEDSFLTSFERDFKPALLKHGLPYLDNIQSVEDMIPFLRSDRFRGP--------ALLYAGRKDEA. 162
271 5.000e-13UniRef50_A0A1I5Z4E3 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1I5Z4E3_9BACT  ali  22  2.........FGEVAKANEFKSAFGGWYKESTECITVLELQKSNFGDYYQLLIKVFIQGAFESTYTPNKELIKSSMGHITANETPEYKAVLDFDEPMEDNIRKELEKLFKNHILPFTNRALSKAGIKDLANKGEIF...................... 128
272 6.000e-13UniRef50_UPI000587A7F3 DUF4304 domain-containing protein n=2 Tax=Proteobacteria TaxID=1224 RepID=UPI000587A7F3  ali  14  21.METALKAGCIPALRNQGFKGTFPNFYREHENFVALVNFQFFSSGGSFCINLGYADPERRNVSFEPEAEPRARERSRLGSGGEGDNWFEFRGSTSEVNEIAEQCAKLFISEAEGW.......................................... 148
273 6.000e-13UniRef50_A0A2V6HM98 Uncharacterized protein n=4 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2V6HM98_9BACT  ali  12  8.MIEALRRVVVPTLRDMRFTGSFPHFRRIRDIQIDLLTFQFNRWGGSFVTEVAFCEPTGWTDRLGRHVPPQQRLRLGSHPPTQADHWFRFEPESDVYDDAALETLSLLRSQAEDF.......................................... 132
274 6.000e-13UniRef50_A0A1Q9KTK4 Uncharacterized protein n=10 Tax=Bacillus TaxID=55087 RepID=A0A1Q9KTK4_9BACI  ali  18  12.KEQDFITNLHATLKPLGFKKKRHTFFKAENGFYKLINIQKSQFGDDFYINIGVHPIGLPQKENISILACILQTRIEPIHIKQNQLLHNVSHETINIPNYLSTIFD................................................... 124
275 7.000e-13UniRef50_UPI00096CE4EE hypothetical protein n=1 Tax=Mycobacterium fortuitum TaxID=1766 RepID=UPI00096CE4EE  ali  1MLRKELSDDIEPLLRERGFIRKGRVFRRQRGLLYDGIGIHRGKFDDFHTFSVSVGIGSTEIDRFPPEPNSTISRPWGRLVPGLPEY---FYFDETYDVDIWGCVLSDGLERVVDVMDQFDSSRTLARWAAANNLLYQYERTCG--YLAAVGDVD... 161
276 7.000e-13UniRef50_D7IH83 Uncharacterized protein n=7 Tax=Bacteroides TaxID=816 RepID=D7IH83_9BACE  ali  12  5..RKKVMLLLGERLLEFGFKKKLNTFVRQLDDRIQNIGFTIANCGQKFYLNIGVAYKNVNRLKYPEYVYATISTPLGYLMPENTFKEWKFSNQENVEKEV-NSMADAIIEYGLPYLNEFSDEDNLVYGLECDKFHIGEVKYDLLIFYYLRGNNERAL 175
277 8.000e-13UniRef50_A0A2B5X5A8 Uncharacterized protein n=1 Tax=Bacillus toyonensis TaxID=155322 RepID=A0A2B5X5A8_9BACI  ali  16  2...QDFITNLHATLKPLGFKKKRHSFFKADNGFYKLINIQKSQFWGDFYINIGVHPIGLPQKENISIFDCILQTRIESIPIKQNQLLHNVSHETIHIPDR--------LSTIFDWFQTWASYKNLAK.............................. 125
278 8.000e-13UniRef50_A0A0C2UY82 Uncharacterized protein n=1 Tax=Cohnella kolymensis TaxID=1590652 RepID=A0A0C2UY82_9BACL  ali  11  1MEKKLIKKTYAEFAKEHGFTFYKPTLVRISEDTLHIINFDVYAHG--FDCKVAIQPLFVPGEA----ISLSLGNRLSHLGEHSPGIW--GQGNEIEVAEDFEQVKVLLENNALPWFEKVGHPEGLINFLSDGNFPPFMRRLILAMGYLNCGNTRKA. 163
279 8.000e-13UniRef50_A0A1H6K6G0 Uncharacterized protein n=1 Tax=Chryseobacterium hominis TaxID=420404 RepID=A0A1H6K6G0_9FLAO  ali  17  1MNAKEIKLHLKPFFKNRDYKNSNQTWWKDRGDFYNVINLQNFSWNTDFRFNLGIALKADRTLKKVTHFDCVTHLGNGAFLPDGSNLGYEIKSDTHLDD-FITSFFDDFSNYVIPNFEKQNNLKELIDFYNQYEFWGNQLEKQIII............ 162
280 9.000e-13UniRef50_UPI000B862412 DUF4304 domain-containing protein n=2 Tax=Burkholderiales TaxID=80840 RepID=UPI000B862412  ali  18  20........HLGAHIRTLGFKGRGQNFRRVEGEYIFIINIQGSRSGEVFYINLGAQPTFIPAESTLKEYECVMRRRVGN--------EWNRDLD----EAARLALIRQLDAEQEAFFGTVDTPDELLRKF-SMGNPPARTALHLARAAASLGH..... 164
281 9.000e-13UniRef50_A0A2G2DIM3 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2DIM3_9FLAO  ali  15  24..KVAVKEYFAPQLREEGWKGTGFDFYKNESPLFYVLSFIPNKYGGSFYVEIGIHYSFQFDSKKLKTYELDFRRR---LKDEDNNVEWQYPSDIESCSDILDQIWGTLETDGNVFFSQFN..................................... 145
282 9.000e-13UniRef50_B2JFT9 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=B2JFT9_PARP8  ali  14  8MNRA-LKARFVPALRQLGFKGALPHFRRLRDDRVDLLTVQFDRHGGGFVVELSQCGAEGITTHWGKFHDLHPRHRLGSPGPN-IDHWFRFD-DGTLPRAVADSLCTHIDE............................................... 124
283 9.000e-13UniRef50_A0A1R1G342 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL R7-0337 TaxID=1926588 RepID=A0A1R1G342_9BACL  ali  18  4.....................................NIQSSRWNTQFCFNTGIYMEEYPKPAFPTVVSSVLQIRGTELTKNGN--WYKLTPDS-SVEELKRRITKDISEYILPHLQQFEKVEDVIRVLELREKAGIYEPHHLPVLYYLIGEMEQA. 131
284 1.000e-12UniRef50_UPI000A26920E DUF4304 domain-containing protein n=1 Tax=Roseovarius aestuarii TaxID=475083 RepID=UPI000A26920E  ali  13  21.MEAALKERCVPVLREQGFKGSFPNFYRESDKFIALVNFQYYSAGGSFCVNLGVFFEPQAKTNRLRVSATKDQRRLGAL--DGGDRWFSFGKTSSGVAEIADTCTQLLLSEAKNW.......................................... 148
285 1.000e-12UniRef50_UPI0009DFB275 DUF4304 domain-containing protein n=1 Tax=Pseudomonas TaxID=286 RepID=UPI0009DFB275  ali  17  1MKRESIKTIFKRAATKFEFSGDDSTFFLKMNDKYLIVNLQKSSSGKSFYINCGIHSPTTTFENKANRFPAHVDFRVESIPHTTIKQDQIDSASTNQNTQEIEKILQAALQSVISFTQQHGSREEIRRLSQAEKFNAIINK................. 152
286 1.000e-12UniRef50_A0A1E5PMG3 Uncharacterized protein n=1 Tax=Streptomyces subrutilus TaxID=36818 RepID=A0A1E5PMG3_9ACTN  ali  13  9...QMLRRKIAPALRDAGFTGTGLEYRRECAPDHALVGFQRSAGDGRFTVNLRAVLHEDHEALRRRRPALGWHTRIGRLLGHPHDHWWTIT-DERSADRAADDVLALVLRHGVPAL......................................... 139
287 1.000e-12UniRef50_A0A2I0D7X1 Uncharacterized protein n=3 Tax=Flavobacteriales TaxID=200644 RepID=A0A2I0D7X1_9FLAO  ali  21  1MDSKEINSIIRPVLKENGFKFNGRTYWRHNSDRIDILNFQFNSYNADFAVNLATYIKEKDGIEKPAEYQGHFRKKGIDQKEFPRNDIWFVNNDGGNLSCVVSDCNSQIQKTAFDWYKQFESKENVIRILLEGNMDSPNRNKFIAYTAIELGKTELAI 194
288 1.000e-12UniRef50_UPI000A01D40B DUF4304 domain-containing protein n=1 Tax=Frankia sp. DC12 TaxID=683315 RepID=UPI000A01D40B  ali  17  1....MLRDRVAPELRAVGLSGSGQVFRLKSTSHHVILSFQRSRGEVHFTANLAIFDRDTWNSARDRDPVLPIQTRIGHLAGGSTDIWWKIG-ELGDAESVAAEVVRAIRSFMIPVIQS....................................... 131
289 1.000e-12UniRef50_UPI0009EADC40 DUF4304 domain-containing protein n=1 Tax=Nocardioides sp. Soil777 TaxID=1736409 RepID=UPI0009EADC40  ali  12  70..RAEVRDVLGPAARSHGFKGTSPTWRRSTPGDWAIVNLQSSRSSSRCVLNTSVAPEPWLRWTRVPESMGLYKQRLPSNTPDSNDGWWQVDSPRRVP-QVVDDMHAQLERQGWPVLGRLLERDEMLDRIRQGDLVPGYFATAEALLLMDAG...... 240
290 1.000e-12UniRef50_B8GMW0 Uncharacterized protein n=1 Tax=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) TaxID=396588 RepID=B8GMW0_THISH  ali  12  1MTSKAITEHLAPVLTKAGFYRYRPHFLRIRREMVDSVGFQMSKWGGHFYVHYYINLLSDPLMDIDTY---RIGKRVD--APPDRDINWA-GPDEATATIAIQSVTKVVEDSILPWFESVSTVRDVVEYVAKPDTQLDSLDLSIALLH.......... 150
291 1.000e-12UniRef50_A0A170ZP20 Uncharacterized protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A170ZP20_9ACTN  ali  15  15........RIAPHLRALGFQGSGQRYELPREKAWAQLGFQKSRGNTRFTVNLSVIGKAAWERARPGRPNPNVHHRIGLLLPSGSDVWWGFEAGEGSVEELAEDVCTAITDCAVPHLHR....................................... 145
292 2.000e-12UniRef50_A0A2V2YMJ0 Uncharacterized protein DUF4304 n=1 Tax=Paenibacillus cellulosilyticus TaxID=375489 RepID=A0A2V2YMJ0_9BACL  ali  12  7..RKLIKEHFAPRLHQLGFKGSDHHFVKTNDNFIYTLVIQADKYGGSCVMEMGVHLPISFNEIKPPIYDCEFRKRLNNWLKVERERWFSYGETEEEALDTIMEMRELFLNEGMNYYSQFKEFPKSITSIELDEIVARSNRL................ 156
293 2.000e-12UniRef50_A9FWA5 Uncharacterized protein n=1 Tax=Sorangium cellulosum (strain So ce56) TaxID=448385 RepID=A9FWA5_SORC5  ali  15  8..KRLISQIVGPRLADLGFHNPGRAMWRLRPYFVDVVWFHCPRAG-IFQVEFGCGLRNAVR-NNPAPWHCQFRTQPAHSFNW-EELPWSFRLSESEQVEVLRLLAPRVVAAARRWFAHFDTIDSAIRALESNPLSGP.................... 139
294 2.000e-12UniRef50_A0A086AAP7 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A086AAP7_FLAHY  ali  22  1MNKKDLVKFLDEIFLPLDFKRKGNNWVSNGNIINKIVNLQKSQYSNSYYINYGYVLNSLPLDNF----TYHVDNRLASKDKSEQEITDLLNLENDIDSEKRLVLLNIINSKIVEEIKFISKEEDILRILKAREHLYTIPPFVLKYF........... 144
295 2.000e-12UniRef50_A0A1V2Q151 Uncharacterized protein n=1 Tax=Saccharothrix sp. ALI-22-I TaxID=1933778 RepID=A0A1V2Q151_9PSEU  ali  23  11..KVMLRDHLRPVLKAGGFRGSTTTWRRESEGDWAIVNLQRSRDGVWFTINLAVVARPWWEWINPSAASGYWRTRLDPDDLSAGYRDWWAVHDTDSAHACGRDAAEQLARIGIP........................................... 137
296 2.000e-12UniRef50_D0KJ71 Uncharacterized protein n=8 Tax=Enterobacterales TaxID=91347 RepID=D0KJ71_PECPW  ali  18  6MNIKLINN----FLTSNGFSKDNDNFFRVNNGFLNCINFQRITTGDVFFINLGVHPIFDPKDTFKREIDCYIRTRLSTDK--------RLSVELFNSSEGISFVINEIEEKAWHFFDLFSSTNDVFSCLSIDDIKNKNIP................. 137
297 3.000e-12UniRef50_A0A2U3AWJ9 Uncharacterized protein n=1 Tax=Oceanihabitans sp. LYZ1037 TaxID=2200952 RepID=A0A2U3AWJ9_9FLAO  ali  19  64....ELNKIIGANLKEYGFKKKGRKHYRLTNDLLEIIDIDNSWTGAKDNMKIRVGLVPYCWEGLTNEYYLVGSKKIEEID-KSIRKHFRISQEYLI---LADYLSERIINNILPFFNKYNSTEKIINQYYSKRGGDDIHKSQFLILFSELKQH.... 215
298 3.000e-12UniRef50_A0A2T5JGW0 Uncharacterized protein DUF4304 n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2T5JGW0_9SPHI  ali  22  1MKKEDFKKSFNIVAKSFGFEKEFGGWFKESTECIIVLDLQKSNYNNLYYLNIKIYIQKMFGNNYAKSKDL-VKKNIGDVFFRERGNSEVFNLDNSMTDTERLDQLNIFFYSINPLLNAALTKSGIKKLADEKSLLLPAVENELLLLLSK........ 149
299 3.000e-12UniRef50_UPI000D6DF9A2 DUF4304 domain-containing protein n=1 Tax=Pseudarthrobacter sp. AG30 TaxID=2249742 RepID=UPI000D6DF9A2  ali  11  9..........APLLKAAGFKKRRHCFNRLSDGLVHVVCFWMARLYGSFRLDFGVHVPEMPRRPWINDYDCHLRRTIGQLISGQDARDSWWKLDDPKASGNAD---TALRQVGLPWLDSFPDALSILDSFDEVGPLP..................... 152
300 3.000e-12UniRef50_UPI0008159D51 DUF4304 domain-containing protein n=2 Tax=Arthrobacter enclensis TaxID=993070 RepID=UPI0008159D51  ali  27  10...RIIESSFAGILKARGFRRRGRSWFRTTSGEYQVINLQKSPWGGEFYLNLG-WDPAVASGEFRSENSCVFGLRAESIDFVRPDGLAARDLPGIIEDSFVKQLIDVIVVPIADFMDRTPALQDLVPLLTEKPHLAFIP.................. 163
301 3.000e-12UniRef50_A0A0M4G3D6 Uncharacterized protein n=8 Tax=Bacillales TaxID=1385 RepID=A0A0M4G3D6_9BACI  ali  28  1MDTTEFKEIVDKIVVSNGLVKRRKFYYLESEDLTVVLGLQKSSYSSSYYFNLGYVINILNDTHYPKYTDGNVRLRFD-FEIDGKTTD-IVDIQDVLKDQFISELVRNINHYV----SSITGIEALKNLILKEPVLLYQTTLATKQYLK......... 142
302 3.000e-12UniRef50_UPI0005605489 DUF4304 domain-containing protein n=1 Tax=Streptacidiphilus rugosus TaxID=405783 RepID=UPI0005605489  ali  15  11....MMRDCVAPRLRALGWKGSGQRYEFPDTHAWVQLGFQKSQHNSQFTINVSVIGRLAWDAHRAEQPLLPARVRIGRLTPREQDTWWHISVDRPRDDWIANGVCASVSDYAMPEIRRLL..................................... 145
303 4.000e-12UniRef50_A0A1G8FJ43 Uncharacterized protein n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G8FJ43_9FLAO  ali  16  19..RKLVEEFVQPELTSLGFKKSELTFKRKIGDFTQEIYFAKNQRNFCFWTILSVYYVKWHEKKYGFKPMNEFVESWYDNHIKTWNTDFWYDLTEFDNIKLMNDLTKNILTIGLPILDKVSDWEGAADSLMERQRFGFISKIFDFYILA--GKEEKAI 185
304 4.000e-12UniRef50_A0A1M5W088 Uncharacterized protein n=1 Tax=Fibrobacter sp. UWCM TaxID=1896208 RepID=A0A1M5W088_9BACT  ali  16  1MNLKVLKRTFAEITKSIGLETKFGGFVKETEEVIIVLSFQKSNYSSQVYLNIKLYIQGVFGKNYQLSREMVVNDVGDVFRRAPKDYDQIFDLGFDLSDERIEQLKAFVDEFLSGFIQQASTVKGIMLLAEQGELF...................... 136
305 4.000e-12UniRef50_A0A0R3MGU0 Uncharacterized protein n=3 Tax=Bradyrhizobium TaxID=374 RepID=A0A0R3MGU0_9BRAD  ali  11  2MTGQEFRKGLFEALQQHGFARRGSLMRLPGDAAITLVGVQKG-FGEQWFVNVGFWLKQLDRAEPDRIEQSHLYFRLERLFPKYREFILEAGDLAAEAQLSAQNFLRVLVDEIADGLKQLGTAEGLADAYHAGRLTAGLVTKAATELLAR........ 150
306 5.000e-12UniRef50_UPI0003B4D9C1 DUF4304 domain-containing protein n=1 Tax=Lachnospiraceae bacterium (strain NK4A179) TaxID=877424 RepID=UPI0003B4D9C1  ali  15  8...KEIRKRIKPALKEMGFKTRNSHYVRVSGEIVQCFGFQKF-NGDHFTVNFGITPLYTTSSRYFLE-----SRRIGDLIGPG-DKWWTY------CEKSVDLVSDLILNTLLVVFKQCDSYIGFYEAVEK.......................... 123
307 5.000e-12UniRef50_UPI0009E4516D DUF4304 domain-containing protein n=2 Tax=Pseudomonas TaxID=286 RepID=UPI0009E4516D  ali  18  1MGKRLVEDVVFPIFEGEGFYKNRDGFYRGRKEFFDFLSVQLRSDGAAVALNAGVQPVFLIDSSSPSEVDCFIRKR---LTPEGSDYWFSVHLP---HPQIIEEVRSVFYECGLPFFRFFETLSGVVESIEGGEFLSMMTRSRLALLCAKIN...... 165
308 5.000e-12UniRef50_A0A2G5KIV9 Uncharacterized protein n=1 Tax=Gaetbulibacter sp. 5U11 TaxID=1889780 RepID=A0A2G5KIV9_9FLAO  ali  12  48....LMNNEFTSYVKSLGFRGSKNNFYKKSIPWIYTIHIHKDKWGGSCALNIGVHVFGIEDPSKYNFYDCIIHK---NISMDNDNGWFYYGQTIEEGKETVRLMLKMFKDKAIPFFNLFQNYPHPFDKITVDDIKN..................... 184
309 5.000e-12UniRef50_UPI0006D55A80 DUF4304 domain-containing protein n=1 Tax=Paenibacillus ihuae TaxID=1232431 RepID=UPI0006D55A80  ali  13  7..RKLLQLHLKPRLNQLGFMGSDHHFRKNSDEFIYTLVIQGNRYGGSCIIELGVHLDEKADNHNLTVYDCEFRERIEAGIPWTQRIWFEYGKSEADAIRTINRMYKVFKVRGLEYFDQFKGFPEPIEELKAGRSKQQMSDLRLALVIARTHEF.... 184
310 5.000e-12UniRef50_A0A099RZ60 Uncharacterized protein n=1 Tax=Desulfosporosinus sp. HMP52 TaxID=1487923 RepID=A0A099RZ60_9FIRM  ali  17  5MVNKAIKQHIFPLLKGNGFVFTQRTAWRYGTNKIETVNFQSFNSTFSFAVNLGIYFKDIPNQFCPQEYECHFRKPLEQIELSRKNVWF-IDPEGAYLELALNDVKQELVSAGLAWFERYENMTEVLRTLLEDNE....................... 164
311 6.000e-12UniRef50_A0A1Q6G5Q4 Uncharacterized protein n=2 Tax=Bacteroides TaxID=816 RepID=A0A1Q6G5Q4_9BACE  ali  13  5..KKKIYLFLEEYFSKYGFKKKRNNYVRKDGNVVQYIGFTTATHGERHVIYVGIIYRDVDENRDIEEHGPMICLPIGYLMPENDFREWKFTIDKDISDGV-DNMARAIIDYGLPYLEELSNVDQVIYGLATSQYIGGEKDYILPVLYYLHGNSEQAL 175
312 6.000e-12UniRef50_A0A2W5SEA3 Uncharacterized protein n=1 Tax=Flavobacterium psychrophilum TaxID=96345 RepID=A0A2W5SEA3_FLAPS  ali  16  8..KRQIGQNFRQAMKDLGFKGSGFDYVQETKDFLFSVFISPSRWGEQCSVGLAIHPKQITNLKKLKNYQYEFKF---SLSPVAREETWDYKHTADENLSIVREMIEVIKNRALPIIDNFKKDKNLLDEFTVNDLDNFHEKF................ 150
313 6.000e-12UniRef50_A0A286H5J1 Uncharacterized protein n=1 Tax=Blastococcus sp. DSM 44270 TaxID=1938745 RepID=A0A286H5J1_9ACTN  ali  12  10...RDVVARVRPVLEEAGFRKRRHTFNRTEPGLVQTITYRMGPYDGLFSVHLGIFIEEAWRKDWVNDHDCQLRRLVDNPAGEAINHMWPLDDPGVGPA-----MVDLLVGDVLAWFDRFGSRTAILAELEAAPTSSY.................... 168
314 6.000e-12UniRef50_G7H4T9 Uncharacterized protein n=1 Tax=Gordonia araii NBRC 100433 TaxID=1073574 RepID=G7H4T9_9ACTN  ali  17  11....EIVAQVGPTLRTAGFRKRGRTYNRISPGFVHVVNFQLGRPYAYFAVNLGVFVAEAWDKKWISESDCQLRRRLSRPQDNRSVLRRFVGRRNGGDASTVARLTTAITTDGFGWLARYPDRTALLAELEGRP........................ 177
315 6.000e-12UniRef50_UPI0009A86D98 DUF4304 domain-containing protein n=1 Tax=Krasilnikoviella flava TaxID=526729 RepID=UPI0009A86D98  ali  28  1MDRADFYVDLDATLRALGFTRRGMNWVRRSGDLYSVVNLQKSEWGAGRYVNIGFARASTTEGGWLPESKCEIRFR.................................................................................. 77
316 7.000e-12UniRef50_A0A1Y4GGT5 Uncharacterized protein n=1 Tax=Cloacibacillus sp. An23 TaxID=1965591 RepID=A0A1Y4GGT5_9BACT  ali  24  13...............EYGYKKHGNSFWKTENGFYKLINFQTGAYGDYFFINVALHPDGMPTTKKPKESQCAFRWRIEQIAGCAAVFRGQIGF--PQDADTAKRLIAAVMPEIESWLDKRGSYQAVLSA--DFDELSRSFSAVPILWMKEF....... 150
317 7.000e-12UniRef50_A0A2A3I362 Uncharacterized protein DUF4304 n=1 Tax=Streptomyces sp. TLI_235 TaxID=1938860 RepID=A0A2A3I362_9ACTN  ali  11  8..RAMLREGVAARLRALGWKGSGLRFELPDPNAWVQLGFQSSRFNSDFTVNISVIDRRAWEAYQADRPELPARVRIGYLLADRRDTWWHITTPGDAVDRTADGVVAAVADQAMPEIRR....................................... 142
318 8.000e-12UniRef50_A0A1S9PCV9 Uncharacterized protein n=1 Tax=Mucilaginibacter pedocola TaxID=1792845 RepID=A0A1S9PCV9_9SPHI  ali  19  10MDKA-IKEIAIPFFREKGFTGSYPHFRRIQEDRINLLTFQFNRSEPSFVVEISNCSPKGVQLGWCTAHHMHRRHRIGS-KQHNKDYWFDFSEESTNNE........................................................... 113
319 8.000e-12UniRef50_A0A0D8BV84 Uncharacterized protein n=1 Tax=Geobacillus kaustophilus TaxID=1462 RepID=A0A0D8BV84_GEOKU  ali  21  11....ALKKIVVPELRNRGFKGSFPHFRKQEGQLGYLLSFQFDKWGGGFIIEVGVVIVDGIVRPFQKMKAFHLNNRFRIMNNKNGDKWFKFDNENQNLEE.......................................................... 114
320 8.000e-12UniRef50_A0A2T1MID5 DUF4304 domain-containing protein n=14 Tax=Escherichia coli TaxID=562 RepID=A0A2T1MID5_ECOLX  ali  22  4.......KPIGDFLNKNGFIKNGNNFYKVHDKFVNCINFQKKSTGDIFFINTGVHPVFFCNEPPKKEIDCYIRNR----VCDGLSISLLHSFEGS------EFVINEIKNKAFCFFEYFDSLNKIFDAIR........................... 119
321 9.000e-12UniRef50_UPI000CF739D0 DUF4304 domain-containing protein n=1 Tax=Pseudoalteromonas sp. T1lg22 TaxID=2077096 RepID=UPI000CF739D0  ali  19  8..KKYAKNSLSPYMAALGFEIKGLSYVKEAPEMTYFVDCFASRWGN-VTFDVGIYVPELDEEEWPKVMRSLVGGELQEDSPMLKYVQHCWNFES-EPEAVIDRVQAAIEKYAIPFFEEIQSREDMVNAIDND......................... 142
322 9.000e-12UniRef50_A0A2C3JMB2 Uncharacterized protein n=5 Tax=Bacillus TaxID=55087 RepID=A0A2C3JMB2_9BACI  ali  20  28.........IAPLFKAKGFKKKGKNFAKLFPDFAWTVNIQSSKWNTKFLFNTGIYCDKVYTPIFPLELYSMLRLRISDI-KNIRENWYKISDKTDI-EEIKKQVESDIVNVILPYFEQYQNVEDIINVLEIMDEKGEFEPHHLTLLYHYYGYPEKA. 184
323 1.000e-11UniRef50_A0A1T5I8D7 Uncharacterized protein n=1 Tax=Bacteroidales bacterium WCE2008 TaxID=1945891 RepID=A0A1T5I8D7_9BACT  ali  17  36......KQYLDSLLKAKGFLKSNAYVRRNHVDVLELIELQKEKNGGTFTVNYALTPL---YLQYDFASFC-YSERMGILVC-GKDVWWDYADESIARVSF-ENVAKAIEEYVLPWFDACSNDDSIKKLLLAKEEQGGRLSVYERAWLESLGNHGD.. 182
324 1.000e-11UniRef50_A5FLI4 Uncharacterized protein n=2 Tax=Flavobacterium johnsoniae TaxID=986 RepID=A5FLI4_FLAJ1  ali  15  1MKNKKIQKIFGKAAKETGFKGSGVTRYIEFPNYWLLVNHQKSFYSIHFYANVGLIYKELVDHTIKSAIFPHVTFRIESCPGMPEDLTIQIRAVENGQEERLENVLKEALTKLLSFMEKNYSRQDIRKMYEDKKLSAMILK................. 154
325 1.000e-11UniRef50_A0A223EB80 Uncharacterized protein n=3 Tax=Bacillus TaxID=55087 RepID=A0A223EB80_9BACI  ali  18  8MMDNALKKVVIPVLRKLEFKGSLPHLRRKNENNIDLITFQFNRWGGSFIVELATCPTEGVTMYWNKVTAHHIYKRLRLGAESEDEDGIWFDFENAKTEEEFEKVA.................................................... 118
326 1.000e-11UniRef50_U2XRX6 Putative acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase n=4 Tax=Microbacteriaceae TaxID=85023 RepID=U2XRX6_9MICO  ali  23  10...ALVANAVVPVLKPRGYRKKRLVWTRETPGVLHEVTLQRSQGNARVYVEGAVYVAGFDEPSPLSRATPQYRRRFEDIVGWPA---QWIDLETWSDDELVPRLHEAIGTLA-DHLERIDSAEGLA............................... 138
327 1.000e-11UniRef50_A0A0T9LVP3 Uncharacterized protein n=1 Tax=Yersinia nurmii TaxID=685706 RepID=A0A0T9LVP3_9GAMM  ali  21  4.......KSISDFLINNGFKSNGSDFFKENDEFIKCVNIQRKSSGDVFFINLGVNPIFNDENPPRKEIDCYIRHRISS-----GNELDAFPLNTGDDVDAA---INKVKNEAWPFFDFFSSLDNVFGSIKVKDLEEGTIPKEL.............. 135
328 1.000e-11UniRef50_UPI000D7C5680 DUF4304 domain-containing protein n=1 Tax=Modestobacter versicolor TaxID=429133 RepID=UPI000D7C5680  ali  13  26..RELLTGHVGPGLRAEGLTGSGSVWTLPSDTHWVTVGFHASQTSTTFTADLRVLSKALWAAEDVPAGRCPARERVGALLPSSGDHWWSVTPD-DEPAPLAADVLAALRDHALPAARRVLEEE.................................. 162
329 1.000e-11UniRef50_V6S3B3 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=V6S3B3_9FLAO  ali  22  1MERKELKEILIPFLREKGFKGSLPHFRRQQSDRINLLTFQHSLYDTKFVIELANCPPNGITTHWGKEHDIAYRMRLGS-EKYNSDYWFDYSLFTDNYKKIANEIIELWSE............................................... 128
330 1.000e-11UniRef50_A0A0H0XK44 Uncharacterized protein n=1 Tax=Erythrobacter marinus TaxID=874156 RepID=A0A0H0XK44_9SPHN  ali  13  1MD-AAIRQVVVPHLRALGFKGSLPDFHRPRGEAVDLLTFQFNRNGGAFVVELGRVAAGGFDFHGKHIPAARAKTRYSELRVNYGDHWFAFAIR--DPADVAREVCAELRAELWAFLDELQ..................................... 126
331 2.000e-11UniRef50_A0A1H7L1L8 Uncharacterized protein n=4 Tax=Comamonadaceae TaxID=80864 RepID=A0A1H7L1L8_9BURK  ali  16  9.MSSALKSVLVPELKAAGFAGSFPDFRRDRADVIHFVSVQYDKPGTAFFLECGAHPPGEKTTSWPLTERARLQGRGGAGGSSLAEDWFSYEGFGDSPEPYR--LLAASVASMLPQ------IEGWLAARERGPNLSTM................... 151
332 2.000e-11UniRef50_A0A2R7SKJ8 Uncharacterized protein n=1 Tax=Pseudomonas sp. HMWF010 TaxID=2056847 RepID=A0A2R7SKJ8_9PSED  ali  16  11....ALREIAVPALASHGFKFDGRTFRRFSEGRCLIINFQLGQRSGKFTINLGVFVEGDNPTSRANAYDCRFRTRIGALIPGGPDKWWVFSDDSSDTDAVLSDAVDKITAHGLSWLNTI...................................... 151
333 2.000e-11UniRef50_A0A0A0BBS4 Uncharacterized protein n=1 Tax=Cellulomonas cellasea DSM 20118 TaxID=1408250 RepID=A0A0A0BBS4_9CELL  ali  10..RSLVKDHLGPRLRELGWTGSAAAWVRPHLTHWVLLGWQKGRYSTDFTAHLAVMSKDAWDAENIPAWGVGWQASIGMLVPGTAGDRSWYVRPGDELAAIAGEVMRDVVTYGLPAVER....................................... 142
334 2.000e-11UniRef50_A0A0Q6GUM7 Uncharacterized protein n=5 Tax=Rhizobiales TaxID=356 RepID=A0A0Q6GUM7_9RHIZ  ali  22  30..KKSMTTDINGLLLPKGFRREDSRWLRQGVFFEVYFEFQKSQYGFSCYFNIGRVSRLGDQQHWRMNSFLPTVE-----LKNEYDAHYYVDLDGDSP--RRREIIRQLNEIGLPMLERLASWRGLLTSL............................ 149
335 2.000e-11UniRef50_A0A2K8Z2M1 Uncharacterized protein n=1 Tax=Spirosoma sp. HA7 TaxID=2057025 RepID=A0A2K8Z2M1_9BACT  ali  18  12...RVIKRSFAHQLLTSGYQQKDNQFYLKSDQVGKLVTIQRHSYYHQFTIRVQILSDDVWELTHPGYPYSVFDRNLGQFYGKKRGTQW-LALDATAPEQIISYLNNLILTRILPYLNQFNSVDDILQECERMGFSHL-----RMLLLARLGRKEEA. 175
336 2.000e-11UniRef50_A6C4D4 3-oxoacyl-(Acyl carrier protein) synthase n=1 Tax=Gimesia maris DSM 8797 TaxID=344747 RepID=A6C4D4_9PLAN  ali  17  1MTPKQFRQLFAGVLSAYGFTCEGSTFYRKSDELFHFVLPDLGTHGTWFDVKVFPASPFPDDVGIPTDSYSYLSERGIGLDQEK----FNCKTEENMRHRFEASVRPALEDRAIPYLDQFCSIDDIVPVLSN--------PIFRGIGLHLVGKMEEAI 162
337 2.000e-11UniRef50_A0A0Q9DAK4 Uncharacterized protein n=4 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0Q9DAK4_9MICO  ali  16  1....MLREDVAPILRAAGFRGTERTFVFPDADWFAQVGIQSTSSRSRLTINAQVIPKAFWERHYPAKPSPNVYGRIGEFWIDGQDRWWSLDASGRGRRELAVEIADLIVDVVLPAMQ........................................ 130
338 3.000e-11UniRef50_A0A2G1WB87 Uncharacterized protein n=1 Tax=Rhodopirellula bahusiensis TaxID=2014065 RepID=A0A2G1WB87_9PLAN  ali  10  54MND-VLRDRVVPVLRQRGFRGSMPHFRCVVDDTLRLLTFQFRSSGGSFVVELGHCASGDFTTSYVTYLSPRSRFRLGATDP-LDDHWFDFAGRDNGCDLSATEVLAFLDSDG............................................. 173
339 3.000e-11UniRef50_A7B691 Uncharacterized protein n=8 Tax=Clostridiales TaxID=186802 RepID=A7B691_RUMGV  ali  20  6MTKQEFKEFCHEEFTKRGFKKRRNMWYLQGKGLLCGMYLQKSMA-EAFYVEYDFFFGDFSNKKYPTTYDSDVYRRIGVLTKEDKTLTGLIDYELYTPDELRPYFDKAFEEHIMPAI......................................... 121
340 4.000e-11UniRef50_A0A2T0R508 Uncharacterized protein DUF4304 n=1 Tax=Kineococcus rhizosphaerae TaxID=559628 RepID=A0A2T0R508_9ACTN  ali  14  1MDAQALKAHVAPAWRRMGLRGSGNAFRLPNDGHYALIGVQRDKWNCAFTLNVSFTSAQEWPNANAHTPGVGWWQRVGSLVADGHDHWWLVQAEVVGVDAVAAEVIDIVAEVVLPQLQARLD.................................... 162
341 4.000e-11UniRef50_UPI000ABECA81 hypothetical protein n=1 Tax=Phenylobacterium immobile TaxID=21 RepID=UPI000ABECA81  ali  13  1MSRSLFAKALDAALRPIGFERNKDDWTRIRGDFEATINRQSSWLGGNCALKDLVTERLYLEIFPEAVVFPVPYRRMGEF-IEGHDGWW-----ATEDPDAAADMATAVLNNVIPWFEQPWPLEVQAREWERLRGGGGFGAIGLVLTLHRMGEFDD.. 159
342 4.000e-11UniRef50_A0A0Q4V552 Uncharacterized protein n=1 Tax=Curtobacterium sp. Leaf261 TaxID=1736311 RepID=A0A0Q4V552_9MICO  ali  15  8..RDALRTILGPAVRAHGYRGTAPTWRKESEGDVAVINMQMSAYGSSCVVNLSVEVVPWAEMTLLHSPGGLWHRRPSEASDDGPEQWWSVTDEASAR-FVVEDVVAQLEDRWFGVLDDLLAPGGMLRQVRSGDL....................... 155
343 4.000e-11UniRef50_A0A1M7N5U1 Uncharacterized protein n=1 Tax=Anaerosporobacter mobilis DSM 15930 TaxID=1120996 RepID=A0A1M7N5U1_9FIRM  ali  19  7.KNRILKEVIKPLIKSAGYKCGGTTFYRECQECYVIINLQSSQFNNDFWFNIGVLKKEVVDINDVKKSDGGNSTREETFLPDSRSNGYSIGGIKNDYDDAAARIGSDISQYILPRLDFVQNLEDWDKLLEELIELNNNKRNHLLTFFY......... 172
344 4.000e-11UniRef50_A0A257GUG8 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A257GUG8_9BURK  ali  21  1MD-AALKAIVVPVLRERGFTGSFPHFRRIAA-AVDLVTFQFDRNGGGFVIETAVAKKEGFTTHWGKHIPASKRKRLKPREGAGTDAWFRFDGLVSCDAVAREALSQILRDK.............................................. 119
345 5.000e-11UniRef50_A0A0Q9JLX8 Uncharacterized protein n=2 Tax=Agromyces sp. Soil535 TaxID=1736390 RepID=A0A0Q9JLX8_9MICO  ali  20  6....IVQLTLGGFCESAGLRQRGSAWSRRREDLIHVVELQKSGQGRRYRVEIGIWLLTLGETTSPRTASCHVRTGLEAQMPEESHLQQLLDLEVSIAKERRDELTTLLDDHLAPVLGSITSAAELR............................... 130
346 5.000e-11UniRef50_A0A0M2T229 Uncharacterized protein n=7 Tax=Bacilli TaxID=91061 RepID=A0A0M2T229_9BACI  ali  14  8.MIKALKMILIPLLREKGFKGSFPHFRRKLTNRIDLISFFFDRYGGGFTVEIGASPSNGFTIKPPNKVNTTHHVPQTWLEPFEGHDSFRYD-EEPVPDDIYEKLAYEVVS-LLPKAEEWWNSDKIARIIEKK......................... 141
347 5.000e-11UniRef50_C4L067 Uncharacterized protein n=21 Tax=Bacillales TaxID=1385 RepID=C4L067_EXISA  ali  15  13.....LKREVVPYLRSHQFQGSFPHFRRMQSDRIDLVTFQFNRHGGSFIVELAQAPPTGFQTYWAHDIDVDARRRLGSHSPDEDGIWFLYESAQSDQDYLRQQVIASFEQDIL............................................ 132
348 5.000e-11UniRef50_A0A2N2UG16 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2N2UG16_9PROT  ali  17  1MDSKEIRGRIWPLLKEQGFTRSSRTAWRDSEGQVDVVNFQFNRYNADFSVNLGCYVPPMWPPKMPQESECNFRGGLSPKVSQPGNNQWSIDDEGRNLPWNIQDVVGQLPE-VHRWFGRLSDRSEVLRVLLEDGE....................... 159
349 6.000e-11UniRef50_A0A2G3M232 Uncharacterized protein n=8 Tax=Janthinobacterium TaxID=29580 RepID=A0A2G3M232_9BURK  ali  11.....IEAYLLEPLSAAGFKFSQLTFKRAQDEFVQAIHFQANRHNEEFWSHYQVSSRACTSWHKARYGYEPVNNIVGEVADWNIKNWQFPVIDGKQDKEVMACLRDNLLELALPWLDHHSNWEAALALVEAHDSHARACDF-----YLMAGKQEQAL 176
350 6.000e-11UniRef50_A0A2A4MQE3 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4MQE3_9GAMM  ali  21  8.MESELKEYCISFLRERGFKGSFPNLYKETKGFVCLINFQFFSSGGSFCINLSVYYKKETEAKKLKASQTRKRVRLGSENLEG-DNWFSFGKTSTSPSELIEIINNLITNQAELW.......................................... 136
351 6.000e-11UniRef50_A6LYB2 Uncharacterized protein n=11 Tax=Clostridiales TaxID=186802 RepID=A6LYB2_CLOB8  ali  16  23MLHETFDNVIVPGFKEKGFRKNGKTFYRKRDGLTEVCNVKFSRDNSRFWLQVCIAIPSFYDTIFNIESDSLIGWENGHYPPYMLDLWNSRETRKDEKEELLKDVASDIENVIIKFFNTIPSAEKLLEHINNDESADEAMMYEVACLYYNYGEQEKA. 225
352 6.000e-11UniRef50_A0A1H4P8T9 Uncharacterized protein n=2 Tax=Arthrobacter woluwensis TaxID=156980 RepID=A0A1H4P8T9_9MICC  ali  21  10...ALVAGVVVPALKPLGYRKRKLSWSRETPEAVHGITLQRSQGNAPFYVEVSAYVPDFARPDRLEKATPQYSRRFESVI---DWPGQWIDLESWTDEDLHPAFGEALL-QLDGHLAAIDTAPALAEALRSGGPLN..................... 148
353 6.000e-11UniRef50_A0A1F5QCY7 Uncharacterized protein n=1 Tax=Candidatus Doudnabacteria bacterium RIFCSPLOWO2_02_FULL_48_13 TaxID=1817845 RepID=A0A1F5QCY7_9BAC  ali  21  8..EEDIFLKFKSYFKKMSFKNKHKTWWKSKDQFILVFDFQKSKWTDEYYINVGLVFQD--DLKVPKTSKADIMWRLQRQGVDRHRDQFNIASDSDN-------IISILQKEVFDIFDSLNTLEQVKNKILENRDKYIITAKGKATL........... 142
354 6.000e-11UniRef50_A0A209DQH9 Uncharacterized protein n=2 Tax=Saccharibacillus TaxID=456492 RepID=A0A209DQH9_9BACL  ali  15  1MDKKLIADKLESLLKKEGFRKTKSTFYRMALDRIEFVHLNKLASGPYFRVQVGIRFLCDPFPVVALEG-------ISSDDQPAYRIRLAYTREQESLDRCAEAILEYVQEQGLPWLERWSSQEALI............................... 127
355 7.000e-11UniRef50_K4IGY3 Uncharacterized protein n=5 Tax=Psychroflexus TaxID=83612 RepID=K4IGY3_PSYTT  ali  18  8..KKMNTEILAPLLKEAGFSNDGDIWWKSTEEFSLVLTLQNYWWSTDFRINLGLMIPPIHEKKRPEITELAVCVSQDCYLPESIQFHKYKNSNGDNVKEFLELIQRDFEKFIMPQLLKQKTLEDCVDFYKDVPFWN..................... 153
356 7.000e-11UniRef50_A0A0Z8GMD5 Uncharacterized protein n=11 Tax=Streptococcus suis TaxID=1307 RepID=A0A0Z8GMD5_STRSU  ali  19  1MELKEFKNIIYDILKKNGFKYIKSKYCFENDELLVFIEFQKSNFSNAYYINYYFVVKDHKRIEKLTIKVRDFGARFAYYNYEGELVNNEFELEEISKENLTFSIQKELDEEVFSAFNKYLSYRPIMKKMSSKATKKYLEEQTKYL............ 150
357 7.000e-11UniRef50_A0A2V5LG15 Uncharacterized protein n=1 Tax=Arthrobacter livingstonensis TaxID=670078 RepID=A0A2V5LG15_9MICC  ali  16  9..RDMLKSQIGPMIREHGFRGTAPTWIRSAYGDYGSVNFQSSSETTHFYINLGYTPQAWFDFQKPKRGYEFLKDRYTDDEPRALENQRWSITDHESAIETARRVTDRLNQVGLPQINSWLDPSNRIKQLTTFNS-----DLARVLILTDCGELDDAI 173
358 8.000e-11UniRef50_E5WXH9 Uncharacterized protein n=29 Tax=root TaxID=1 RepID=E5WXH9_9BACE  ali  10  21.......ERIAEPLIPLGYKKSRNDIIKKGSPFTFGFDFQPSIRFSSICFHARFFVESQWRKRKYNEDDCIIIDTITRLTRQNNDWKDYWVDTFMERERVIKEISDQINQYALPFFERFSNLEQLIEDVERDGFLPHRKKIEKY............. 166
359 8.000e-11UniRef50_A0A221NIX5 Uncharacterized protein n=1 Tax=Arthrobacter sp. YN TaxID=2020486 RepID=A0A221NIX5_9MICC  ali  16  387MD-AIIRSQFAPILKARGFKPTGRTFRRVSSDRVDVVAI-GSFGMNQFAWSYGTRFVTTWPP------------REPADINEAGLDIRLVEESGISPTDVRLA-ADKLDGTILPFLDSLGSYE-LVRAYVEHNTGAPAESRCIA............. 514
360 8.000e-11UniRef50_UPI000361FC10 DUF4304 domain-containing protein n=1 Tax=Paenibacillus massiliensis TaxID=225917 RepID=UPI000361FC10  ali  17  1MNTRYIRD----FLVGHDFRLHNPDFYREKDGFVQCINFQRKSSGDVFFINLGVHPVFRKDPHPRQEMDCYIRHRLQM--------DRELQVAWLHDEDTCGQIIEEITDKAWRFFDFFGSFAQVIEAIESGRVPEPLQQVTKVRLAMLMGYHE... 152
361 8.000e-11UniRef50_UPI0009DBE587 DUF4304 domain-containing protein n=1 Tax=Dorea sp. AGR2135 TaxID=1280669 RepID=UPI0009DBE587  ali  17  24...KELLKYLYAILKPLGYRKEASDYRVFRPDLARIVNIQRNKNNCMFTINIGVYFEKSDMISKFKEYDCQIRKRV-----KPEENEEWWIIENDTDMEVLKENLQTVLGHIEKWFDNFISKEETIHRILDK......................... 154
362 9.000e-11UniRef50_A8PKE9 Uncharacterized protein n=2 Tax=Rickettsiella grylli TaxID=59196 RepID=A8PKE9_9COXI  ali  21  9.....LMKLMRPFMKQQGFTSRGNNYYKRHPGNIGIINFQRNREGPKFTMNIGIYFNQKQIREYPLLGEYHWQARIGDVVPNGDDKWWHYD-DKTDVDALFHEISELIAEFAIPAIDKHITDGQLKEYWLE.......................... 159
363 9.000e-11UniRef50_A0A291A5Y1 Uncharacterized protein n=1 Tax=Lysobacter capsici TaxID=435897 RepID=A0A291A5Y1_9GAMM  ali  13  28...AVIDHRLANELKKRGFRKKGFVFTRRHGDTGQVVRLELSSWSGMFSVWASVMFDDIMRI-WGREPPSMPGVHDGQFFADGSPPTWEVDRHTDIAK-MSELLCGFVVDGVLSRLDGVKTLSD----FEETGWVPVMHWRFPAIYAYAMGRMDEA. 184
364 9.000e-11UniRef50_A0A198AKV4 Uncharacterized protein n=1 Tax=Paenibacillus sp. 1ZS3-15 TaxID=1850517 RepID=A0A198AKV4_9BACL  ali  15  16...KEIIVDVYEALKPLGFRKKGLNLVRIDGCMYQKMNFQKHTYSPLMTLNVTFRPLFLKNTE---DNTLESSKRLCFFESDLH-NWYEIQL---NYKETSNKIIKLIIDKVLPYYDGLNTSKLVLEKLSELPS----YLHQQLILFSALKEHDSEI 159
365 1.000e-10UniRef50_UPI000830D616 DUF4304 domain-containing protein n=1 Tax=Mucilaginibacter sp. L294 TaxID=1643920 RepID=UPI000830D616  ali  21  14MD-EAIKNIVIPFLRAEGFKGSYPHFTRVKHDRINLLTFQFSLYSSKFVVEIAIVTGKQIEPSKCRVHYEGKRLRIGSI-KNKTDYWFDFNKESNIYKKRAKEIIALW................................................. 129
366 1.000e-10UniRef50_A0A164BLZ7 Uncharacterized protein n=2 Tax=Microbacterium sp. TNHR37B TaxID=1775956 RepID=A0A164BLZ7_9MICO  ali  12  14.......RVITPELKPRGYRKKRWEWTRVTGDVVHGISPQRSHGNSRIYVNVSAYSAEFARTIGSAVPDDLTRATPQYVTRFEDVITWWIDVEEWTDDALDDAFATALRE-LDAHLSRVVDGASLAAVLRESDAPLDTTLLAWWCATGDAQHVEDA. 172
367 1.000e-10UniRef50_K9E4J0 Uncharacterized protein n=1 Tax=Bacteroides oleiciplenus YIT 12058 TaxID=742727 RepID=K9E4J0_9BACE  ali  19  3..............KSYGFKSAFGGCYKESSECIFVLQLQKSNFGDYYELNIKTYIQGTFGKKYAPDKDTIKKYMGNVFDRQPKEYCSLFNFDTTMSDEDRMQLKKFFDDFVIPYEEKALSVSGVRELADEGRIFLIST.................. 128
368 1.000e-10UniRef50_A0A148N5H8 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A148N5H8_9GAMM  ali  13  9..NKYIKQLLLTVVDKDGFAYKPKVFMRVKGPFVDTISFQVSQYGDKCF--HIHYYKNLIAYPFLDINSYTVGNRLSDNRLNGDETEW-CGFEEEQAKLAIESVINAYNKTIRPWFSAVSTIPEYIFEIVSQHNNKGFSSLESAIAFAEGGKRNRA. 160
369 1.000e-10UniRef50_F0FEG0 Uncharacterized protein n=14 Tax=Streptococcus TaxID=1301 RepID=F0FEG0_STRSA  ali  24  1MNKTEFKKIVGEILKSHSFAYENKYYTFENTDLKVFIGFQKSNFENSFYINYGFLIKGIYDGKLPLYKQGDFGGRFVY------QNLDSYNLEKITSESLVASINSNIKMLIQPAFD-----DGLANYFELYPHFKFLCKKRVKEYLG......... 139
370 1.000e-10UniRef50_A0A1G9EHW5 Uncharacterized protein n=2 Tax=Microbulbifer yueqingensis TaxID=658219 RepID=A0A1G9EHW5_9GAMM  ali  14  1.MIAVLKNRVVPRLRKSGFSGRFPHFRRYAGESVHLLTFQFDRRGGGFVVEVAACPAAGARMHWVTAHDVQHRLRLGADGP-GADHWSRYDFWRDPCHRVADELLPLLDGQA............................................. 123
371 1.000e-10UniRef50_A0A091AZD2 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A091AZD2_9GAMM  ali  14  7..RAEITRQLVPLLSDAGFTRTQPVFLRRHGDLVHVLSFAGSWSGGQFTLSFAAALLCDPFFQLHSLKVGHAHQR----GPEEPCVPWEGRTEASAAAAIASA-AGVVRDAALPWLDGVRDLRGYVFAYLANP-DNGIGDLALAVAMARAGEHNR.. 155
372 1.000e-10UniRef50_UPI0003FDD176 hypothetical protein n=1 Tax=Arthrobacter sp. 35W TaxID=1132441 RepID=UPI0003FDD176  ali  13  15........LVKHKMQALGFTTRANRFTMELAPDIHSVGLNTSRYSARGTWDIAVHHLEVARITYVPYMGAPVSRSIGYLMPAKKFMNWPLG-DFDGADHNAEDMVGAIREYGLPFMHSHATNETILEAINEKIGIPDNHIRDKPILLALMGRFDEA. 175
373 1.000e-10UniRef50_A0A2V3DM99 Uncharacterized protein n=2 Tax=Arthrobacter TaxID=1663 RepID=A0A2V3DM99_9MICC  ali  11........ALCDALVGAGFKKRAGIFTIVLDD--DVLGIYASRAGGPGELNMGVRIQDITGRKYSQYMPATVSEPLRYLVPIEHRMDWILTRENPENAAVIADILASLESYGLPYMRERATLEAMAQALVAKEGHRWQTVFRAPVALWLLNRNEEAL 174
374 1.000e-10UniRef50_A0A1F9ZR61 Uncharacterized protein n=2 Tax=Firmicutes bacterium GWF2_51_9 TaxID=1798011 RepID=A0A1F9ZR61_9FIRM  ali  22  1MDKAEFKNLCKKVFYENGFTKNKHGYFIENNDYLLAIFLQKSNYGMCYYVNVSYSVKGYNTPNITGEWDADFMGRFPFLDGNIRKLSSMLELDKFEVAEIEPYFLEAFREWIFPIFQ........................................ 121
375 1.000e-10UniRef50_A0A2M9EDS1 Uncharacterized protein n=1 Tax=Xanthomonadaceae bacterium NML95-0200 TaxID=2032577 RepID=A0A2M9EDS1_9GAMM  ali  23  16............................ISDGSILVINIQSSLYNGVFTVNLGRYLPDMAKEDKPKTHECHARIRIGKLLPGIETDYWWQVDELSNLDALAAELKEAVILHGLAWFESPDSM................................... 119
376 1.000e-10UniRef50_W4C8I8 Uncharacterized protein n=11 Tax=Paenibacillus TaxID=44249 RepID=W4C8I8_9BACL  ali  17  12..TQIIKQDVKPFFSAQGYRTKDLNFNKIEGQLSYKINIQKFKYNTHFYVNYNIHSEELAQYRPALSLGAHFYARINQIVPAAPER-YFLTPEVDVDKFTSDLLLHL--DQGLQFLYTLTDARAIIEYYMQRTALHLSEETFGFLL--DTGDTETA. 165
377 1.000e-10UniRef50_A0A2S6V5P2 Uncharacterized protein n=1 Tax=Chroococcidiopsis sp. TS-821 TaxID=1378066 RepID=A0A2S6V5P2_9CYAN  ali  15  8..NKIIRKILSPVLRDNGFVKTRNNW-ADRDPCIWVLNIRPHFPSVSVSVWLGIYYKDKDGKLIPKEWMCHVRKSLRSSTEASRNDIWWIEPDGSNLEDAIHDIKIAFLTQGIQWFNAYSDLESCIDFLAPDFLVEDIDETGRTVL........... 186
378 1.000e-10UniRef50_A0A2A4MZN8 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4MZN8_9GAMM  ali  12  4.MRELFKDEFIPSLKSDGFVRYGRKFIRRHDDYYQLISFLSSRWGDKFYVTVDIWIPELCKESKVIFDKTICSFNIGSGCSVRGGGTYQYKDEETETRALLKDILGGIRVYAFPWFALMSDRKYPVATFLSKNYNKSHMDLV............... 155
379 2.000e-10UniRef50_A0A2T0SIX7 Uncharacterized protein n=1 Tax=Pseudosporangium ferrugineum TaxID=439699 RepID=A0A2T0SIX7_9ACTN  ali  14  84....MMRSVVVPELRRLGFSGSGRRFTMRAGKHAGTIAFQQSRGNTWFTADVSVAGSGGT-------------ARLGSISHHGGDHWWWAGFPTG---DVAADLITAIRDHAVPAI......................................... 185
380 2.000e-10UniRef50_A0A285SJN7 Uncharacterized protein n=3 Tax=Lachnospiraceae TaxID=186803 RepID=A0A285SJN7_9FIRM  ali  20  34...KVQIKAFAEFLKQKGFVKKSNSFRRNQLEVLEYIDIQKERYGSKFTVNYALTSLYVPHSFF----SFDISERLGNLIC-GKDIWWDYSNELA-AEESFNNIIEAIDSFLLPWFAEKDNADAIKEMLLSEK........................ 160
381 2.000e-10UniRef50_C7PQM6 Uncharacterized protein n=1 Tax=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) TaxID=485918 RepID=C7PQM  ali  12  39MTKERLMDAITPELICNGFTRIQTEFHCSQKGYHGIISMQRNSNNYKFTLVIGVFFNDVVQFRSYRIHDAHWREELGPFILGNQRHCWVLNDDNISI--VADQVLEVLRKVGLPLLNKYMVEDHLLRAWKVKNGSEIME.................. 187
382 2.000e-10UniRef50_A0A1M7I1Z0 Uncharacterized protein n=2 Tax=Duganella sacchari TaxID=551987 RepID=A0A1M7I1Z0_9BURK  ali  11  56.................GFKKSGLRFSRKAGPFTQIVSFQADSSGHHVAVAMHAQVKSAALEKWRQINHGVWTTQAGYLGPAHTYLKWQL-VDAHTRADEIQSMIETVRGIVLPAFDACSSMESLSTHLLARPEITRFPDWALDIALW-VGNKQAA. 203
383 2.000e-10UniRef50_UPI000DD7A292 DUF4304 domain-containing protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DD7A292  ali  33  7.....VADAVSSLLKPLGFRRKSSSWYLENDETVLIVNVQRSQFGPQYYLNFSVVIRAISTVPQPKEYHGD...................................................................................... 72
384 2.000e-10UniRef50_A0A1H4KGL7 Uncharacterized protein n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A1H4KGL7_9BACL  ali  18  17.....LKNIVIPSLRDRDFKGTFPHFRRITEKKIDLLTFQFDKYGGGFFMEVAVCSPEGFTHHWVTAYDLHPNIRVRIGDKDDWFRYDKVNFFGNIYENVANKALKSLIE............................................... 129
385 2.000e-10UniRef50_A0A239AM47 Uncharacterized protein n=1 Tax=Dokdonia pacifica TaxID=1627892 RepID=A0A239AM47_9FLAO  ali  14  56..KECINEYFQPLIATQGFTGKDYKFYKEDDSKFYLINFFPDRNGGGTQVDLLVKVKGITYPPKHFKFNCEFSKRLSPI--NTSVWHWAFKSNKDDNKAVLEDIYRIILEKGIPYFKQFENLDTILSKITIGTFENLKYGIQ............... 200
386 2.000e-10UniRef50_K4IHZ3 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=K4IHZ3_PSYTT  ali  16  44....ELNKIIGANLKEYGFKKKGRKHYRLTNDLLEIIDIDNSWSGARDDIEIRIGLVPYCWQGLTTEHYLVGSKPIEEIDKTIRNH-FRISKEYLI---LADYISERIIKNILPYFEKYNSTKKITRQYKASHLTFDTYNSHLLILFAEIKQH.... 195
387 3.000e-10UniRef50_A0A2V9VXU8 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9VXU8_9BACT  ali  14  15..........................................RARKKFTVNVAIHFYDEPEDKSPLHYKCHWEVRLGQLIPGNGDCWWTLPGEPSYLP-VLAEVKELVVGRAVPIVKEHLTEERLLELWDQNGGFEYPTLKYKSILLGERGRFEE.. 133
388 3.000e-10UniRef50_UPI000DCB0119 hypothetical protein n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCB0119  ali  13  22...KAFTKSIADNLAPLGFRLNGRMIQRISQDVIQTIHIDTSWTGEHYTIAISI-MPYCNTIFIHDELSGIVN--IEEIVPNIRNHTRI----TLEHPLLADFITRQIVAYVLPYFEQYRSTLEIAQNLRQFPTGNFSKRNEAVVIFTALKNHNKAV 172
389 3.000e-10UniRef50_A0A0L6JMA5 Uncharacterized protein n=1 Tax=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 TaxID=398512 RepID=A0A0L6JMA5_9FIRM  ali  17  32...KKIINEVASGLKQYGFRKSNSTLERVNEYMIQILNFQRHTHLPTITINTAIRPLFINSTDDRILPLC---KRLDKFDSKESS-WYPIRRDTKTASG---ELLSIIINRVLPYFEHLDSPENIIEMLEAGEYTSP.................... 162
390 3.000e-10UniRef50_UPI0009E8AE96 DUF4304 domain-containing protein n=1 Tax=Komagataeibacter xylinus TaxID=28448 RepID=UPI0009E8AE96  ali  19  14MDR-ELKASVVPWLRQQGFRGSLTHFRRPGPDAIDLLTFQFDLRGGGYVLEVARCATQGYTMAWRKVTAWHIRERERITPEDTYLKAKWFRFDQHTPQELAAVTIEKLSDPAL............................................ 132
391 3.000e-10UniRef50_A0A2S8Z4W6 Uncharacterized protein n=3 Tax=Microbacteriaceae TaxID=85023 RepID=A0A2S8Z4W6_9MICO  ali  14  377...RMLDERVNGTMRELGFRKSGRTWRRWVDARVELVDFYSS--DLYMSVQYGVLFEGLHPEDGPAPQRDPKRVKPFELDLLVSETGWF------AEDEVLDLLAERVRTEIVPFLERCGDRTALFELLLHGVGLPP.................... 502
392 3.000e-10UniRef50_A0A150KLM0 Uncharacterized protein n=8 Tax=Bacillus TaxID=55087 RepID=A0A150KLM0_9BACI  ali  19  15.........LSPVLKEFGFSSNSRNYYALHNDCIWVLNIHHGWPAQSLNATVGIYYDFIPPENFPKYYECQLQMYDQIKDNKKLESIWWFHPNGSNIEDVVHDIRNAFVNTGLPWLKKYSNLERAFEKIE--GELNSYHKFYKAKFFAKY....... 180
393 3.000e-10UniRef50_A0A0V8I7Q6 Uncharacterized protein n=1 Tax=Arthrobacter enclensis TaxID=993070 RepID=A0A0V8I7Q6_9MICC  ali  25  2....................................INLQKSPWGGSFYLNLG-WDPAVASGEFRSENSCVFGLRIPSIDFVRPDGLAARDLPGIIEDSFVKQLIDVIVVPIADFMDRTPALQDLVPLLTEKPHLAFIP.................. 121
394 4.000e-10UniRef50_A0A2E2BX07 Uncharacterized protein n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E2BX07_9PLAN  ali  25  1................................MIAVLNLQKSQYGAIYFLNIGFWLQQIEHNDFPRAHQCHVRERASSLWPEGTHRLDLLNIDEYDDTQRLDQLRLFIADKLIPVLKTGVTLEGLNQLLAEHDGFLIMRTARNALGLA......... 126
395 4.000e-10UniRef50_UPI0009B7E34E DUF4304 domain-containing protein n=2 Tax=Rhizobium TaxID=379 RepID=UPI0009B7E34E  ali  11  29..NAAIKSDVLSKLRNLGFSGSFPHLRRIGDEVVDLVTFQFDRHRGALTIEIAKCSLSGIDGPLAHHRHPIYRKRLGDHSRSPGGSDNWFSYADRGAASVADAILTRLLD............................................... 145
396 4.000e-10UniRef50_UPI000DD5221F DUF4304 domain-containing protein n=2 Tax=Micromonospora saelicesensis TaxID=285676 RepID=UPI000DD5221F  ali  14  50....VVVREIGRILAEYGFSAAGREFRLRSPGDWLVVDVQTSDASNRFYVNAGFLMSAKWDWSRPSVADCLWSTRFDPRFGDTSMRWMV--DSEATLTAVVDELEHVLHREI-PVLVRLLDRCHLHCIADQEVGLGYATWQVKAWLLAEAGR..... 208
397 4.000e-10UniRef50_UPI0005682B62 DUF4304 domain-containing protein n=1 Tax=Promicromonosporaceae bacterium W15 TaxID=1214064 RepID=UPI0005682B62  ali  13  246....ILRDHVAPGLRRLGLKGSGQAYTLPDGDHFAQIGIQKNRYSTEFTLNLSVVRKADWDEPWRCEIEGAWSARIGELLPGGVDRWWTVARDAD.............................................................. 354
398 4.000e-10UniRef50_C2M497 Uncharacterized protein n=8 Tax=Capnocytophaga TaxID=1016 RepID=C2M497_CAPGI  ali  16  13....EMVKELYQILKPLGFKKKALHFYRVVEQSLQMISIQKGAYGSADEIYFTANIKKAPYKEPISFYPDDNTQRIGNIKGNG-DIWYEFSGRKQKIKENREAFLTDIQQIVLPYLS........................................ 131
399 4.000e-10UniRef50_A0A191WGQ5 Uncharacterized protein n=1 Tax=Agromyces aureus TaxID=453304 RepID=A0A191WGQ5_9MICO  ali  13  9..KALLREELAPRLRAEGLTGTERSFTVPSREFFAQLGIQSSVSSTKFTVNAQVIRKASWEAARQDRVEGSWDERVG-LLMGTTDRWWTLGANGANRGEIASDVIHAVIDFALP........................................... 137
400 4.000e-10UniRef50_A0A2N5M3F8 Uncharacterized protein n=1 Tax=Bacillus deserti TaxID=673318 RepID=A0A2N5M3F8_9BACI  ali  18  11....ALEERVVPVLKAKGFQGSFPHFRRILSREIHLLSFQFDRCGGGFVIEAASCPLKGHTHAWGEYHDLHPDERI----RLQDGKWFRYD-ESCTCEEIASEVLHRLSE............................................... 119
401 4.000e-10UniRef50_A0A2K3IUW4 Uncharacterized protein (Fragment) n=1 Tax=Thermoplasmata archaeon M8B2D TaxID=1933278 RepID=A0A2K3IUW4_9EURY  ali  15  24...KIIREYIFPSFEKYGFKKSGLTIKKTENDFVYEINVYKNHRNCAFTMYASVQSSFYQKWYKKTYNSSIISYIIQALPNSTFNSDIDFDLALYDNQCLIKLINENVDSSIIPFFNQVNSIEAALKLLREEEVL...................... 167
402 4.000e-10UniRef50_UPI000A3CE64A DUF4304 domain-containing protein n=1 Tax=Allokutzneria sp. NRRL B-24872 TaxID=1137961 RepID=UPI000A3CE64A  ali  20  7...ELVRSRVAPWLRQAGFRGSGGEFALPSESYWALLGFQKSVHSDRFTVNLLCVSKDTWASLYAAEPFLVPRARIGELTPSGEDKWWRLR.................................................................. 111
403 5.000e-10UniRef50_A0A2C3K164 Uncharacterized protein n=2 Tax=Bacillus TaxID=55087 RepID=A0A2C3K164_9BACI  ali  27  10MDIKEFKKFVDEVFLANGMKKRRSNYYFDNEDIISVLGLQKTSYSNGYYLNLSYVIKDLNTKEISNYTDGNIRLRF................................................................................. 85
404 5.000e-10UniRef50_UPI0009DE6C9C DUF4304 domain-containing protein n=1 Tax=Sphingomonas sp. 35-24ZXX TaxID=1545915 RepID=UPI0009DE6C9C  ali  14  18............ELKAQGFTKRNRVFRRERVGYVEAIDIQGSSWNWHFYIYVHVHLPDVALSNLSAITRYHASGRIDGLVTNAPGG---FELTAANFDQLVSDVGALVNE............................................... 117
405 6.000e-10UniRef50_A0A1Y4LE46 Uncharacterized protein n=1 Tax=Pseudoflavonifractor sp. An184 TaxID=1965576 RepID=A0A1Y4LE46_9FIRM  ali  29  1MNKKEFQKLCRDIFKRNGFLARGNNFYFDYGSLLLIFGLQHSDFGSYYYIEHGVANKENPYMPWPKYYQIDRRGRIAFQLNKSGDPQAIF-YESDFDEGRFIDILE................................................... 107
406 7.000e-10UniRef50_A0A1Q6Q284 Uncharacterized protein n=1 Tax=Faecalibacterium sp. CAG:74_58_120 TaxID=1897005 RepID=A0A1Q6Q284_9FIRM  ali  18  1MNKNDFLLAVHEYLKALGYRKNKSYWFLSNGELVYCVYVQSSQWDNDYYVEVGIAIEEIVGP-KPSVTRWYVRKR--------------CEDESQNDRNISLSVLK----QAIDFFSDILTVNDLTLYLERTPH....................... 116
407 7.000e-10UniRef50_UPI0007AC00F9 DUF4304 domain-containing protein n=1 Tax=Bacillus niacini TaxID=86668 RepID=UPI0007AC00F9  ali  22  8..............KEYGYRKKGNSFWKIENGFYKLINIQKSNNGDYFFINLGIHPVGLPQLEKPPESGCIFRKRIEQVAPSLTN-----SFKEMMSKGLTTKITDEILTSI-PYVEEW...................................... 114
408 7.000e-10UniRef50_A0A1D8P443 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1D8P443_9FLAO  ali  24  40MTNKEIQKLVHSELKADGFKKKGRTHNKIENGIIQVVNFQMAKYYGNFAVNIGVFVPELYESTFKQEYDCEIRERIND-KASGKEYWFSLGADYPTAEFIIGKLKSDVKKVV............................................. 182
409 7.000e-10UniRef50_A0A2D8SRH4 Uncharacterized protein n=1 Tax=Owenweeksia sp. TaxID=2024847 RepID=A0A2D8SRH4_9FLAO  ali  21  11MD-QALKELFVPKLRLLGFKGSYPHFRRYNENSIDIIGIQFSQWGASFYIEIGVIYPKHYPPKTIKFYQAKNRIRIGNNPFHYESCEYHKAADQAID............................................................ 114
410 9.000e-10UniRef50_A0A0Q9SWK5 Uncharacterized protein n=1 Tax=Paenibacillus sp. Soil787 TaxID=1736411 RepID=A0A0Q9SWK5_9BACL  ali  16  3.DTKKIKQLIKHNMKEKGFKFQNPTLYKLNGNFVQILDFTV--QPKHFYCNYALQPLYVPATTFVLSCGSRVRK-------QGKDLWD-IGDSEISLEQSVTELKKNLDAEISPWFEEKGSMEGLVSFIETDSKFVGFPPHLRYIYLGSLEQYDKA. 160
411 9.000e-10UniRef50_A0A2G6RVC9 Uncharacterized protein DUF4304 n=2 Tax=Janthinobacterium TaxID=29580 RepID=A0A2G6RVC9_9BURK  ali  11  11.....IEAFLLEPLTAAGFKFSQLTFKRARNEFVQTIHFQANRHNEEFWSHYQVSSRSYASWHKARYGHEPANHIVGAVADWNIPNWQCASVDGEAHHQLVDCLRHNLHTLALPWLERLSNWEAALSLVEAQDAHARACDF-----YLMAGLQEKAL 174
412 9.000e-10UniRef50_A0A2L0F820 Uncharacterized protein n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A2L0F820_SORCE  ali  14  32..KRLISRIVGPRLAELGFNNPGRAMWRFRPYFVDVVWFRCPRAG-IFQVEFGCGLR-RAVPNNPAPWDCQFRTQPGHSFNW-EDTFWSFRRSESEQVEVLRLLAARVAAAAERWFSHFNTIDSAISALENNQRSGPQ................... 164
413 1.000e-09UniRef50_A0A1I2V332 Uncharacterized protein n=1 Tax=Desulfotomaculum arcticum TaxID=341036 RepID=A0A1I2V332_9FIRM  ali  12  8MTEAII-DWVVPFLKDRGFSGFFPNYRRMRSCCLELISFQFSCCDQSFCVNIGKCPPEFVGPSAVTALHCPVRFYLG-VQNDDSCHWFKYNPRKQELKLIADDIVALIVNQADSW.......................................... 147
414 1.000e-09UniRef50_A0A2C0MLJ0 Uncharacterized protein n=1 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2C0MLJ0_BACME  ali  15  12.....LRKNVIPIMRNRGFKGSFPHFYRQLEDRVDLLMFQFSAWGGVLYIEASKCSPEFYEPNKVKVYHIDVEHRQ----RLGKDLYGMFEFNKDNTELISFAVRNALKE............................................... 120
415 1.000e-09UniRef50_A0A1H1BWT3 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1H1BWT3_9ACTN  ali  13  2....................GSGQIYRLPDERNWPLLGFQKSMFNTSFTINLSVVSKELWEQRRSFYGPWMWHRRIGHLLPAGDDHWWEVG--TAPDPAIVSEVVEAVRDLALPAMRR....................................... 113
416 1.000e-09UniRef50_A0A062VAX4 Uncharacterized protein n=2 Tax=Hyphomonas polymorpha TaxID=74319 RepID=A0A062VAX4_9RHOB  ali  24  1MDKA-LKQLVVPLLRTLGFQGSYPHFRRMQNEQIDLLSFSFSRFGGEFSAELAICPVDGFRYH.............................................................................................. 62
417 1.000e-09UniRef50_A0A1F8S0X0 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_69_14 TaxID=1797661 RepID=A0A1F8S0X0_9CHLR  ali  12  16.........LGKLLEPIGYRRSRLTFTVTVPAVVRTIKIEKYRWNVRFQLILGIYLATGEVGEFASRYSIVFLQNAGVLWGDPTQLWQ---VPTALTQDAFDPIRADVETRILPFLERCDSVDAVIRALDEAEAQVGWRPYSLAIALARLGRVDEA. 171
418 1.000e-09UniRef50_K0AB93 Uncharacterized protein n=4 Tax=Exiguobacterium TaxID=33986 RepID=K0AB93_EXIAB  ali  14  11MMTQAIKKMIVPELRKQGFKGSYPHFRRKQDTNQELLMFYITKYSENFYIETGVIP..................................................................................................... 66
419 1.000e-09UniRef50_A0A1M5ZU83 Uncharacterized protein n=2 Tax=Butyrivibrio fibrisolvens TaxID=831 RepID=A0A1M5ZU83_BUTFI  ali  12  1MTPSEMNKALTSLLIDNGFKKKRGVFWRKVNNCEQYFSFSYTRDRGLPGTNYSMYPTLSFRYQKVDELHCLFMRRFGTLVPRSDSFRYKYSSKNPMNDH-AELIYKDFADYALPFFDKYDSLDKVEAYFDKNRIRHNAYGCCIAAVLCANGKLEK.. 183
420 1.000e-09UniRef50_A0AFT1 Uncharacterized protein n=1 Tax=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) TaxID=386043 RepID=A0AFT1_L  ali  13  1MDRKEFSKRIAESLREHGFKKSNNAIIKKDSQFTYKISFQPSKYGSTFLVNISVESDRLAQWRRNEYQGMVVATSLARLTKMKNEWPRYEIATFTERERVILEITNIINDYAIPFFEQFNDINLLVKKVEKFGFLPHL................... 160
421 1.000e-09UniRef50_A0A1C0YBM9 Uncharacterized protein n=1 Tax=Caryophanon tenue TaxID=33978 RepID=A0A1C0YBM9_9BACL  ali  21  3...AALQRIVVPSLRADGFTGTFPHFRKMTGYPIDSFSFQFDRYGGGFVVEGAVCSTAGVMHEWGEHIPPHVSERLR--LNEKSGQWFRYDLAETMA............................................................ 100
422 1.000e-09UniRef50_UPI0009B69E6E DUF4304 domain-containing protein n=1 Tax=Methylobacterium TaxID=407 RepID=UPI0009B69E6E  ali  16  3..............................NGNCGIINFRKSQSSSIFTINIGVLYDSDCRLTKADVWDAHLRERIGLILADRHDKWWEITPET-NAGLMFSQNIDVACERAADYVNKHLTIETIVDLWESGKSPG-LTDHQRIKYLSVVKNKIKS. 135
423 1.000e-09UniRef50_A0A2E7KE96 Uncharacterized protein n=1 Tax=Gimesia sp. TaxID=2024833 RepID=A0A2E7KE96_9PLAN  ali  15  16MTPKHFRQLFANVLSDYGFKSRFCTFYRQHDEVFHFVLPDLGTRGTWFDVKVFPASPFPDDVGIPTDSFSYLSARGVGLDQEK----FNCKTEENLRRRFELSVRSALEERAIPYLDHFRSLDDIIPVLR--------TPVFRGVGLHCVGKMDEAI 177
424 1.000e-09UniRef50_A0A2G2E4H9 Uncharacterized protein n=1 Tax=Fluviicola sp. TaxID=1917219 RepID=A0A2G2E4H9_9FLAO  ali  12  25..RKVVECYIFPDLEKLGFKKSTLSITRKVGDFKQEIHFQKNKYN---QGNETVGFSLIFNISFPKYMKWHLKNRNDGIAGWGMKGWRWYDLAAENNIKMIKAVKHNILNVGLDYFDSYSTKEKAIETLDSGSHQARCPLLFDLALILNNKDLGETI 194
425 1.000e-09UniRef50_A0A1A2E3B8 Uncharacterized protein n=3 Tax=Mycobacterium TaxID=1763 RepID=A0A1A2E3B8_9MYCO  ali  1....MVSADVGPFRRARGFGISDCSFKRERGPLYDMIHLQPDWHNGTFFVNVGIGSVERYERVRHPLKGSLLQRRWEHLVPDLP---YEVRFDRRTEMRQFAGALCDGFDLVLVELERISTTEQLVRYAVDNNLLIEYDKTCRYLAAT......... 152
426 2.000e-09UniRef50_A0A1H7RB53 Uncharacterized protein n=1 Tax=Roseateles sp. YR242 TaxID=1855305 RepID=A0A1H7RB53_9BURK  ali  15  4.NKSLAQKAISLLLKPHGFEKHGSVWALDLGDTLLGVHLQGSRFGRAYVNFLAWYKALSTQPLTSFKDDFHLSFRGDDVHQDDIQAALTFDDSEVEFDTYVARLNELFFSKSLQKLLSLSTLEAAIAAVRADEMRGYSLEL................ 145
427 2.000e-09UniRef50_UPI000829567A DUF4304 domain-containing protein n=1 Tax=Isoptericola dokdonensis TaxID=372663 RepID=UPI000829567A  ali  15  1................MGLRGSGQTYTLPSDTCWAQLGIQRSTWSDRFTANLSVISRAAWVSAVEERPHGRFQERIGRVAG-GGDYWWRLSADGRDEASTCSDFLAMIETHGLPALRH....................................... 119
428 2.000e-09UniRef50_A0A142HRR1 Uncharacterized protein n=1 Tax=Mucilaginibacter sp. PAMC 26640 TaxID=1300914 RepID=A0A142HRR1_9SPHI  ali  15  10.MEEALKSIVIPFLRSQGFKGTFPHFRRVADDRINLLTFQFSSSSSKFTVEIANCHLGWGEDIKPTNCTAHHINRRHRLGSLKGDHWFDFSILLNIYKQRAHEIISLW................................................. 124
429 2.000e-09UniRef50_A0A147EWG7 Uncharacterized protein n=4 Tax=Microbacterium testaceum TaxID=2033 RepID=A0A147EWG7_MICTE  ali  16  14........AIGGVLKRHGFRKKRYVWTRVGDGIVHEIDVQRSHGNSRFYVNARAYVAEFDRAIGRTLPDDPTRANAQRFEEVSDWPTDRVDVERD-ADALGTALPAAI-EQVVAHLDGITDAPSLARTLRESGFVLDDDLFAWYCA---TGRTDDA. 163
430 2.000e-09UniRef50_B7GLY1 Uncharacterized protein n=17 Tax=Bacillaceae TaxID=186817 RepID=B7GLY1_ANOFW  ali  17  27....ALKKIVVPELRNRGFKGAFPHFRKQEGQLGYLLSFQFDKWGGGFIIEAGVVVVDGIVRPFQKMNAFHLNNRFRIMNNKNGDKDW-FKFDNENENLEEAEFIR-MAKNVLPYLD........................................ 145
431 2.000e-09UniRef50_UPI000DD3169B DUF4304 domain-containing protein n=1 Tax=Piscinibacter caeni TaxID=1861917 RepID=UPI000DD3169B  ali  12  8.MEESIKRIVVPELRRAKFTGSFPHFRRIRDSTADLLTFQFYSSGGSFVVELGRITQEQVESHPRNVYDGHPRHRLAA-SAVGGDHWFKFGKRNYEPDRVAQEVVALFGREAEEWF......................................... 141
432 2.000e-09UniRef50_UPI000D74C67D hypothetical protein n=1 Tax=Nocardioides solisilvae TaxID=1542435 RepID=UPI000D74C67D  ali  16  395....LLRSHLLPTLRAAGFEGGGRTWRRPHDDRVDLVHLGSSR--DALSLVYGVRFDAAHPSDRPRGVD-----RSRILAHH---LDVSLDERWTAAPDDLDRCADHLRRRVLPFLDTF...................................... 499
433 2.000e-09UniRef50_A0A1G2SG72 Uncharacterized protein n=1 Tax=Candidatus Yonathbacteria bacterium RIFCSPLOWO2_01_FULL_47_33b TaxID=1802727 RepID=A0A1G2SG72_9BA  ali  20  1.MIRTLKSNVVPSIKKLGFSGNFPHFRKKKSDRFEFISFQFSRYGGKFVAECGFTLPFEKEAGFEKLNHGNARSRL-RIGAVGVNEEYWFEYEKFENEAQFEKLAQSI-NRLLPQAEMFL..................................... 122
434 2.000e-09UniRef50_A0A117DT14 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A117DT14_9RALS  ali  13  1MDKKELREQFFPCLTNAGFKRNGDIARRELGGVVHVVEIQHRARGHVFQVKLGAHLLALGDPQAFRDFDCAWRGSIISGFRNDSDAEFAYGATEQDATESVAFLVSEWPRQSDAFFAPFAAYPRTFHVAANAELHHPAHLLTWARVAHILGDSL... 172
435 2.000e-09UniRef50_A0A1N7JC15 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1N7JC15_9FLAO  ali  20  44....ELNKIIGINLKEYGFKKKGRKHYRLTNDLLEVIDIDNSWSGAKDDIEIRIGLVPYCWEGLTNEYYLIGSKKIEEID-KTIRKHFRISKEYLI---LADYLSEKLIVNALPFFDKYNSTKKITSKFYSKCGGNDIYKSQFLILFSELKQHNKAI 201
436 3.000e-09UniRef50_A0A1H8ZY60 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium RM5 TaxID=1200721 RepID=A0A1H8ZY60_9FIRM  ali  10..NSEIKNTIVPDLRKEGFKGSFPHFRMMEDDRVDYISFRFNKWGGSFIVEMAVAYPYLGKEGNFYYWDSNYGYTKERLRIKPHNGDW-FEYNDNNYEEVVECARKLISEN-LSYFEKV...................................... 134
437 3.000e-09UniRef50_G2RLB1 Uncharacterized protein n=8 Tax=Bacillales TaxID=1385 RepID=G2RLB1_BACMW  ali  17  12.....LRKNVIPIMRNRGFKGSFPHFYRQLEDRVDLLMFQFSAWGGVLYIKLSKCSPEFHKPNKIKVYDIDIEHRQ----RLGKDSYEMFEFNKENTELISLGVRDALKE............................................... 120
438 3.000e-09UniRef50_A0A212DMJ7 Uncharacterized protein n=1 Tax=Mesorhizobium amorphae CCBAU 01583 TaxID=1449348 RepID=A0A212DMJ7_9RHIZ  ali  28  2....................................LNLQKSSWGPQFYINAAVWFTRLGPERRPKEYNCHIRWRVDSQMEDSQSKTFSLNLEYPLPDDRLSLIKHGVDTYGFGLLARCESERAALQVADE.......................... 99
439 3.000e-09UniRef50_UPI00040AB5DD hypothetical protein n=1 Tax=Arthrobacter sp. 35W TaxID=1132441 RepID=UPI00040AB5DD  ali  12  10........LVKAPMLALGFRKRGLIFTMEAPGFLGWVSIYMSEPRWAGQPNIAVRHQEVSRIEYHPYHVPQIGNPLRYLTPHRGNPLQWEMGTFPGADLNAQDMVDAIRDYGLPFIRKYATNEAMLSAMAQNLVLNGVSSRSKPVLLALMGRFNEA. 172
440 3.000e-09UniRef50_A0A1Y4VA56 Uncharacterized protein n=1 Tax=Eubacterium sp. An11 TaxID=1965542 RepID=A0A1Y4VA56_9FIRM  ali  27  1MDSSEFRRIFKECMIENGFAFRKNKCYLLSEKLIAIIQTQKSNFSNGFYINYGFLVKEHKNMDCSNICLCDVVGRFTINDKD------EYELSSLTSEMLIESLKTNVNDIIFP........................................... 109
441 4.000e-09UniRef50_A0A0B4XD65 Uncharacterized protein n=6 Tax=Rhizobium TaxID=379 RepID=A0A0B4XD65_9RHIZ  ali  15  26...KLLTKEVDDILLPLGFVRQGVRWHRTGWFATTFVEIQKSRYGNACFINFGRDARVADWRAPSYRDNTHWRIASLAHRDAACRLDQLPYAELDGVSDLRLEVVCLLRNGAAPFLEQFGSLLRPRRSVEDELRRRPAAVFRRVLSALLFGRDD... 180
442 4.000e-09UniRef50_A0A2N0C508 Uncharacterized protein n=1 Tax=Leptospira sp. ATI2-C-A1 TaxID=2023202 RepID=A0A2N0C508_9LEPT  ali  16  1MGAKEFKNHLSPKLKEMGWNGDGFNFYKTTNNIIQIFGIYGSWIGGTIYCETAIHFNLIPDPAKIRFNNCLIRERLTRNGFGSSG--WKLKEKVEDNISSILQIQNSFEKFGLEFYKEFENFPKPFDSINPEDTKRNLKVLEKYYIHNEI....... 160
443 4.000e-09UniRef50_A0A2V1K3B6 Uncharacterized protein n=1 Tax=Bordetella sp. 3d-2-2 TaxID=2175229 RepID=A0A2V1K3B6_9BORD  ali  14  11....ALKAVFIPALRQRGFKGSLPHFYRNTPARADFVSIQFYSAGGSFVVEIACCPPDGPASRLNTTYFGTGRIRTQEADKQAGEQWFSFGPRSYEPDQVAASLLPLLDTQAENW.......................................... 141
444 5.000e-09UniRef50_A0A1Q4XRR1 Uncharacterized protein n=1 Tax=Saccharothrix sp. CB00851 TaxID=1835005 RepID=A0A1Q4XRR1_9PSEU  ali  10  15..KKEVLAACTAGLRELGFTKQDGKLILDRGDGWLGLNLATFALPASLMVNVGVRFASVEDIDIPRTPMPVVSRPLGYLMPERTFRTWEFQRDGNI-EQVAASLVSAVKQYGIPYIDTYADWRVFCHSVE---LPGFLLPHEKAKVIALNKQLDEA. 179
445 5.000e-09UniRef50_UPI00083AE3D4 hypothetical protein n=1 Tax=Porphyromonadaceae bacterium H1 TaxID=1658779 RepID=UPI00083AE3D4  ali  15  3..............KGMGFKLKKYNFYKPISEMAHAFGMATHTDKGHIYVDIGVFHKDVEELLNFDIMQPTIGTQIGYLMPGNSYKEWDF-IENKDNSHLYDDILTNIQTYGFAYQEKMKDFDKLLEAFEKREIFNSARDRCLPILYYLKGDKQKGL 158
446 6.000e-09UniRef50_A0A0R0CLB3 Uncharacterized protein n=1 Tax=Stenotrophomonas terrae TaxID=405446 RepID=A0A0R0CLB3_9GAMM  ali  16  7MMAISIKKVLLPEMRRLGFVGGGANFARSSGDHRDFLSIQYWTYGGSFILEFSVDPDSGEVPKRVFETDPLLRKRLIDAEQHKDFRGFTFGGEQSRYDQLAASVVALLP-QVEAWLES....................................... 133
447 6.000e-09UniRef50_A0A1M5QWU9 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1M5QWU9_9ACTN  ali  13  269...ALLRRHLAATLRRHGFRGSGRTWRRLHDDRVDVVSPGSS--GDELAVAYGTRFDAAHPES---EPHPVERARDHHLDIRLIEYWGTSGSD-------LDRLARHLDVVVVPFLDTLGRYELTRSFLEHR......................... 387
448 6.000e-09UniRef50_A0A2A6DYQ5 Uncharacterized protein n=1 Tax=Paenibacillaceae bacterium JTherm TaxID=1906605 RepID=A0A2A6DYQ5_9BACL  ali  14  9......KNFVAPLLKQHGFLMKQGEFIYKTDSVSRIIAVTPYRFNENFIIEYGVHRSTIPTIDRPKLYHCQIKT----YVRDKKGHGMLFNA-GKWIPKRQDELKSILLN-VVAQTEDWSDPRKFISMILNDDPLIPYGPLYKKVLLIYLGEREKAL 164
449 6.000e-09UniRef50_A0A0J6I6U5 Uncharacterized protein n=1 Tax=Pseudomonas helleri TaxID=1608996 RepID=A0A0J6I6U5_9PSED  ali  20  1MT--AISKIFGTVSKQLGFKGCGSTLFIEYESYFLTVNLQKSSHGEGFYINVAITYKQLLDSSTTTYKKCHVDFRAENIPQAPYTQNDFDKLASHKDSNTIKDCLQKALEAVIDFTHKNHDRSTIRKLKEANIFPAIIMK................. 150
450 6.000e-09UniRef50_A0A2A5FW29 Uncharacterized protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5FW29_9FLAO  ali  13  16...KVIFDKVKPPLEELGFKKSEPSFKRSVNNFIQEISFSTSKWNETFDLYIEVVSKEYDEWCKLNYPDQVNGNRIFGFRPQNSHFWDWYNLAEHDNKDLIESLLNDLHTIAIPLMDEWSSAAKLLRAYQDWTVLPLIMD................. 179
451 7.000e-09UniRef50_UPI000A067022 DUF4304 domain-containing protein n=2 Tax=Nocardia TaxID=1817 RepID=UPI000A067022  ali  23  61...KSLMRDVGAALRPMGFRGSGGLWRLVTAEGAAVVQKQGSHGSSWFYINTSVVPRAWWEWKKASEADG-IRILEGRVTSAGGADRWHVT-DGTDVDRLRSDLLAAV................................................. 175
452 7.000e-09UniRef50_UPI000DE910E4 hypothetical protein n=1 Tax=Bacillus taeanensis TaxID=273032 RepID=UPI000DE910E4  ali  14  8...QLVQTDFPSLLSERGFIKKGDLFYRSSKEIGWVVEITPSIKEMEFMLETSVFLPAIYEIVMNQETGDILYKSIADLKGNKKHMKYRLNELYVDLPKLIKTVEEDIDEFVLPHFQQLTSMEKLIEKLGTNNYVDRY--LYKGILLGLQGD..... 168
453 7.000e-09UniRef50_A0A1G7WUX5 Uncharacterized protein n=4 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1G7WUX5_9PSEU  ali  12  12........AVGTALRPTGFVRRGHVWLEDRGDGVEWLGFGLS-GTLDLTPLVGVRFRRYDEICRQLPIAPLVSVPLGALMPEEPVWHWNFVPGGD-HAATASCLVATFLEHGKPYIDKHATWDALSRELVAKPASLLDFERARKLAITHLGDVGAA. 164
454 7.000e-09UniRef50_A0A162RAL7 Uncharacterized protein n=1 Tax=Flavihumibacter sp. CACIAM 22H1 TaxID=1812911 RepID=A0A162RAL7_9BACT  ali  13  13......RSLIEPALLPYGFKAYSKTIRLSHEEVFQFIVLNQHRHTATFAVDVAIRPLFSINESHLTLWPG---NRLGKMVTNGKMDTWSNAGTAEEAGISYAEVLKQLEKYAIPFFNQTRTSKEILEFLGQSRFKNQIEWFDFIHLQLQAGNYQEAL 174
455 7.000e-09UniRef50_A0A0C1FZE3 Uncharacterized protein n=1 Tax=Pedobacter kyungheensis TaxID=1069985 RepID=A0A0C1FZE3_9SPHI  ali  21  4...............KHGFTRAFGGWFKESLECLAVLDLQKSNYGNYFELNIKIYVQGAFGNSYKKTKELVKKDIGNIFTRQPNEYSYLLNLDQKTEDKRITGIDLFFRDYLTPRLDKLLTKVGIIE-LESKKHL-YLLPAVKEQIYLLLGK..... 139
456 7.000e-09UniRef50_B7VD35 Putative integron gene cassette protein n=1 Tax=uncultured bacterium TaxID=77133 RepID=B7VD35_9BACT  ali  14  14..........KAVLKPAGFSKKAATFSRSHETHVELFNIQLSQWNSMFYVNCGLTFTGLPEFPWLHFPGTQWAARIEDLVPEAPKVWQY-------SEDTVDTVLALLGGSIL............................................ 114
457 7.000e-09UniRef50_UPI0009EEF417 DUF4304 domain-containing protein n=1 Tax=Bacillus aquimaris TaxID=189382 RepID=UPI0009EEF417  ali  23  14.TRKQLTDCLKLVLKKQGFKKTKTTWRKTTDDLIYVLNIQGSQWSEDYYINVALYIKAIGEEENPPEYRCHIRGQIENEVY----------------------VCSSIYEEVSNWFEKYGDIERLRTLWRKSELP...................... 126
458 8.000e-09UniRef50_A0A1C6GH34 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C6GH34_9FIRM  ali  20  1MNKLEFKKFCHTEFIKRGFKKIKNGYYLQSKDILCGIFLQKSNFGELYYVNYCFHVCALKENIIPSYYDMDIGGRITVKSKTQKDSKDLIEYENYSAEELAKYFDKEFKEMILP........................................... 122
459 8.000e-09UniRef50_A0A0P9G7Z0 Uncharacterized protein n=3 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A0P9G7Z0_9GAMM  ali  14  8..KKIAKQDFIPAMKARGFSKSAMVFYKKHDDIFQVIMFDLLSNKEDLEVLVFSWVPELKQSYDMKEPKKLVITNGGSLDKNGESADYWEVSQIESVASILNEIIVSVDSHAIPWLNEINSREKLVDAL............................ 141
460 9.000e-09UniRef50_UPI00096DB0C6 DUF4304 domain-containing protein n=1 Tax=Paenibacillus odorifer TaxID=189426 RepID=UPI00096DB0C6  ali  17  7..RKLIKKYLSPVLHELGFSGTDHHFVKDNNHVIHAIVIQADKHGGSCVVELGVHFDFLPNPNQLTVYDCEFRTR.................................................................................. 87
461 9.000e-09UniRef50_A0A2V4JK42 Uncharacterized protein n=1 Tax=Pseudomonas sp. MB-090624 TaxID=2213078 RepID=A0A2V4JK42_9PSED  ali  13  10.......RVISDELKQNGFIPTPSGFIRLREHYADYISPQARSDNNAICYNGGVIALFLHTPAQKSELDCDIRFRITP--PEESDFWIE---NTQNRDALRDNSIKLLNSHGISLFNSFENQDSICSNIESGNIPYQFSSMTKSRLA.......... 154
462 1.000e-08UniRef50_UPI000CF66A72 hypothetical protein n=1 Tax=Pseudoalteromonas TaxID=53246 RepID=UPI000CF66A72  ali  13  1MDYQEFKKQLMPELAEIGFIRKKPTYWKEDERLAWVVCLNFSHRGNPFDVLITPYWPCQHKDEPFPRGVGYLGHLSPEGFGHGQHTWWTKTPEG--AQKSIQEVVDALSGPGLEWFQQYSTPEKLLK------------EVPSAKLAADLGYYQQA. 154
463 1.000e-08UniRef50_A0A0M2WMT4 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A0M2WMT4_9BURK  ali  12  11.....IEAYLLEPLSAAGFKFSQLTFKRTQNEFVQAIHFQANRHNEEFWSHYQVSSRSYATWHTARYADWNIRN-WQFPVIDGKQDKEHQLADPSHRATVMACLRDNLLELAVPWLERLSNWEAALALVEAQESHARACDF-----YLMAGKQERAL 176
464 1.000e-08UniRef50_A0A2D9H276 Uncharacterized protein n=1 Tax=Nocardioides sp. TaxID=35761 RepID=A0A2D9H276_9ACTN  ali  13  20MDDA-LKRVLVVELRRRGFTGSLPHFRRRDAGRISLLSVQHFSSGGSFVVEVAACPPAGHVTSWGADVAPDPRPRLGPNFPGFGDHWFVYGPRNYETDAVAEDVV-VLLDQAEAF.......................................... 153
465 1.000e-08UniRef50_A0A2R8B4M5 Uncharacterized protein n=2 Tax=Defluviimonas aquaemixtae TaxID=1542388 RepID=A0A2R8B4M5_9RHOB  ali  14  12..RAALRQHVIPLLRDHGFTGTPSRLWHHRGDRIELVELSCSTYRAMFEVRIGICLPEGPNGPRPSEPQMPIRGMVCPDAPPMQKCRWGWEVQSTWSVETVEEIANQLQSYVLDWLRRDWSYRDLLTLLQQEDTSPILVTSENGSYLRL........ 191
466 1.000e-08UniRef50_A0A2A3FJJ3 Uncharacterized protein n=3 Tax=Nocardiaceae TaxID=85025 RepID=A0A2A3FJJ3_9NOCA  ali  19  65..........VPLLKQHGFRKQKLTFRRERDDVVDVVNLQL---------------------------DCQYRRRIENI-GSGIGPHVTVDAETDIPAT--ADIVCAALTSALEVMCQLRGPDDIVRFALSD......................... 156
467 1.000e-08UniRef50_A0A1C4ZBD9 Uncharacterized protein n=1 Tax=Micromonospora viridifaciens TaxID=1881 RepID=A0A1C4ZBD9_MICVI  ali  14  11....IVTNHLAPPLEEMGFARKRRVFRRYADNGAVVVGVQTSSGSAKFYINIALVPVPWLRLQEPHDSEGGLSTRVTS-SVNGRWFEDTWVADAIDAHERAADATRHLVAQFIPLLDR----AEFLHRLENRAALPGFEEAMRAVLYLDAQRFDEA. 177
468 2.000e-08UniRef50_A0A0M8W158 Uncharacterized protein n=14 Tax=Actinobacteria TaxID=201174 RepID=A0A0M8W158_9NOCA  ali  10  12........AVDAALRPTGFVRCGHVWLQERGDGVRWLGFGV-TGSLELTPLVGVCFRRYDEVCRALPATPVTSTPLGHLMGDKPVWRWTFTPGGD-HAGIASALVDTFLRHGKPYIDRCATWDALSRELVAKPESLLDFERARKLAIIHVLDGNAA. 162
469 2.000e-08UniRef50_A0A246H600 Uncharacterized protein n=1 Tax=Mitsuaria sp. HZ7 TaxID=2008677 RepID=A0A246H600_9BURK  ali  14  16MNRKEFSEAVLPG----GFKKTRRVWTRQRTHAIEFIHFFRSSYGKASTGSVRIRVHWGIRVLNSGLDFMHLNGSSGDGQLFGLRFHLRFNAETSTYERCMADLSRLVEEHIEPWFQKFSDP----LVLFSDPSSPLNAEEKDALEAALYGQPDPA. 170
470 2.000e-08UniRef50_A0A143XET1 Uncharacterized protein n=1 Tax=Alistipes sp. CHKCI003 TaxID=1780376 RepID=A0A143XET1_9BACT  ali  15  7..SKIVEPKVISVFEEVGFKKITHKWLRHYNDNIDVIGLNTSGRGCHFYVYMYDYRRIFHEITGKPQEECPIGQAMGYTTPRRTFYEWKFT--ENNIEEMLSELRYDLKEYGIPFMYRMLDLRNYVE--RTKRVRDLPARYFVPIMYAQLGEKDKA. 170
471 2.000e-08UniRef50_A0A0D0SCB5 TWA4_scaffold00001, whole genome shotgun sequence n=1 Tax=Lachnospiraceae bacterium TWA4 TaxID=1392836 RepID=A0A0D0SCB5_9FIRM  ali  12  14......QEILDSFMKKQGFVKYKTNSYIRLNELVECICIKKSKIR-KFTLLISLAPLYVPNVCLPLAQGFDLGKVITNANEKEKFKSFWWDYREDVAKESFENVVEVIEQFVLPWFSQYLSPKIYQEDLKNGKILDGNNSIQWLIYF.......... 156
472 2.000e-08UniRef50_UPI000A11F2E4 DUF4304 domain-containing protein n=1 Tax=Thermoactinospora rubra TaxID=1088767 RepID=UPI000A11F2E4  ali  12  32..RVMLRDEIAPALRELGFVGSGQIYRLPDDRHWARLGFQKSAFSMWFTINLSVVSKELWEQRR---SAGRLPARPAPSTFYGPWMWQR.................................................................... 119
473 2.000e-08UniRef50_UPI00093DA728 DUF4304 domain-containing protein n=1 Tax=Mycobacterium sp. SWH-M3 TaxID=1490482 RepID=UPI00093DA728  ali  25  25...........PVLRAHGFTKSGRTFRRDREPLYDVINFQGSKWNG............................................................................................................... 59
474 2.000e-08UniRef50_UPI00047559CF DUF4304 domain-containing protein n=8 Tax=Teredinibacter TaxID=2425 RepID=UPI00047559CF  ali  8..RRLIKKKLVPLLEKDGFIGVFPNYRRFGDKALHLLAFEFNKYGGSFFLELACVPRGDLEMSWVAHTNFESRARLQQNGRANSLSDDWFQYQNLSEPEIEKLVVGDLLSQVNDWF......................................... 133
475 2.000e-08UniRef50_A0A0M4G076 Uncharacterized protein n=9 Tax=Bacillales TaxID=1385 RepID=A0A0M4G076_9BACI  ali  14  8..NKVIRKILTPTLKENGFNKNTRHNWASIDHCIWVVDITTGWSPMSIHVELGIYYDFVPTENLPKAHQCQLYTRHFDNPAEVDRKDWWIETNGSNIEEVISDIKHSFLISGLDWFRKYTDLETAFNEIEKEH--NSFNKFYNAKYFAK........ 186
476 2.000e-08UniRef50_A0A1F6WQZ9 Uncharacterized protein n=1 Tax=Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_33_17 TaxID=1801764 RepID=A0A1F6WQZ9_9BAC  ali  19  1.MKDELIKILDNFFTPLGFKKQNSLWSFDNGILIKKVNLQKSDFGEIFYLNYG---YDIKNLNSDLDSTMDIYNRAGTINHV------------DDLQSLINEVSNN--------FNSTNSEEDILSSFEKRPTMNDIPLNIKKYF........... 122
477 2.000e-08UniRef50_A0A2T5MDB6 Uncharacterized protein n=1 Tax=Sinobacteraceae bacterium GT1R17 TaxID=2029166 RepID=A0A2T5MDB6_9GAMM  ali  12  14.DTAKILRLFAKAMAAEGFTRKSTWFCRERGHVVQFLHVHKFSFGPDFRIHVCIRVL---NDPRSFIALLGISSDEDKQRPN-----FQFESNQESLKDCAQRMAEYIHSVGLPWLESC-TLKALLA.............................. 130
478 2.000e-08UniRef50_A0A2A7WUV1 Uncharacterized protein n=4 Tax=Bacillus TaxID=55087 RepID=A0A2A7WUV1_9BACI  ali  14  8..TKQYKEMFKETLFPLGFIMKGSLFIRTNNEIIQTINIFKSSP-IDFTLNIGIFPFSRDNDKSLLKEG---SFRLYDYGDYDSGEFQYNPLSLKSIQQELEKCKNQFKKEILPIFESVQTEEEFLKFEIESDIRNYFISNEKLNLYLKFKNYEDAL 163
479 4.000e-08UniRef50_I4BD56 Uncharacterized protein n=34 Tax=Mycobacteriaceae TaxID=1762 RepID=I4BD56_MYCCN  ali  11  18....MLSTDVRSFLEKRGFTRSGTEFHRDRGALYDLIGFQENWHNGSFFVNVGVGSAEIDGRPRTRRNRYLLDRRWESLVPALP-YEMRFDHRTDTAV-FAAELCRGLGLLLEVL-ESCDSTAMLVRYAVENNLLIAYETTCCYLAATDDIEML... 175
480 4.000e-08UniRef50_UPI0008E4AEBB hypothetical protein n=1 Tax=Myroides guanonis TaxID=1150112 RepID=UPI0008E4AEBB  ali  15  24.....IENIVTEKLEPFGFRKFGRKLIRKSNDIVHIIHLRGSWQGSSSSLKTEFAIVSIFDTDILIENFEPISSSYIQHLEPKLKNYYQITKEFNL---FAEYLSRKIIEIILPHLDKYLSSKDVLKEGIKLGGTKNLEQFCRLI............ 162
481 4.000e-08UniRef50_A0A1P8FES1 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FES1_9PROT  ali  12  11..SKACERHFAPMISKLGMLPLGGNFGRRRGRWIDGLFLQQSGYGGDFCVNVGFNIPELSELWRTPAVFGL--SMGGRLSAAGVGHDRWLRASNAELLEGLAEFAKHLES-AMPWFDETQTFDDLVERYRRVGRIGSSPPTA............... 150
482 4.000e-08UniRef50_R5AH18 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:1024 TaxID=1262770 RepID=R5AH18_9CLOT  ali  15  4..KEELLKQLAVLLKKRGCRKSKQTWTKRVDGLVLLLNIQNSQFSEAYYINLGILIEPLNKDGKACLTNCHIIERIPECDKEGNAF----------SAENIASIFDRWEEW-------YGTMDKLKDKAIKGSLPRQTWGTAWTYLTTYRG...... 137
483 4.000e-08UniRef50_A0A2N1KN64 Uncharacterized protein n=2 Tax=Siphonobacter TaxID=700450 RepID=A0A2N1KN64_9BACT  ali  11  25...KDFTAIIAENLLPYGFKKVGRRLIRPSKDLLQVIHIDTSWMGTSFKTEIGLATV-YDTDCFVKNYELTGSKKIEHIIPSLKNYHRI----TQEYKVFAEFYTQTLIEHILPYFSRYSSSTDVLTNRTHFKVGEVSGRDENLILFCELAQH.... 173
484 4.000e-08UniRef50_A0A2N3LN83 Uncharacterized protein n=1 Tax=Bacillus camelliae TaxID=1707093 RepID=A0A2N3LN83_9BACI  ali  11  6..TKVYKEVFKDYAESLGFKLKGSLFIKVVGEIIQTIYLFKSSP-IDFTLNIGLF-PFCIKNDKVFLREGNFRL---DDFLTNADYWEFDRLNYNKTVSVVNDVLAVFQKHVAPVLEKVTDLKTYLDFVNKHELEKYLWNVDKLYSYLKLGDYNTA. 158
485 5.000e-08UniRef50_UPI0004AE795F DUF4304 domain-containing protein n=1 Tax=Sphingomonas jaspsi TaxID=392409 RepID=UPI0004AE795F  ali  13  1MAKKALDDKVGSILKEAGFKPKGRTWLRHRGRRVDGVQFQQSRYNVTRASQMTVTLSSLMEEGVAMLVAPGSMKRIGDLTEVRGDLWYSYDGDDADCAAVAAEIADDLKRFGLPWL......................................... 143
486 5.000e-08UniRef50_A0A2E0XBS8 Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E0XBS8_9PLAN  ali  13  1MNKRALRAVLDALLTERGFTPQRRHFIRQGPVLIHVITFEVCHSDPDDTWTTSREAHELETDDPFTESAKSWSGRHVS-DGMGPGYWQLDAEDPDGVQKTARTVCEDLRQFIIPYLDALQSYDDLL-ALGEHRSVSP-HPMSRAAIAMLVNRPEVAV 176
487 5.000e-08UniRef50_A0A0N1L425 Uncharacterized protein n=1 Tax=beta proteobacterium AAP51 TaxID=1523421 RepID=A0A0N1L425_9PROT  ali  11  33.....VAKRLGAALAPLGYKRKGRMLALAAGAHWKIVQVQAGKWNGEFYVNLSVQYPALMRISQPDEAAGQARARLGQLMSALPPDEWKLSPHVDMGP-LADGVVRGMLEVGLPWLEEHGSLRGLADQEASLLTVDVDMRIAAAVLLGDFARAQQVL 215
488 6.000e-08UniRef50_A0A0M6ZE80 Uncharacterized protein n=2 Tax=Labrenzia alba TaxID=311410 RepID=A0A0M6ZE80_9RHOB  ali  18  27MNDSLMKDVVAPLLDEKGFRARNRVFRRVSNGFEHVVSFQKSQYKGKFCINLYSHPLIDGYPGFPKLPEHLFSRRMA--VNELQDQWWRIEKLYRSD---VREIEGLLSRELDLWFSKTESVKAFSE.............................. 158
489 6.000e-08UniRef50_A0A0M4GRX9 Uncharacterized protein n=2 Tax=Actinomyces TaxID=1654 RepID=A0A0M4GRX9_9ACTO  ali  13  3MTQADVRDCIAPELKEFGMRRRGLRWFWSGPEVRWSLHLTKIPRREWFELSGGLAAEDPGTPSSPTGSGFQLHMYLADWDIDEDVTVRMVEDYTALPDNTRRALLKRMVAMVCRYVSEHSTVEQLVRAYAAG-------EYRSSIIFKDLRRTLE.. 154
490 6.000e-08UniRef50_UPI00097E589F DUF4304 domain-containing protein n=1 Tax=Sphingopyxis sp. KK2 TaxID=1855727 RepID=UPI00097E589F  ali  19  23................HGFKRKGRNWVRRTCDFVQLVNLQHSQWSDDSYLNFAMWPLAMGEPPTFAESKFQFRTRAERLDVNDLPGFFSAADKLRTLADLREAVRA--SEHVL............................................ 119
491 6.000e-08UniRef50_A0A1Y4ARR3 Uncharacterized protein n=1 Tax=Lachnoclostridium sp. An298 TaxID=1965627 RepID=A0A1Y4ARR3_9FIRM  ali  18  1MEKKEVQKFIKNKMKELGFRSRGNGLYKILDDNYLIIYMDHHSYCKGYFIEYGVIYL-PDDEKMPFRGDFDWSSRFFFTTDPEDDLKYHFDVDE-IDEDSYENITVYFEYDVLEELDAQLDLKKLLPALLDKNFVLEFYKKEL.............. 147
492 7.000e-08UniRef50_UPI0008A88E86 hypothetical protein n=1 Tax=Sphingomonas haloaromaticamans TaxID=653954 RepID=UPI0008A88E86  ali  14  11.........................................SAHSIKFTINLGAISVEPRDINRETVWGARLGERVGAFLATPDDHWWAISQHSPLSD-VEGEIAHLLVSGVLPFLQKHVSGSDLIALWDTGHSPGLTEG-QRLRNLAQLKEI.... 127
493 7.000e-08UniRef50_A0A1X6QEH4 Uncharacterized protein n=1 Tax=Bacillus mycoides TaxID=1405 RepID=A0A1X6QEH4_BACMY  ali  24  11...QDFITNLHAALKSLRFKKKRHTFRKADNGFYKIIHIQKSQFGDDFYINIGVHP..................................................................................................... 63
494 8.000e-08UniRef50_A0A1Y4HAV5 Uncharacterized protein n=1 Tax=Anaerofilum sp. An201 TaxID=1965588 RepID=A0A1Y4HAV5_9FIRM  ali  11  18............ILKPYGFRKKKDRFRRLANGIFWEIEIQRQDFKMHFTVNISVAEKDLWTPDGPKQLWGHLGESPEDGWHHQKWYWKTVWIPYPSPEQIREEICRLIREKVLPFFLSVQTLEQYLALLKDHQDLHLSWGEEAARLYA......... 194
495 8.000e-08UniRef50_A0A1I2RV21 Uncharacterized protein n=2 Tax=Planifilum TaxID=332100 RepID=A0A1I2RV21_9BACL  ali  15  22.....LEEHIWPLLEPEGFCRRSLRFWRGDSSGRQALEFRLSRRRTDPVLAYQVQKLMGEETTAKKNPEVLVHQSVGLVSPDRANTRWILFGEEDLTD-LGPFLGEYVKTYVLPFLNRYRSCRDIVEGWESGDERLAPPPIQMVAACLEAGRKEQA. 191
496 8.000e-08UniRef50_Q8RI20 Uncharacterized protein n=19 Tax=Fusobacteriales TaxID=203491 RepID=Q8RI20_FUSNN  ali  15  14..KKYFKEYFDKPLKKDGYYKKGTTFYKINKMMIEVINFQ--RHYDRLTVNFGVSPLWCGALK----GAMTIGGRINKFSKEKSHWWWNIRNEEEIKNSMI-EILELIQTGLYKWFTEKDNKENIMESLKEAYFDKINEYMFLATAMAKFKRYDE.. 164
497 8.000e-08UniRef50_A0A0L1LY41 Uncharacterized protein n=4 Tax=Bacillus TaxID=55087 RepID=A0A0L1LY41_9BACI  ali  12  12.....LRKNVIPTLRDRGFKGSFPHFYRKLENRVDLLMFQFSVWGGVLYIEISKCSTETPNKARVYNIDTAHRQRLG------KEIGEMFEFNKDNTEVISLNVRESLKE............................................... 120
498 9.000e-08UniRef50_A0A0G3XGW8 Uncharacterized protein n=1 Tax=Croceicoccus naphthovorans TaxID=1348774 RepID=A0A0G3XGW8_9SPHN  ali  12  13..RKAMRELLEPEIARLGFVGKYPDWRRETPAEYHYLQFYTRKYGGGFSFSGAWAEKGRFTDPNGKVFDTDFDQRPDRTMARESTGYFEYAHIADDADACRSLVLEA--RAVLPQMDRWLHTREAGEAISSKDHSPPQGLSRRLRWH.......... 174
499 9.000e-08UniRef50_UPI000D5297DD DUF4304 domain-containing protein n=1 Tax=Miniimonas sp. S16 TaxID=2171623 RepID=UPI000D5297DD  ali  32  1MDAARVEGVCVEVLKQRGFRKRARNWYRTTSAVYQVVNLQRSPWGGSCYLNLGW---DVDASSFRSENRCLLRLRAQE............................................................................... 78
500 9.000e-08UniRef50_UPI000A369FDD hypothetical protein n=1 Tax=Streptomyces vinaceus TaxID=1960 RepID=UPI000A369FDD  ali  14  1MKKSEVFKEIAGAMKAVGFRRRASNYEYVLDEGWCSFHAKRGSSNLLVATFAGVRCSAVEERRWCGDVVPGWDGRSGYLRPEAQWLEHPVDLTGDEPAESAQRNMEDVTGIALEFLRRTASYQGVTHALITVKGQMPDRQIERLLTYALQGEYEKA. 175
501 1.000e-07UniRef50_A0A2S5YLT7 Uncharacterized protein n=4 Tax=Rathayibacter TaxID=33886 RepID=A0A2S5YLT7_9MICO  ali  11  6....EVEAVCVRKLKEAGFRRRKDTITAPLSEGWQWVGLNSGGWDGVMYPIIGVICDEIQRIYYRNYPTPTITIPLGYAADVPKLRQWFFTND-DTVEERATDLVQAVVDIGIPYMRRHASLDAIRATL-SGDNMIPNPRVARQKLA.......... 158
502 1.000e-07UniRef50_R4KRG2 Uncharacterized protein n=1 Tax=Desulfotomaculum gibsoniae DSM 7213 TaxID=767817 RepID=R4KRG2_9FIRM  ali  16  8.TTEAMVDWVVPYLMNNGFKGSYPNYRRIRPGQIDLVTFQFSCCDQAFCINIAKCPPEGVRYKKPSEVHCPQRLYLGVQEGHSY-HWFKCNPRRQEIIQMADDIINLFKKQAEPW------WENSEAWWEKG......................... 158
503 1.000e-07UniRef50_A0A2W6TWI4 Uncharacterized protein n=1 Tax=Stenotrophomonas sp. TaxID=69392 RepID=A0A2W6TWI4_9GAMM  ali  15  23.....IKKVLLPEIRRLGFGGSGANFVRSSEVHRDFLSIQYWTYGGSFILEFSVDPDSGEVPKRVFETDPLLRKRLIDTEQHKDFRGFSFKAEQDQYDQLAASVVVLLP-QVEAWLES....................................... 144
504 2.000e-07UniRef50_F9Z4D8 Uncharacterized protein n=2 Tax=Odoribacter splanchnicus TaxID=28118 RepID=F9Z4D8_ODOSD  ali  22  2MDNKKFKQLFNDVARLYDFEQAYGAWFLESPECIVVLELQKSYFGNYYELNIKSFVQGAFGNHYVKSKDLAKKYMGNCFGRQPSEYNDIFDLEEDMEDEYRKE...................................................... 104
505 2.000e-07UniRef50_A0A1G7D2V6 Uncharacterized protein n=2 Tax=Bacillus aryabhattai TaxID=412384 RepID=A0A1G7D2V6_9BACI  ali  12  12.....LRENVIPTLRDRGFKGSFPHFYRKLEDRVDLLMFQFTAWDEVLYVEVSKCSPGGH................................................................................................. 66
506 2.000e-07UniRef50_Q98GC3 Mll3391 protein n=2 Tax=Mesorhizobium TaxID=68287 RepID=Q98GC3_RHILO  ali  17.........ISSRLESVGFRKSGPHASRRAGDWTFRISFQSNYLNVELVVHASVYNKAIREWDERNGWDWIAGGHLGNLRTPYHWRTWNI-ANPLTRQAEIANIVANVQTTVLPFFERFGAPRELAEELAHSEVPGFMFP................. 158
507 2.000e-07UniRef50_UPI00047BE12B hypothetical protein n=4 Tax=Butyrivibrio TaxID=830 RepID=UPI00047BE12B  ali  15  60....VVKELIKPLLKEHGFKTGGNTWRKITDSLKVVIHMEGYRFGAIFQLIISLFESKEKLKPQHGIGELSIDSRYYNVLGYRIDGYRDYLPIDIPIDEVKEYFRTDLEKYILPELLKIESREDYEKMYAKYGSEKRWNDLDIRIA........... 218
508 2.000e-07UniRef50_A0A0A0BBM1 Uncharacterized protein n=1 Tax=Cellulomonas cellasea DSM 20118 TaxID=1408250 RepID=A0A0A0BBM1_9CELL  ali  15  14...EMLRTSVAPALRELGLRGSGQSYRLTNGGDHALLGIQKSVASSRLTVNLAYFPGADWDAAHARWIPSGWQTRIGLLVDEPHDHWLTVRSPADVSV-VSAHLLALVRDLALPQL......................................... 142
509 2.000e-07UniRef50_A0A257ZRI1 Uncharacterized protein n=3 Tax=Rhodobacterales TaxID=204455 RepID=A0A257ZRI1_9RHOB  ali  20  30...AQIIAALDQALVPRGYVLKHTTWTRLSPDGRSAVHLQRSRYGWDVQIILRVLTLDGETPDWPEEEDMTL-TRFGGGGGEDPGRLAFLDVLERPACLVRA--IDILVDEALPWMESLQS.................................... 147
510 2.000e-07UniRef50_UPI00047E3A9D hypothetical protein n=1 Tax=Aestuariibacter salexigens TaxID=226010 RepID=UPI00047E3A9D  ali  10  8.TKNALRNLIEPHLSKLGFQRSKKDFYRIRGALLDHIYFGFGRWGDVIYIYCSVHLLSSPIDDVDSY---DVGFRLSSKWSSKNH---------DVAMKYARDILAEVESCAFEWFRTIDSLEKL................................ 121
511 2.000e-07UniRef50_A0A1C5C1S1 Uncharacterized protein n=1 Tax=Streptomyces sp. MnatMP-M17 TaxID=1839780 RepID=A0A1C5C1S1_9ACTN  ali  14  15............ALAQLGFVKRGGAFLQERGGGWIGLNLATHGLPRLFKINPVVGVRFAHRDDVPKKPMPVISKPLGYLMPENSFRFWEF-LEGGDIERVAKSLAGAVREYGEPYIATYSDWDVFSRDVGDVGLLVEHERAVLPIVHLINGDREEA. 169
512 2.000e-07UniRef50_A0A0Q6SFN4 Uncharacterized protein n=1 Tax=Massilia sp. Root335 TaxID=1736517 RepID=A0A0Q6SFN4_9BURK  ali  13  1MNKVEVNKAVYDILVPAGFKGSDCRFIRRTASGFQDVGAPLRDYDPVFSVNIGLRVDAIQDEANPLYPSQYWADSFTVLLKPVYFLGRDLKFEVQTPEEITSEIKSLFEDHVFSFFDSCQDLATVERLLNRDPGKPWM................... 151
513 2.000e-07UniRef50_UPI0009845D59 DUF4304 domain-containing protein n=1 Tax=Marinicella sediminis TaxID=1792834 RepID=UPI0009845D59  ali  13  8..RAAMKKLFEPFLANEGFTGKYPHFQRKEMGDIQLLSVIYDKWGGGFVLEFAHHPAGTLHTSWGTYTSPSIRARLVRTERGQGCYEDFFRYEKISD--NREECEALVNRVVMLF.......................................... 128
514 2.000e-07UniRef50_A0A0B5RW06 Uncharacterized protein n=1 Tax=Myroides profundi TaxID=480520 RepID=A0A0B5RW06_9FLAO  ali  16  13...KIVFEYLNSILKSNGFKGRGNNWTRTNGAIFSKITIQKSKSSFRFYLHLCVTIDNKEMDWTYNEQAYSVKERKMFKFKNHGWLGWYVIFRENACDQLLDELKVDFENYILPVINKINTI-DIYQKVKTDMNTYPKKDIHLGIY........... 177
515 2.000e-07UniRef50_A0A1H9PXZ7 Uncharacterized protein n=1 Tax=Isobaculum melis TaxID=142588 RepID=A0A1H9PXZ7_9LACT  ali  22  12..KKELIKDATLFLKEKGFKKNKNTWLKFDTKVIAGFNIQSSYYGETYYINVGIIIKGVDKKLITSPSHWHFSQRIDEVRKSTKDI....................................................................... 96
516 3.000e-07UniRef50_UPI000A36410F hypothetical protein n=1 Tax=Lentzea kentuckyensis TaxID=360086 RepID=UPI000A36410F  ali  11  4............ALRPIGFVRRGHVWLQDRGDGVCWLGFGL-AGSLELTPLVGVCFRRYDDVCRAIPGTPVVSTPVGYLMGEKPVWRWAFAPGGDHAP-VAASLVDAVRKHGLPYIDKRAKWDAVSKELVGTPETLLDFDRARAIIHVLNGNAGAA. 152
517 3.000e-07UniRef50_A0A1E4EW75 Uncharacterized protein n=1 Tax=bacterium SCN 62-11 TaxID=1660156 RepID=A0A1E4EW75_9BACT  ali  14  1MMDRVFQEGVGPLLAPLGFSGRGGLLRKDG----WVLEILPGA--DRFEVGVGKGGKSW--------SECPERTTLGELW-KGKPYHWKMNSPADIKPAV-EQVTVLVLELALPWFQ........................................ 101
518 3.000e-07UniRef50_E2NKW9 Uncharacterized protein n=1 Tax=Bacteroides cellulosilyticus DSM 14838 TaxID=537012 RepID=E2NKW9_9BACE  ali  15  2.......................................................................ISLPIGYLMPDNDFKEWKFTIDKDVNEDV-DNMARAIINYGLPYLEKLSNMDQVIHGLVASQYIGEAKDYILPVLYYLHGNSEQAL 88
519 3.000e-07UniRef50_V4PDS0 Uncharacterized protein n=1 Tax=Asticcacaulis sp. AC460 TaxID=1282360 RepID=V4PDS0_9CAUL  ali  17  1MNDALVRDRIKPTLDHAGFKARGRTFRRTTDGFEHLMEVQRSMEG-RFCITLYAHPRVSGYPGLPEFPDYWLSHRLTPAGLD--DQWWPVDPLSSSDGDQIMGLIEGLSRFSADWFRRMWTLDHAAARL---GLLPARLAYLQAAVFAEQGKTDVA. 169
520 3.000e-07UniRef50_A0A1V6LPC9 Uncharacterized protein n=1 Tax=Croceivirga radicis TaxID=1929488 RepID=A0A1V6LPC9_9FLAO  ali  13  7..RKLVNKHFSPKMKELGWTGNGFDYRRIEENLVKLFGMYGSWMGGCIYCETGIHFDFLPPIEKKKVTECFFRERLSV-------GTWEFYTEEERNVKQVQNILETFLNVSPQFYSDFENFPDPFDKISVEDVIENQD-------YKLLGKYE... 151
521 3.000e-07UniRef50_UPI0003735FFD hypothetical protein n=1 Tax=Kangiella aquimarina TaxID=261965 RepID=UPI0003735FFD  ali  14  17.........LKPLL-SNGFCRDKVTCYRVRGDFVDVVSIQVGRSLGSLYLHSFINLLVNPLANHLSSYK--VGFRLDRNPINGR-AWLAPEDDESDIELLLQDIASMASTQSIEFFDSINCYKEYLGKIHSDPNKA-LFDYEEIICLSKLGQYDDAI 161
522 3.000e-07UniRef50_UPI0009DFC3FE DUF4304 domain-containing protein n=1 Tax=Pseudomonas sp. FGI182 TaxID=1259844 RepID=UPI0009DFC3FE  ali  14  1MRKEFTKKIFQRVASKLGLCGRDTTFFMKHGNAYLIVNFQKASGNRSFYINGGIHSPVSAYNNQPTQFPTHVDFRAEN-VPNSPITQAEIDAAASNYDAIATEIFTALESMIL-FARNYGDREEVHRLKQAKLFPAIIKK................. 152
523 3.000e-07UniRef50_A0A0Q6LYJ2 Uncharacterized protein n=4 Tax=Phyllobacteriaceae TaxID=69277 RepID=A0A0Q6LYJ2_9RHIZ  ali  12  1MTSELIKRRLGPVLKRHGMIGR----WIVMKPIRHVLRVMLSRDHDSFVV-------PQWAVTHFCEPVGNFPLNWGRLYRDSPGLWLWDDPDMP------EYFISKLESVVLPIFRSIQTLDDLVAYVETKPLPYRIDELRGACLHAARGDLETA. 149
524 3.000e-07UniRef50_UPI0005AC62FB hypothetical protein n=1 Tax=Variovorax paradoxus TaxID=34073 RepID=UPI0005AC62FB  ali  11  1MREREFDRIIEPVVALWGFTGRGCTFHRKHDDLFHFIHFSQRSSGVEFEVWVFPGTPSLGSEQWAGFPDF-VGVPTGQLGVGGDASRFPCRDRKALDVALSRAVVPALQTHARPYLANFQSVQDLVPVLEHRQW....................... 148
525 4.000e-07UniRef50_A0A2S0RIP6 Uncharacterized protein n=1 Tax=Flavobacterium sp. HYN0048 TaxID=2162713 RepID=A0A2S0RIP6_9FLAO  ali  19  39.....LNRIFIPELRKINFSGSFPHFRRTEGDITNLLTFQFDRHGGGFVIELANYKGREYKTHWGKIHDLNTRQRDSEFEENSTDSWFRYDKKSNKFDKLANKVIERI-----PIMERYWS.................................... 165
526 4.000e-07UniRef50_UPI000376A978 DUF4304 domain-containing protein n=1 Tax=Stenotrophomonas maltophilia TaxID=40324 RepID=UPI000376A978  ali  13  10.......KIFGAAAKDAGFLGNAVTRYRDHDKFLLVINHQKSAFGRNFYLNVGLYFHEMLEEPHTPAPHPHVSWRIENTPGMPQEHLDSLVVQNDTDDLRRTLGLALGVLL--AFVDAHADRKALRQLTDAR--------LFNAMILKEV....... 158
527 4.000e-07UniRef50_A0A2R3F0K4 Uncharacterized protein n=1 Tax=Shewanella sp. WE21 TaxID=2029986 RepID=A0A2R3F0K4_9GAMM  ali  25  4...............ERGSKKSSVTWRKDQGESIAALNVQRSKWSGDCYVNLVVYFLALGEDKSPTENKCHVRVR.................................................................................. 64
528 4.000e-07UniRef50_UPI000D6E3AF8 DUF4304 domain-containing protein n=4 Tax=Deinococcus sp. 17bor-2 TaxID=2202254 RepID=UPI000D6E3AF8  ali  19  68............AARHAGYQGSGQTMHATSDGFVWVLNVQRSHDGIHFYVNLGAHPQDSSSVSSLKEGECAFRTRVGERWLREPLDEKLGLVFSQTESVFRAEILAGVEQ............................................... 169
529 5.000e-07UniRef50_A0A1W1X9K4 Uncharacterized protein n=1 Tax=Andreprevotia lacus DSM 23236 TaxID=1121001 RepID=A0A1W1X9K4_9NEIS  ali  10  8.MRRALRKRVLPLLAGMGFVGKTAHFQRRSELWLDLLTIQFHHHGGSFLLECGRTRRGDFQTHWGPELEVAYLHRRARLIDQSEFGWFAFAGDLALYDAVAQRVAGL-----LPQLDDWLT.................................... 130
530 5.000e-07UniRef50_A0A1Y0ND16 Uncharacterized protein n=1 Tax=Curvibacter sp. AEP1-3 TaxID=1844971 RepID=A0A1Y0ND16_9BURK  ali  47........AVAGAFANDGFRKSALRFSRKVGAFTHIVSFQSDSANTSGS-HVGVTIHAQVKSSVLAEWDNIWSTQIGYLSLAHDYLKWQL-VDPVMRQVEVASMVNAVRAFVMPAFAVCSTKEGLSAQLLERREITWTPDWAIDVAL.......... 194
531 5.000e-07UniRef50_A0A228J4D9 Uncharacterized protein n=2 Tax=Burkholderia TaxID=32008 RepID=A0A228J4D9_9BURK  ali  17  1MKEAEFSKVFGQAAVAAGFHGTGVTRFIELTDLWLVINHQKSSYSKLFYVNVGIFYKEKMVFKKGASVWPHVDFRLEGCPGVRGDFQAEVDKCVAERDAPRLEILFDAFSGLAEFVEKNGDRKSIRRLVNEKKL....................... 148
532 6.000e-07UniRef50_A0A2E7JG10 Uncharacterized protein n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2E7JG10_9GAMM  ali  11  48........RIASAFENDGFRKSGPHMTRRRNGFAEKVVFQTSYHNIPVAANVGSKKLKEWRNSQPRKDDWVGGGMIHLLGTNQVYLTWEL-ADPESREDTIADVVDTIRCFALPYFDHFQNI................................... 172
533 6.000e-07UniRef50_UPI0007022BE7 hypothetical protein n=1 Tax=Oerskovia sp. Root22 TaxID=1736494 RepID=UPI0007022BE7  ali  14  1MAVLVLQDEFAPLLLARGFVRSNKVFRRTPGDMTVWLNP-ENRLKQVRTVNVDCWVDDEDQGWLYSLDQA----RAVS-EIERRGAWASFDYTPDMPDWPAV-IVEDFERVTLPFIDACTSPAALCDLLLEGRVPPSNMKRAPVGWFEDVW...... 147
534 6.000e-07UniRef50_A0A1U9N9M4 Uncharacterized protein n=1 Tax=Cellvibrio sp. PSBB023 TaxID=1945512 RepID=A0A1U9N9M4_9GAMM  ali  14  16.MRLVLKSHVDPFLKAQGWMGRNSTYKRIINGQHQILEVQFNKWGGSFAVNLSIVEPENFYAARSGKLKCIRSQRLGSSKKQNMDHWFKF................................................................... 110
535 6.000e-07UniRef50_A0A126ZA05 Uncharacterized protein n=2 Tax=Variovorax sp. PAMC 28711 TaxID=1795631 RepID=A0A126ZA05_9BURK  ali  15  2......................GSTFKRRVGEATQIVNVERSSRNGRFYINGSVYLPAEPLIEDPDEPSCHVRLRPNDADPDAR-REYDVTLDTD-ADSLGAEIASDV-TALLDMLDGLTTPQAAVAHL-AGRRLAQYERVFGWYL........... 131
536 7.000e-07UniRef50_A0A285JWC8 Uncharacterized protein n=2 Tax=Actinoplanes atraurantiacus TaxID=1036182 RepID=A0A285JWC8_9ACTN  ali  14  1....MISKQVGPALKAAGFKRSSGTFRRSGDGDAIVLEFQSGGDLSLFYLNMAASTGGFLRWRLPRTMPSQWWNRVDAVVPGFPIGRDTWRLTSPKAAKRCDLLAAALPARILPQIEKILDYRQIDDALRAGQVVLPPPPSTALGGFHFVKKPD... 174
537 7.000e-07UniRef50_A0A1T5BAI2 Uncharacterized protein n=1 Tax=Lysinibacillus sp. AC-3 TaxID=1680467 RepID=A0A1T5BAI2_9BACI  ali  18  8..NKVIRKILSPVLKDNGFEKTRRNWGWK-DHCILVLDITTGWSPMSVYVELGIYYDFVLPKDLPKSHQCQLQRQFDNPAEKERNDIWWIQPDGSNIEEVISDIKQDFITNGLEWLKK....................................... 157
538 7.000e-07UniRef50_A0A0Q7PUK3 Uncharacterized protein n=1 Tax=Lysobacter sp. Root494 TaxID=1736549 RepID=A0A0Q7PUK3_9GAMM  ali  13  1MLKDDVRNAVFEALKAAGFKGSRRSFRRVVPGGVHTLGMPLADYRPTYVFNLLVTVREAITLPFSRIVTKYW-ERSSTLIIGPEFFDAPREHRIRNEAELVAESAALFEGRMLPWLDASTDLASIERQLNAVRHPGQYTDLDSYAFAGLA....... 163
539 8.000e-07UniRef50_A0A1M7PKD9 Uncharacterized protein n=1 Tax=Duganella sacchari TaxID=551987 RepID=A0A1M7PKD9_9BURK  ali  15  1MDRKAVAKALVPVLKAQGFELKSGSFVRRQPYGFDAFVVQGSASGEYFEIKYGHIHHDRIEVPWNSFGFVHGEDNQQQLSRPGNLPSWKVFPATADAARLAEEIVPFFEQKALPFYQRFADLKE................................. 138
540 8.000e-07UniRef50_A0A1N7C6M4 Uncharacterized protein n=1 Tax=Mucilaginibacter lappiensis TaxID=354630 RepID=A0A1N7C6M4_9SPHI  ali  17  26...KRFTDIIFHNLSHFGFKRYGRMLIKQSNELLHVIHLDTSWTGMSDRFNVEIAITTIYDEDSFIHNRGLTGAKKIEQIIPGLRNFYRI---TQEYELLADFLTRKIIEFVLPYFDKYNSAAQILANPKDFDLRQITALHQRLFLFCELHNH.... 177
541 8.000e-07UniRef50_UPI0009DB85AE DUF4304 domain-containing protein n=1 Tax=Sporosarcina sp. EUR3 2.2.2 TaxID=1305836 RepID=UPI0009DB85AE  ali  21  2.........VTPVLRKQEFKGSSPNFRRNNEMNIDLITFQFNRSGGSFVVELATCPIEGITMNWGK........................................................................................... 58
542 8.000e-07UniRef50_A0A1C7DP18 Uncharacterized protein n=1 Tax=Planococcus halocryophilus TaxID=1215089 RepID=A0A1C7DP18_9BACL  ali  17  1MDKKKLKAMLADLLADHGFKKRNQSFYKKTEDGKISIHLTSINHFDDFDVTVNFAIRLNDVEDILNEIDYTLGAELGNITEEGQKRW---TIENEEDVKIAREIYSGILSVFFPVIEKYTSKESVYELAIKDQKESRIFW................. 155
543 9.000e-07UniRef50_A0A1H7CXL4 Uncharacterized protein n=3 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A1H7CXL4_9SPHN  ali  15  6..EKLIANAAKAILRPLGFQRKGQSWFFDHSWWLAVVEFQPSSWSKGSYLNVAAHWLWMDIGT----ISFDFGGRLEGFAEYASDEQFAVVAAGNSAAEEAQRLATMFSSIA-------DTTEVLLEQARTEARQAQAHPYNAGVTAGLAGRTDDA. 156
544 9.000e-07UniRef50_A0A081PHJ3 Uncharacterized protein n=3 Tax=Pedobacter antarcticus TaxID=34086 RepID=A0A081PHJ3_9SPHI  ali  13  1MINKETQEQFAPLMKQIGFEGAGLKYAMETQSFVFVFELEVSKYGIQPTAVLKMGDYETDNIENIAPQSCELTL---QLVRSLKKPYWHIGVDKEENEKEALDIFSFIQKNVLPIMAKYVTKPDLLSKIEPSDLRDKNIMHQKLYGMHPIG...... 159
545 9.000e-07UniRef50_A0A2W6UG39 Uncharacterized protein n=2 Tax=Actinomyces TaxID=1654 RepID=A0A2W6UG39_ACTSX  ali  14  4.TREDVAAHLAPTLKAAGMRKRRYWWYWTGEEVTWAFRILKSPYGGSFDLMCAPLAPGFETPATLKSDDYPL---APFLANWEIGPDVDVGMLEDMGDEERRELLTRFAHMLVDYMRAHSTAESLVRAYAAGEYRPSFIRTEL.............. 150
546 9.000e-07UniRef50_A0A2S8RAG6 Uncharacterized protein n=1 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2S8RAG6_9FIRM  ali  17  1MDKKIIKKYFTTFAEINNFIFYKPTMLRECNDTLHIINFDLPTEGFNCSIAIQPLYIPSDSITIS------FGNRLNHFKAKLPGTW-GYSSDKTIIEKDLSQVKDLLEVNAMPWFDKVGSPEGIISFIESG......................... 130
547 9.000e-07UniRef50_UPI0004831B30 hypothetical protein n=2 Tax=Prevotella brevis TaxID=83231 RepID=UPI0004831B30  ali  13  24......NQRIIDHLATRGFKRKNMNFRKINEDITQSIIFGHSTQGKYYDVRASIELPKVLETAKPISLTALFNSNIGELMNPSTYLEWLVTEDSSESYDVVDSILEHIDRYAIPLLDKFCTVSSIVGEIKKRGRLYRSSDDMNACIALLL....... 179
548 1.000e-06UniRef50_UPI00059DCC14 DUF4304 domain-containing protein n=1 Tax=Shewanella sp. (strain ANA-3) TaxID=94122 RepID=UPI00059DCC14  ali  21  1.MREELKLAVTDYLRRQGFKGSIPFFRKETKGWYQTLDFQFNKYGGSFAVNLSLWEPNNQFLKLP............................................................................................ 64
549 1.000e-06UniRef50_R9HQR0 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=R9HQR0_BACUN  ali  16  21........................TWLCQCDPFVYMFRIEPGKYCDYYTLEIGIYSSDVFALCWGKVPDCCLRGSIFDFFQENGDIEFYEDVDVKELQERINFL---IEKDIIPFFNKIKSFEKLYRFYEEKAIQQELHQIYIACIEYIMNKKNDAL 165
550 1.000e-06UniRef50_A0A1P8WWN0 Uncharacterized protein n=1 Tax=Sphingopyxis sp. QXT-31 TaxID=1357916 RepID=A0A1P8WWN0_9SPHN  ali  12  7.MKASLKRLAIPHLRSIGFRGSFPDFYRYMGDTVECLQFYFDSSDDRFFVHAGLASRDGVEWHRPKATQLIATVRLGAKPGSNNR---WFDFAVQSADSIALDVVSELQ................................................ 123
551 1.000e-06UniRef50_UPI0009FDF96E DUF4304 domain-containing protein n=1 Tax=Chthoniobacter flavus TaxID=191863 RepID=UPI0009FDF96E  ali  22  11....AIKEIVVPTFRNMRFRGSFPHFRRERGEQFDLLTFQFSSWGGRFAAAAGI....................................................................................................... 60
552 1.000e-06UniRef50_A0A0Q7S0D8 Uncharacterized protein n=1 Tax=Microbacterium sp. Root1433D1 TaxID=1736463 RepID=A0A0Q7S0D8_9MICO  ali  12...ELLTGFVAPALREHGWRGSRGRFTRRSEDISEKIEFQKSRASSAQTVLFRINRYRTCNATNEPIPQ---------DDAPVEDRWLMISADGFDPEPVVEQVLEGLR................................................ 109
553 1.000e-06UniRef50_A0A0U3MEG2 Uncharacterized protein n=1 Tax=Roseateles depolymerans TaxID=76731 RepID=A0A0U3MEG2_9BURK  ali  12  10.NRRFLEKVIESQVGPMGFVKQRSVWVLTTEDGYLGVQIQGSRFKGLVYINFMGWYRAISRSDLETFPD-HIHFSFRGHTNEARDALLTLDDSDVEFEAFVEAFKSLFFSRGLAELMGLQTLEAALAAVRRDELEGIFLALHDA............. 155
554 1.000e-06UniRef50_U2E762 Uncharacterized protein n=1 Tax=Haloplasma contractile SSD-17B TaxID=1033810 RepID=U2E762_9BACT  ali  11  8..EKRFIKVVYELLKQKGFKKCGAYYKMENDDIGRSLAFHSAFWGGYFTVEVIIGVVCEWYKKVPKIWPEIVWDMKYFMPKEEQQSWWRVSEE--NYKEVAEYLVAQGLKYSQQYYDDFNSLEKVLDEMNKNP---GHYENILPILLYQ........ 166
555 1.000e-06UniRef50_E4NDQ7 Uncharacterized protein n=27 Tax=Actinobacteria TaxID=201174 RepID=E4NDQ7_KITSK  ali  12.....IRDHFAPALRGLGFQGWRHSFSLPDHERWAVLGVRPGDGRVRYTVNLSVTDKAAWDR-RSIRPDANWHAPIGELLPVGGEVWWEVAPGPRWLIAVEDSV-AAVRGYALPELRRRLRAEDREHYL............................ 142
556 1.000e-06UniRef50_Q2SMB9 Uncharacterized protein n=1 Tax=Hahella chejuensis (strain KCTC 2396) TaxID=349521 RepID=Q2SMB9_HAHCH  ali  17  7..SKIINRVARQTLKPVGVKRKGQSRVWLDDNGWWVIEFQPSAWSKGTYLNVGVNFQWYPKEYFA----FDIGYREAGFVEYKSDEQF---------ESQAQELAELAKAKVLEMRERLSSPRSTKDYVISDHRPTLWGEFHQGMSCVLTKDKNEAI 153
557 1.000e-06UniRef50_A0A1G9C9C0 Uncharacterized protein n=1 Tax=Arthrobacter sp. ok362 TaxID=1761745 RepID=A0A1G9C9C0_9MICC  ali  16  1MTVAEFRRLVRDAMSKAGAARHGSSWIIEGSEMAWIYTL-ESRHGTRFSLMCGVELFMLNEDRRAKNNECRLVFSLEGFSPVAYEVRQAFSLDFDLDDEGRAAEVQRLVSAMTGYCKQRLSFAQLRKSFQSGELDNGFVHFRA.............. 145
558 1.000e-06UniRef50_A0A2G3E652 Uncharacterized protein n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A2G3E652_9FIRM  ali  14  7.MNAALKKYVFQPLLDNGFTGKYPHYRKVYDNRIELLAVQKNKYGNSFTIEISTIFPQQKDRKKNYNDHGVWDTNLRYRLPGTIDGWFYYTD................................................................. 104
559 1.000e-06UniRef50_A0A1U7HKA1 Uncharacterized protein n=1 Tax=Chroogloeocystis siderophila 5.2 s.c.1 TaxID=247279 RepID=A0A1U7HKA1_9CHRO  ali  20  8..NKIIRKILSPVLRGNGFVKTRNNW-ADRDPCIWVLNIRHSFPSVSVSVWLGIYYKDKDGKLIPKEWMCHIRKSLRSSAEANRNDIWWIEPDGSNLEDVIHDIK-------IAFFNSRNSV................................... 153
560 1.000e-06UniRef50_UPI0009DE4C70 DUF4304 domain-containing protein n=1 Tax=Sphingomonadaceae TaxID=41297 RepID=UPI0009DE4C70  ali  12  24MPVKSLGDIFGAILKARGYTKVGRTFRCERQDFTEMLMIQGSSWNWEFYIDVLVAFPDIPLRPTIRGANYHAKGRIDAIVADAPP---SFQLRANDLDRLVVEV..................................................... 134
561 1.000e-06UniRef50_A0A0D0SAM0 TWA4_scaffold00001, whole genome shotgun sequence n=2 Tax=Lachnospiraceae bacterium TWA4 TaxID=1392836 RepID=A0A0D0SAM0_9FIRM  ali  14  1MYKKYVRKLIAPLMKVHGFDKVNKNYYRKKLDVYILIDIQKVRAVPRVTCNITISKDIDGFDVY------DFYRLGDFLEYSGSDIWW--STEESEIEMSFIEISTFMQECLFPALEKLEDEKIVKEYLDNRKLRWSFED................. 137
562 1.000e-06UniRef50_U7TV45 Uncharacterized protein n=7 Tax=Firmicutes TaxID=1239 RepID=U7TV45_ENTFC  ali  15  7.KNKVIQQVIKPALKEAGFHSLRGTFSIHKEACTIAVNIQSSQFNSNFWLNIVVDTPDLSDEQFKSFTEACFLPHQGRLHPLRDIRGYVIDGYKNYYEEIQAIIANDMQQYIIPGLSQIDSIADCVALWQEE......................... 159
563 1.000e-06UniRef50_A0A1H5HP76 Uncharacterized protein n=2 Tax=Arthrobacter alpinus TaxID=656366 RepID=A0A1H5HP76_9MICC  ali  11  374...ALIRRYLAPILKQHGFTGQGRTFRREFTDRVDVIAL-GSVGLDQLRVEYGSRFATSWPSFNADVIGSVLDIRISEYHGVSQ----------PEIDTVALRLA----THIIPFMDSMGRYE-LVAALAEHR........................ 488
564 2.000e-06UniRef50_A0A2V9W9B2 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9W9B2_9BACT  ali  17  8..KKRFLSLLEETLKEEGFTITGISFIRDRRDVRHFFDLAVTKKEDNVEVNLFVGVRFDAVERKVAAYECHLRRTLGIWLGWSDDGTWKIKDERSLLKAL-KEVTDIFRTTGIPFLEKYSNPEEAIRVLAADD........................ 157
565 2.000e-06UniRef50_A0A0Q6Q5Z6 Uncharacterized protein n=2 Tax=Devosia TaxID=46913 RepID=A0A0Q6Q5Z6_9RHIZ  ali  16  15...RMLHREIDAILAPAGYVQAGGRWSRTTAFARTWVEIQRSSSGLACYLNLG-RLQRLLNWEWVPPGTYFSGWRIGDFADSTAEHYDQLDGDSP----LRAKVMALLSERALPFLKASHTP................................... 135
566 2.000e-06UniRef50_UPI000D6C0CD2 DUF4304 domain-containing protein n=1 Tax=Acidovorax sp. GW101-3H11 TaxID=1813946 RepID=UPI000D6C0CD2  ali  20  12.....IRKYLLPLLKNDGFVGSGRTFRRIDNDAIHLVNVQ..................................................................................................................... 46
567 2.000e-06UniRef50_T5KW63 Uncharacterized protein n=44 Tax=Gammaproteobacteria TaxID=1236 RepID=T5KW63_STEMA  ali  17............ILRPLGCKGRSRTWLDDQGWWVGVVEFQPSAWDRGSYLNVG----ACWLWEEKDYLSFDVGGRVAGFQPFT---------ETAEFSSAAQTLAEQAAAEVMALRDRFPTPGHVRTLMSHHPKPGIREHIHAGITAGLAGAYDE.. 148
568 2.000e-06UniRef50_A0A1C3ESK5 Uncharacterized protein n=1 Tax=Enterovibrio pacificus TaxID=1080227 RepID=A0A1C3ESK5_9GAMM  ali  7..KKALYKQLGEALSPFGFSKRQGSLYRKTDYGWQAIHVPCANYGTNLRAKISCSVRANNGETKSQLNTGTVGASLVDLFPEVTLTWRLWS--EDDIAQVVEGVVFNLERLCEPLFERFSTLEPTYQMAIRDDKESWLH.................. 154
569 2.000e-06UniRef50_A0A2S8FMC4 Uncharacterized protein n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8FMC4_9PLAN  ali  15  1MKAKQFKEAFGSMLQDFGFTSRGCTFYRRNDDLYHLIIPDLLRSGERYDVMVFPFCPRLDPLFSEKFPDGIPTGSFCYLAPSGVGPDQTL-FEASSEERFFSQVAPLLKTMAVGYLDQVQSLENMLPLIRS.......................... 144
570 2.000e-06UniRef50_UPI000D6E8F64 DUF4304 domain-containing protein n=1 Tax=Leucothrix sp. IMCC9719 TaxID=1481894 RepID=UPI000D6E8F64  ali  18  17......KSRFRKMAKELGYEQSGINYIKQRDGWFEGFSLQASSYGNFFYINYGISVPNLWEPFDEEINLKNLGYSLSHRLHHNSGQGFP-NGTKVQIEESVDLAIEKYMEQASPWFNKINGLTDITEMY............................ 140
571 2.000e-06UniRef50_A0A0N0CGM4 Uncharacterized protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A0N0CGM4_9ACTN  ali  11  1MNDSLIREYVAPAAKSAGFRKKGRGFWTVGGHRYALLTFQVYAVDPEATV-FDVEFHAAPEPYWDWVYRGHVAHRPDEGMPFRTR--WAMRPEG--EDACGRALAETLRAKVLPQIQLMTDRAHLLDVVRSGDLMKRMTPLLREIVL.......... 171
572 2.000e-06UniRef50_E7SCP7 Uncharacterized protein n=17 Tax=Streptococcus TaxID=1301 RepID=E7SCP7_9STRE  ali  17  2.......KEAKELFVKNGFSRRTNNYYKINHDFYTVIYFQRKSDGTAYFVNIGIHPLFL-DSGLLEEVDCALRTRLGSIDHRNGMEQ--------------AELEKAVQE-AIDFTAQYSSYSTVFSSIDEKDWLLKQFSITKVNLCRLYVEYYDAI 142
573 2.000e-06UniRef50_R9IDK7 Uncharacterized protein n=2 Tax=Bacteroides sartorii TaxID=671267 RepID=R9IDK7_9BACE  ali  14  6..KKKIKGLLNDRLSEYGFQPKQDWFRLVDDNVFQIIDYGTASRGEKHVINVNKYTIICNDYDYVKLHAAMVGKTLGELLPQKEYKSWRFALNDDVIQQNVDEMVNLVVQYGFPYLQKLLDVDFLIEKMYKYRTLIPIF-------YYLYGRKEQAL 168
574 2.000e-06UniRef50_A0A1Q6JBE1 Uncharacterized protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1Q6JBE1_9FIRM  ali  29  1MDTKNFKNLCDRLLKKYGFKKKKTMYYKDSNDGIRCVYLQRSYYGKVYYFNYYYFLDNSDVKVFPQYFEADVYGRITVLSK............................................................................ 82
575 3.000e-06UniRef50_A0A1S8RS49 Uncharacterized protein n=1 Tax=Clostridium beijerinckii TaxID=1520 RepID=A0A1S8RS49_CLOBE  ali  22  23MLHETFDNVIVPGFKEKGFRKNGKTFYRKRDGLTEVCNVKFSRDNSRFWLHVCIAMPSFYD................................................................................................ 87
576 3.000e-06UniRef50_UPI000DB94B3F DUF4304 domain-containing protein n=1 Tax=Pedobacter cryoconitis TaxID=188932 RepID=UPI000DB94B3F  ali  15  1MSSREVFNQINEGLTEFGFKQKGATLKKISSEFTFEISFQSSALNSSGHVNLLPHVLITAKRLKKWSNDIIYSNQLGYISHFQDWKSWNVSGPAQG--KTVPEVINTIKNYVIPIFNHFEDINGVIRFLINNGT....................... 149
577 3.000e-06UniRef50_UPI000DEBC786 UPI000DEBC786 related cluster n=1 Tax=unknown TaxID= RepID=UPI000DEBC786  ali  15  22..RKSFKLILEPAMAEAGYVVDCPNFRRDRGDTLDVVDIQFWKEGGAFILNVARYVGPLEGLNGFSVPRDRIQDRIGPTKSKRMEKWYKFDDDQDSLDKLSEEVVGL-----LPQLEAWL..................................... 149
578 3.000e-06UniRef50_A0A223V599 Uncharacterized protein n=1 Tax=Maribacter cobaltidurans TaxID=1178778 RepID=A0A223V599_9FLAO  ali  13  25...KIIEKIVEEKLREIGFFKSKNDFYFKHLDVEAFISFHTS---MNFTGTILSYNPIIGFIHKEVEKICTWTESLGYLTKKNEYITWKFKLKSSERAILVDSMMSTIRKSALPELELCCNDEYLFEVLDKHKGLQINNRIKAPILLLVMNKKNQAL 195
579 3.000e-06UniRef50_A0A1M5UJS6 Uncharacterized protein n=2 Tax=Massilia sp. CF038 TaxID=1881045 RepID=A0A1M5UJS6_9BURK  ali  15  32MRKEVLVEGLQPLLQAEGFRFSNGTAWRRNERWVDVVQIQFSAHSPSLHVGRYFNFIPLRDPGNPLRWHCHIRKTIYKPVRDKPPQTWLIGPTGEGLEQCIAQALILAQSHILPWCLWLDDLDAALQLVLNR......................... 185
580 4.000e-06UniRef50_A0A0H5CRT1 Uncharacterized protein n=6 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0H5CRT1_9PSEU  ali  11  16....MVETGLAPGLRALGLSGTGRRYRMVRDAHVAQVSILQSNLGTRFTLALSVAATDEWSSQLRIRPYMGWQERIGNLILVGSDLWWQVDVGKPFG-SLSREVLSAVREFGLPAMDEIRSR................................... 149
581 4.000e-06UniRef50_R6DG31 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:530 TaxID=1262741 RepID=R6DG31_9BACE  ali  12  6...KQIIHIVTERLNNYGFIKRGDFFVREKDDNVQQIEFQTRYYHPIIIPYVGVLYKDEFNLLR-KYFDFHWSTYSNALMNMMDRIDWEF-AKGDDITPILNNMIESIMEIGISYIDYISDRKNLISEMENRKIGKSTSLKALPIAYYLEGRKDLAL 168
582 4.000e-06UniRef50_UPI00093365A2 hypothetical protein n=1 Tax=Jatrophihabitans endophyticus TaxID=1206085 RepID=UPI00093365A2  ali  15  1MNSAELVRSIADGLMSQGMVGRHASYYRRHRELIWVASPRTIFNGSRVAVDLGVSARLLFPGEWPTDAQCQLHTSFERLGGD........................................................................... 82
583 5.000e-06UniRef50_A0A0C1E8E3 Uncharacterized protein n=2 Tax=Parachlamydia acanthamoebae TaxID=83552 RepID=A0A0C1E8E3_9BACT  ali  24  20MDNAEFVKLYCKIGLLNGFTKAFGCLWKESNECIVMLELQKSNYGNYYELNVKIFVHGAFGDIHRKSKDGHVFTRSPSIYGEALDLDTPIDLE................................................................ 117
584 5.000e-06UniRef50_UPI00082A458A hypothetical protein n=1 Tax=Rubripirellula obstinata TaxID=406547 RepID=UPI00082A458A  ali  16  1MKSREFREVFGNVLAPHGFSSKRCTFVRTHGD--DVFHVIMPDPGTRFTWYVSVFPTS-------PRLHLDFHDRFPDDLGNTLDVWGKLNFNCKTEDNFRSRVAPLLVSAAIPFLDTIHTYDDLLPHLR........................... 144
585 5.000e-06UniRef50_C4GEN7 Uncharacterized protein n=1 Tax=Kingella oralis ATCC 51147 TaxID=629741 RepID=C4GEN7_9NEIS  ali  17  3.DAKTFLKQLRATLKQHGFQRNANNYFHRAEFLLCLFTIQKSMYGGQYYFD--VYYRLADDDPKEKNYRALWFGRLESLFATEHETIRSIDFD---DPALVRQFAPQFLARLPAIADDLAAWTDTTAFLQRFGGDFSAEQQAAIAAHT......... 145
586 6.000e-06UniRef50_F7JVH8 Uncharacterized protein n=8 Tax=Lachnospiraceae TaxID=186803 RepID=F7JVH8_9FIRM  ali  16  138.KRKKWIDKIAEKLKPLGFKKKANTWKRVLEDGYYLFHAQKSSFSDEYYFNVYIGKENTDF--------------YGDCYYNRIVTDCPLDWQTIADDEMIKFLENDVVSQLMHIID........................................ 240
587 6.000e-06UniRef50_A0A172TXJ0 Uncharacterized protein n=1 Tax=Flavisolibacter tropicus TaxID=1492898 RepID=A0A172TXJ0_9BACT  ali  10...KYIQNEVKAFLGSFGFKKTFILYRTTDNDLLQFLSFQKGASSLSNQMTINIVQKGLFAPG-CSFDTLQPGNRIGQFAKTEKDKWWYCD-DANKVQEGVAEIKYILYNSVLPFFE........................................ 123
588 6.000e-06UniRef50_A0A2N3YQU9 Uncharacterized protein DUF4304 n=1 Tax=Flavobacterium lindanitolerans TaxID=428988 RepID=A0A2N3YQU9_9FLAO  ali  29  28.................GFKRKGNSWVLNGNEINKIINLQKSQYGNVYYLHYNYVINSLPLNNRKVHIDNQLG---SIDKEEQAMIQGLLDLESDIDADRLIKLFEVINKKIVPELNQYR..................................... 128
589 6.000e-06UniRef50_UPI000DE864CF hypothetical protein n=1 Tax=Roseimicrobium gellanilyticum TaxID=748857 RepID=UPI000DE864CF  ali  15  9.MNKAIKAELVPALNAAGFIGKYPRLQKFSGDYIYFLSINQNKPGTAFFLEFGIHPRGEKLTSW............................................................................................. 71
590 7.000e-06UniRef50_A0A100VJV2 Uncharacterized protein n=2 Tax=Paenibacillus amylolyticus TaxID=1451 RepID=A0A100VJV2_PAEAM  ali  20  1MNTKDFRKYFAPKLHEVGFMGTDHHFVKTTDNFIYTLVIQADKSGGFCVMEMGVHLNFLPNSNEMTTYDCEFRKR.................................................................................. 87
591 7.000e-06UniRef50_A0A0Q7X6Z7 Uncharacterized protein n=1 Tax=Duganella sp. Root1480D1 TaxID=1736471 RepID=A0A0Q7X6Z7_9BURK  ali  18  6..REAIKRYFYPYAESQGFKRQFTSFRRFQGERIHVFDVQWDKYGPRFIVNFGEANVNNVGVPKMEVETQHCNHMYRLQRKKGGSYSCWFQLRKPWLEALSEEVVDQLIAYFL-EMEAWWS.................................... 138
592 8.000e-06UniRef50_UPI0009E6783C DUF4304 domain-containing protein n=1 Tax=Frondihabitans sp. PAMC 28766 TaxID=1795630 RepID=UPI0009E6783C  ali  19  46..RDMLRLDVAPALRELGFTGSGLDWRKRNAHAWAIINVQKSAWGDGGSVDAYVNWVCP.................................................................................................. 103
593 9.000e-06UniRef50_A0A2E2ZXF4 Uncharacterized protein n=2 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A2E2ZXF4_SPHSX  ali  17  1MASKSFRKVIAPRLAELGFRRFGTRYVRPCPPFVQGLALIQSKWNGSGYCRFSFLVTRSLKLGVSHEGLAERARRDGTLTEVRADFQYYLPDDAAGIEAAQREALADIERYALPFLR........................................ 140
594 9.000e-06UniRef50_UPI000B9118CB DUF4304 domain-containing protein n=1 Tax=[Clostridium] straminisolvens TaxID=253314 RepID=UPI000B9118CB  ali  35  2...KKFKKVLTEVLSEYGFEIKGNIFRAETRELIAVVATQKSNYENSYYINLGFLIK.................................................................................................... 55
595 1.000e-05UniRef50_A0A089L088 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL R7-0331 TaxID=1536773 RepID=A0A089L088_9BACL  ali  7..RNLIKKYLAPALHELGFSGTDHHFVRVAPNLVNTIVIQADKDGVSCVVEMGVH...................................................................................................... 60
596 1.000e-05UniRef50_A0A2E5S5G0 Uncharacterized protein n=1 Tax=Leptospiraceae bacterium TaxID=2026757 RepID=A0A2E5S5G0_9LEPT  ali  13  1MTTKALNELLERNLRPIGFKALKDRWEREAEGFVQKVWMAKGTFGLQFQVKFGVLFEELKAERGKLEAD-IFFEMYYQARDNQIELNRALTFDFPMEDDLRIRIIEDIRLRLCPDLEKFRSRAAIKEKAEKDSLFRMLMLPKVLRILGL........ 155
597 1.000e-05UniRef50_A0A1Q4G7Z9 Uncharacterized protein n=1 Tax=Sphingobacterium sp. 40-24 TaxID=1895843 RepID=A0A1Q4G7Z9_9SPHI  ali  24  11...RIIKESFIEILKPLGFKKKANNFYLQLEKIGHIINIQKSCY................................................................................................................. 51
598 1.000e-05UniRef50_A0A0F8QG03 Uncharacterized protein n=2 Tax=Methanosarcinaceae TaxID=2206 RepID=A0A0F8QG03_9EURY  ali  11  15......KKYIGDIMEEEGFVPYKTTFIRENNRLLQYIGFPSGKYGGYKILHVGHLPLFMPHKREDIASEIAGGMHNDAPYGWSPLSWDFPKGDKEMAEQSMIGIRSVILKHSLPYLNKYSTFSDTLQMLEKDDVDVVPPGYRRLRARK......... 159
599 1.000e-05UniRef50_UPI000D7CCAFD DUF4304 domain-containing protein n=1 Tax=Arthrobacter sp. RC1.1 241 TaxID=2183924 RepID=UPI000D7CCAFD  ali  19  26..RAMVPAELAPELRGLGFRGSGTRFELPSATHWLLLGLQRSTSCSPFTVNLDVGYLCFLLYVRRQDWNCCITDR.................................................................................. 102
600 1.000e-05UniRef50_A0A220MFQ0 Uncharacterized protein n=1 Tax=Brevibacillus formosus TaxID=54913 RepID=A0A220MFQ0_9BACL  ali  29  17....MIKQDVKPFLSNYGFAKKGLNLNQKTESLIYMFNFQKSAGNAMFYVNCGIYAVE................................................................................................... 74
601 1.000e-05UniRef50_A0A0Q8TGX6 Uncharacterized protein n=1 Tax=Acidovorax sp. Root219 TaxID=1736493 RepID=A0A0Q8TGX6_9BURK  ali  18  1MTGAEFKRGIYRAFERAGFAKQGYALQVPGDGATTLVDAHK-GFGDQWFINAGFCLHRLASEPADRVEKAHMYFRLERLFPEHQVL--ILDLEDPRQPGAYPLLLELLAGDIGAGLRALGTEQAIIEAYR........................... 130
602 2.000e-05UniRef50_A0A1E3L121 Uncharacterized protein n=1 Tax=Paenibacillus sp. TI45-13ar TaxID=1886670 RepID=A0A1E3L121_9BACL  ali  10  13.TIQQIAERYQPLFK---YLKSKKCLRQKSGDFTFDISFTGSKYGEFVSVETAIAPPDAN---------CVFISPIVNLTRKYKNIDSYHVITISERERVIEEICRYIDDYVLPFFARFEQIEVLSQEVSTQGFLPHRKNWDRFSLTTK........ 151
603 2.000e-05UniRef50_A0A1V5L037 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium ADurb.Bin474 TaxID=1852931 RepID=A0A1V5L037_9BACT  ali  1MKTKAFRQVFGGWLQSEGFLYVGGEYERKGLTCFHSLAFQKNSDFFDFSIGCGIRMPYVNELIASEYWDGHVGLPINKLIGRDYLVAWPY-HDRSDLEKIKGEIVTIILSHCYPFFDRYSDPNELFMWMSSADNNHWFMH................. 148
604 2.000e-05UniRef50_A8STU0 Uncharacterized protein n=8 Tax=Coprococcus TaxID=33042 RepID=A8STU0_9FIRM  ali  14  8...KSLKAAFKETLEPHGFKKRYPHFVRMTPEIIQVINYRGSIYRPEINLNRSVYASMDWHTTMPHMYMKAKRNEITVYENEQPGVDYIIKGDEASLREQIAFAMTGIEHYIIPAFDKVVDLKTCVDYLELYDSMCLTVWNR-----YQFENSEEAL 182
605 2.000e-05UniRef50_A0A2U8E312 Uncharacterized protein n=1 Tax=Ereboglobus luteus TaxID=1796921 RepID=A0A2U8E312_9BACT  ali  46.............FEPRGFSKSGPHFTAKSRDFTYRISFQ-SSHNNIPGQHIRLLVHTSISSPVVKKWETALWARHGYLAEPGKRAWWELAHE-HTRAAAIAEVTDRITRHALPWFAQCEDIPRLVRIVETGVFPDCHVENFPAELLLCFASREQT. 208
606 2.000e-05UniRef50_A0A2W6BDZ6 Uncharacterized protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A2W6BDZ6_9ACTN  ali  36  7....................................LQLQKSQYGLRYYINVALWLLALGEAQFPKERTCHVRSRLSRVLGRR.......................................................................... 53
607 3.000e-05UniRef50_R5D3S9 Uncharacterized protein n=1 Tax=Firmicutes bacterium CAG:555 TaxID=1263030 RepID=R5D3S9_9FIRM  ali  16  1MNKVEFKKLCSECFIRHGFKEQNGRFYRHGPDIFCAAEMQRSDYSEAYYINFSFLTKSECAEPYFFRRVKVKSVSMHSSIGLRLMTDMIIIADY-TPEEILNYLNAAFDEWIMP........................................... 117
608 3.000e-05UniRef50_UPI000524D674 hypothetical protein n=1 Tax=Dactylosporangium aurantiacum TaxID=35754 RepID=UPI000524D674  ali  13  50................RGFTGSGR-LYRLDDLVFARLGFQSSRWNSECTVNLMVVGRAHWAGHRAAAPHLPWWRRLGHLMPVNGDTWWTVT.................................................................. 142
609 3.000e-05UniRef50_A0A2S8N8S7 Uncharacterized protein (Fragment) n=2 Tax=Mycobacterium TaxID=1763 RepID=A0A2S8N8S7_9MYCO  ali  15  1....MLSGAVDEFLSERGFERSGHDFERHRGPLRDRINFQNNWHNGVFFVNVGVGSVEVDAACPGHEP......................................................................................... 69
610 3.000e-05UniRef50_A0A2V4WFQ3 Uncharacterized protein DUF4304 n=1 Tax=Paenibacillus sp. OV191 TaxID=2135473 RepID=A0A2V4WFQ3_9BACL  ali  19  10..SEMISNIFEPKFLEQGFKRSKNDFIRETEGIQQVCGVQKSRANSSIFASFHV....................................................................................................... 61
611 3.000e-05UniRef50_I2NVB1 Uncharacterized protein n=3 Tax=Neisseria TaxID=482 RepID=I2NVB1_NEISI  ali  18  6..EKIFFKELRAILKKNDFLKLNTLNYFYNNSYIQCFNIQKSKYSKQYYFNLCAKKTSPDISPKEISWGADLILRLENLFPKYSFLIKGINFDENKDKQNYFDFLNLLDTYFLIEIKKLTNIEIFENYIK........................... 134
612 3.000e-05UniRef50_UPI0005902DE1 hypothetical protein n=2 Tax=Psychroserpens mesophilus TaxID=325473 RepID=UPI0005902DE1  ali  18  53..................FRKSDLRIKRKDGDFEQSLKFITNHKNYKFEIILLVYSKKLETWRAENYSDKSLRERLKDWNQQFEKGWYKLHLDDN--HKIVDEIINNIINVAVPYFSQYESYDQIIADFNKNPITNFIDLIDINLMQGKYQD..... 199
613 4.000e-05UniRef50_A0A0Q0VTK1 Uncharacterized protein n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q0VTK1_9DELT  ali  18  11.......................QTFHRFTPDVIEIFSIYFNTNTASFSLNLGIYFNFEEKSEFPQEYHAHIRTRNFYFHPERFRRDWWVDGDGSNLKSVTVNAVKRINTKADPWFNRHSKVDYVLKYLKTKPEQEPH................... 151
614 4.000e-05UniRef50_A0A2T9XPK9 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A2T9XPK9_9CELL  ali  16  24..KAALRDQLGPEARRHGYEGSPPSWRRASEGDWAVVNVQSSSFSSPCVVNLSFAPEPWWMAEWVSESLGLYRERHPEGTPAGTDGWWEVSD................................................................. 129
615 4.000e-05UniRef50_UPI000560B59B DUF4304 domain-containing protein n=1 Tax=Paenibacillus sp. FSL H7-689 TaxID=1227349 RepID=UPI000560B59B  ali  18  1MNTKDFRKYFAPKLHEVGFMGTDHHFVKTTDNFIYTLVIQADKSGGSCVMEMGVHLDFLPN................................................................................................ 66
616 4.000e-05UniRef50_A0A2B3LEM8 Uncharacterized protein n=7 Tax=Bacillus TaxID=55087 RepID=A0A2B3LEM8_BACME  ali  14  1MKPKEIENELVSLLEPLGFKKSGPKFSRKTGPFTLSFSFFTSKYSCIFWTAWSILSKDYKKWYKKIVSDVIIGSSDWNIPNWLEGKHDHVVLYNSDVDQEFKRFIHNVLNVGIPYYEQIIDWSTAADLALQAPF....................... 151
617 4.000e-05UniRef50_UPI000DAE7800 hypothetical protein n=1 Tax=Spirosoma sp. HMF3257 TaxID=2183553 RepID=UPI000DAE7800  ali  16  1MNSKWVYQSLEKVLRPFGYTGRKGFWIKNTSNSCLLIEFRKPFYGGKFTIVISVYYKDLKNMSFDRGHILNFGVR--MLSDVPIDIESLMDMNSLVDFNERERVETLLVSYVAPMLEKMDTISGLVEILNEQHNLKYHITTPLQNMIHNEGYSLD.. 168
618 5.000e-05UniRef50_A0A1D3DDC8 Uncharacterized protein n=1 Tax=Shigella sp. FC1655 TaxID=1898038 RepID=A0A1D3DDC8_9ENTR  ali  15  3........AFSQFFIKQGFRKINENNVFQTSHFYKSINLQRKSSGDKYFINLGVSPIIPNLETFSKEIDSIIRFR---IHPQGD-----FPIETINSHDFFK---SLFESRITDFFDNFISLDDVLNMIENRTLPNYLMHTITQTTLSHV....... 140
619 5.000e-05UniRef50_A0A0Q8UM76 Uncharacterized protein n=4 Tax=Caulobacteraceae TaxID=76892 RepID=A0A0Q8UM76_9CAUL  ali  16  1................................MWECVNRQSSRLGG-VTVNLLMKDLETEKLFLSIFQMPPIDTRLGAL-IDGYDRWWK--REEVNGP---SEMAEAVVQYGLPWFDRVRTLEQQAENWLSERGYHGPSLVGLALTLHRMGEGEEA. 129
620 5.000e-05UniRef50_A0A1C6UX24 Uncharacterized protein n=6 Tax=Micromonosporaceae TaxID=28056 RepID=A0A1C6UX24_9ACTN  ali  14  10.....FVEDLAAQLAGYGFEQGGLVFRRFSPDGALIVEVQISEHSSRFYLNVALVLAPKWGWDRPWHENGIWRRRLGFTRLSPAGGQWRI-ADDDTAYEASTLVRQRLDERILPLLNRAVVLDQTVEVLGPGDWLLRAWLLAEWGPIEELRHLL... 177
621 5.000e-05UniRef50_S6A8H3 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=S6A8H3_9SPIO  ali  11  1MNNKIINAVAKNVLAPHGFRGASRVWLQDNGYYITQVEFQPSRWSKGSYLNVGISFLWESTEGLNSVLAFNFGYRVNGIFFVD------YTGDDVRFEKEIQNLAQKSLGKVIEY-EKFRDLEYAKKALVKGEKNPLWQDYDLIMLCFLKGDFTEGL 154
622 5.000e-05UniRef50_A0A1H7FCX0 Uncharacterized protein n=3 Tax=Aquimarina TaxID=290174 RepID=A0A1H7FCX0_9FLAO  ali  15  1MNNESVKDKVGSFLIDKGYTKRGKNFIRKEKKREEVISFSSRKGRAPHTITSGIYYKEVNSLDKKIIQDFIITGSISHFKDTDNNFISIPINNSDQVESIANEIIENIKDGGFNLFNKFPTLESILDGIEKKEWLNDYHKFIKAAMSLLIKDKDTAI 181
623 5.000e-05UniRef50_A0A2I0QM24 Uncharacterized protein n=1 Tax=Candidatus Altiarchaeales archaeon HGW-Altiarchaeales-1 TaxID=2013673 RepID=A0A2I0QM24_9EURY  ali  16  38..NKVIRMIFSPVLRENGFSSTRNNWGW-HEHSIWVLNINTGWPPMSIVVNLGVYYDFIPEEFPPKEYECHARASLSNPAETKRRDIWWVKPDGSNVEEVVTNIKDSFLNSGVEWFRKLSDLEYVFNAFEDR-----QDYYKAAFFAKHFGCKDK.. 239
624 5.000e-05UniRef50_A0A1S2GY45 Uncharacterized protein n=1 Tax=Curtobacterium sp. MCBA15_001 TaxID=1898731 RepID=A0A1S2GY45_9MICO  ali  20  23MDN--VIGLFDQSLRAEGYRRKGRRWFVEKDEFRVAFYVLKSRFGAEYFVDIELTLHGSQDV--------DVSTRVDYWTG---DVGLSFRADDPL---LQTKISDFIEQQAMPLVRRLN..................................... 126
625 6.000e-05UniRef50_A0A1H9QJC9 Uncharacterized protein n=2 Tax=Sphingobium sp. YR768 TaxID=1884365 RepID=A0A1H9QJC9_9SPHN  ali  44.......KAIADHLVEDGFRKSGPDLIRKAGDLTFRIHFQSDRNGRRAAIWIHAVASSDHLAEWRLAHPLPWGGQIGNLLHHPKWMEWDF-ANPHKRQHRINDAAATIRA