current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60681605|ref|YP_211749.1| hypothetical protein (BF2124) [Bacteroides fragilis NCTC 9343] (Range: 1-361), from B.fragilis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# E-value Template Links and tools%idFirst MKPEKTAPVLAITPNEQIFLPKCYHRIQDICAVIYDQLTEIYKEKNYQDLYHTESILDGSETGMDELNKNKIHAIDWLTWNNKNKDLELILTKHIILSITSDFINFVFESLYCAKRGKITVAYALIRKPFTDELLILEQLLYNRSDFIYRFFHSDTVETYDPSSKNINKVDVIKNAVDCLTNPLFDADFVHDLRYNKLCEYGINGISNHALHIVTKNKNYRTEPQNFNFVFSQEEDFALYYKQYYWVVPYILIYAVDIIDKLIFSILKDTDNQNLSIVKRLRRTIGFSLFTESYLRTKKDSIFILFNKKIRFTCPICKNKYFLKRDDYEFFFETEAILCPKCNNDNLTIENIQKIKNIIGLLast
1 0.000e+00UniRef50_A0A149NCE9 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A149NCE9_BACFG  ali  100  1MKPEKTAPVLAITPNEQIFLPKCYHRIQDICAVIYDQLTEIYKEKNYQDLYHTESILDGSETGMDELNKNKIHAIDWLTWNNKNKDLELILTKHIILSITSDFINFVFESLYCAKRGKITVAYALIRKPFTDELLILEQLLYNRSDFIYRFFHSDTVETYDPSSKNINKVDVIKNAVDCLTNPLFDADFVHDLRYNKLCEYGINGISNHALHIVTKNKNYRTEPQNFNFVFSQEEDFALYYKQYYWVVPYILIYAVDIIDKLIFSILKDTDNQNLSIVKRLRRTIGFSLFTESYLRTKKDSIFILFNKKIRFTCPICKNKYFLKRDDYEFFFETEAILCPKCNNDNLTIENIQKIKNIIGL 361
2 1.000e-95UniRef50_UPI000375E2AF hypothetical protein n=1 Tax=Rudanella lutea TaxID=451374 RepID=UPI000375E2AF  ali  39  1........MLLIEEGQQSHLPKKYRPVNNLCAVIYDQFTSILTQKHFLEHINVEIAIDANQQFVEDLQNGSMHALDFMKANGQHIELAEILTKHITLSVLSDFANFMYESLSCAQRGKMTVAYALLRKPLTDELVIFERLLTNPAEFIQLYFHVGNPKGYDPSEPNLNRQQIIQEVFRMNPGPLFVPDLVYGLRYDKHNPAGINGISNQALHIVTNHPAYRTEEAELNFVFSNYHDYRRYWRHYYYFVPYLLIYAAHVVDELVFSWMPGYE--HLKAVRAFQRFVGTLFWGGRRTKASQQLLMQAISESLSGICDQCGKDHTIDEADLTLFFNEQLLLCPHCLCNHMASETIERIMDLV.. 358
3 2.000e-95UniRef50_A0A0D8CVX1 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A0D8CVX1_9GAMM  ali  21  1.....MSSLGIINAERLMLLPEKYWKSHEFCFYLHDKLATMLVEYDAHGVQDMVVDAFHEAAKGKEDKLSDINLLEFMKENKLVEPYKHHLVSHTVIALTSDMLHFLYEALSCFEKRKFSVAFSLLRKPLKEHLFFLSWILADEDDFVSRFEANNHVSFSGVTKET--RIDIIEKAIKKLHGDAFDAEMIWNYVYSKKHENGFEPTWQRATHLTTSQGELKTEDYSLNFIFEDVFD-DYYFEFLSKNLPYIFLYITQVTLECFNRIHEVNDKTASHLI-----LTMMGCYEALFLDGRGMSISKMLQKKLGLSCMHCKSDFKINKSNAPSLYLHEFFVCKKCGLKS............... 337
4 1.000e-93UniRef50_A0A0X3Y7G8 Uncharacterized protein n=1 Tax=Rheinheimera sp. EpRS3 TaxID=1712383 RepID=A0A0X3Y7G8_9GAMM  ali  28  3..................NLPDKYRFSHEFCFFLHDQLLEALKSGEKASIFHHEIKMRAHEISAIEGL-SGESLLNWLEENGHKDLVLILYYKQICAALISDMLHFIYEALQCSKKGKLTVAYALLRKPFKENLFYLEWLLGDPVNFLSRFDLGNIKELSINSALNEKKIEIIAKALNKTSGDWLSAEYIYALRFDKKFEHSLEPLFQKANHLVTTFRFLETEGQNFNFVFSDHDSWESQWNHLYTFLPILLFHAVEVFEALLAKFATRADGFDLTGIR---TLIGFAFWSDCELEFDHGALFTEIRGKLNLLCETCKTPIEFDDQQLLNLYEDYLISCNKC................... 328
5 2.000e-93UniRef50_A0A259D303 Uncharacterized protein n=2 Tax=Nitrosomonadales TaxID=32003 RepID=A0A259D303_9PROT  ali  25  2..............DGISHLPEKFEFSHWYSFFLHDQLVETLKSAEEADVFSARIQFKDDSHAKAVEGLSSEEFILWLEHNGYKEEVLVLYYKQLCAALLSDFLHFIYESLKCSRKGKLTVAYALLRKPLKENLFFMEWLLARPDDFLERFEKENPHRFRLPFSEELEHIAIIEAIDNTKTGRWMTPEFIHELRFKKNSPISLEPLWQKANHLVTTFKHMETEECNLNFVFSSSDAYHSQWTGYYQFVPILLFHSVEVIEALLKRFARRENEEADLM--PLRTVAGMMLYLKNPDMAETISNFGASLQEAGLNCPKCGEAFQFHQKNISLFYESGSLECEHCGE................. 338
6 1.000e-92UniRef50_A0A2N7QRU4 Uncharacterized protein n=2 Tax=Dyella sp. AD56 TaxID=1528744 RepID=A0A2N7QRU4_9GAMM  ali  20  27.........GLIPRNRLQWVPPSARLAHEYCYFLHDACVQMLAEYEKARAHLVRFKFDADEADEFERLANEVGSVEALKRLGRLDEARRVAINTITMGMVSDCLHHIYEALRCMERRKVVVAFNLLRKPLTDSLIYLAWMLGDEDGFYEAFSKQSPAGLAPKIVGNLRQAILQTALEKTALKGVIQSDWLHAVLFKDDFERGLYKILQRAVHLITVQRAVRTEPENFNFIFKNYADDDS-YDGLYEVLPPVLLFLAHVIEGLYDRMKAMDPGARTAF--QVRTIMSMFLLSDDPKRINETRKILVKLSRI-LACPNCKKPLILTQHNMARLLMRESFRCTGCRTV................ 360
7 6.000e-92UniRef50_A0A1I7I1F9 Uncharacterized protein n=4 Tax=Pseudomonas TaxID=286 RepID=A0A1I7I1F9_9PSED  ali  21  6..............EDNTVLPEQFHAAYKFCFAAHDVAAQLLVSGMKQGIFVTNISFNGEHEKNAFDQADD--LIDWLKQSGRMDDEVDVLVTMAFPAVLSDMLHCIFEALEASRKGKLAIAYMLLRKPFQESLYLLESVVADKKTFAKMIADDPSKLRPQNAGGIDGHTRRIQKVLEIIGTSRLDANYIAKLRYDKTERDSFDGICNKAMHLFTEHKAIKTEQYNINFIFSQKDQALTQWAFLYSRLPYLLTYIVSLVEHIAERFAQTHPTYTQDMSRRLAALLLISTPQVAP-DYQAEPLTHLVLATYHWLSEHC............................................ 306
8 1.000e-91UniRef50_A0A179RUX5 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A179RUX5_PSEPU  ali  21  11...................LPQQFHDAYKFCLAAHDIVAQLLVSGMKQGIFVTNLTFNDEKDLVN--LEQADDLIDWLKKSGRMNDEADVLVTTAFPAVLSDMLHCIFEALEASRKGKLAIAYMLLRKPFQESLYLLESVVADKASFAKMIAEDPARLRPQNAGGIDGHTRRIEKVLEVIGESRLDANYIARLRYDKTSRDSFDSICNKAMHLFTDHKAIRTESYNINFIFSQGDQVLTQWAYLYSRLPYLMTYIVCLVEYIAERFAQTHPTYTQDMNRRLAALLSNAQITEGYQAEQLSHLAEMTYCWLSNHC............................................... 306
9 1.000e-91UniRef50_A0A2M6XP13 Uncharacterized protein n=1 Tax=Methylobacterium sp. CG09_land_8_20_14_0_10_71_15 TaxID=1975532 RepID=A0A2M6XP13_9RHIZ  ali  18  1.....MANLGIIDTERLTLIPARHHDEHELCFHLHDMMLELLRGAEASGASEVRFTFRSEADRDAFERTSAEDPLTALEALGYIDEARRVALNQVNLALFSDFLHFVHEGLKALEKRKFTVALALLRKPLKENLFLAAWACGDEEGFYRALAEAPNEHMDARRLQPGRRKDIFAAAIAKLDPSAFSAELIYDILYNRDLATGLSNPFDKATHLVTSKPLLKTESLNLNFIFKNSFDDDVF-EFVYLRLTYIMIFALSIQIALYSRMRQVEDS-----FRSYCLLVALGANHALFGEGRS-PLMESLTRTLFMMCPHCKARLRIGKRAAARFLVAEQVTCRACKEDS............... 338
10 7.000e-91UniRef50_A0A1L6JFA7 Uncharacterized protein n=3 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A1L6JFA7_9SPHN  ali  19  8...........VPRNRLRWIPRDLRLAHEYCFFLHDECVRLLAEYEAARAHIVTVKFRSKVENRNFTKIARTSPIEAMRATGYPDEARRVILNTVTMAMVSDCLHHLYEALRCMEKRKVVVAHNLLRKPLTDNLMYLSWMLGDEDAFYAAFTAED-GDAVISRAMASQRLAILETTLATLPANVLTASFVHEALFKRNNPYGLYGLFQHAVHLVTKHAELRTEPENFNFIFKNHND-DDLYELLYAVLPQLMLYLSHVIVGLFDRMRAMDAGAHRAF--EVRSILGLYFVEGGENEGYA---LAQMDNVRGYRCAVCEHPFSLTPHNAARLVLADAYRCVRCRRVQ............... 337
11 2.000e-89UniRef50_F7T9D5 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=F7T9D5_9BURK  ali  20  3.........LLIPSNRLKWLPADTRLAHEFCFFLHDEIVRMLVEYESANAHQIKVKFSSRERKRFESLVKKTDPVSALNALGRHSEARRVVLNTIAMAMVSDCAHHIYEALRCFEKAKVIPGFNLLRKPLLDNLMYFTWMVADEDGFHAAFKSGDPTKITQKVLGNRRREFMQAVIEKTGLSNIVQMEDLYSIIFDASNPEGLYGLFQHAVHLVTVDREIKTSPENFNFIFSRPADHDI-YRALYASLPTALLYLTFLIMALYQRLRPMEKGTRDALV--FRAINGYRL-----LRGKQASLAVASALSPRFQCADCKTRLKVTESNAAKLLLADCFQCTACRRKQL.............. 338
12 1.000e-88UniRef50_A0A1C2HJ49 Uncharacterized protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1C2HJ49_9RHOB  ali  19  3.....LKTIGIIDPDRLQNIPKKHWAEHEFCFHLHDLMARLLVQMEIQKAGHIQFEIESEADR--HLLASGINILDFLDKSGRGDLERRAAVNHVCNALFSDMLHFIYEALRALEKRKFTVAFSLLRKPLKEGMLIVAQMCADEGAFFDKL-KSDAKNLLNRKDLDEAGIKALLASAMKQGCSFTNADAVYDTLFNFQNDLGFAGLFDKATHLVTEFRRNQTEDYNLNFIFKNPMDDDIYAGGTYSQLAMLMLFLHVMQIELYGRMRKPSKKY-----QNWMLFTSLGSYEALFTRGRSRTNFVNSNFAELMRCPVCEARIRIKKVDAPRLFIGERLNCDQCFTDQ............... 338
13 2.000e-88UniRef50_A0A1R3WML9 Uncharacterized protein n=1 Tax=Pontibaca methylaminivorans TaxID=515897 RepID=A0A1R3WML9_9RHOB  ali  20  1.....MSRIGVIDEARLRHLPEKYHAAHEFCFHLHDQMAALLVEMESTGANEVSVSLSDESER--DLLESSESVIDFLNSTGRSKFADRAILNTINMVLFSDMLHFLYEALISLEKKKFTVALSLMRKPLKEGFILASWICADEAEFLENLKLDPAKTFDQGEISPEKKISLIEGAKKCKGSDFIASDQIYSIIYDRKNEYGLAPLFDKATHLVTRNPHIATEQLNINFIFKNPLDNDI-YENIYADLAKTLMFMNLIQIELYSRMGAVKEKY-----KNWLLLTSLGVYGAIFLKGRPPLLFVNSTMKEFMNCPGCDTAFKIRKAEAPSFFIRETVTCREYGMEH............... 335
14 3.000e-88UniRef50_UPI0002FF4C7A hypothetical protein n=2 Tax=Vibrio TaxID=662 RepID=UPI0002FF4C7A  ali  22  4...................LDSKFKDSHDLCFLIHDIMVQLLHSAESQKAFNQT--FDLTEVEAKSLESTERHIIEWLEENQMYQESSLVIRSTVLPALLSDMMHCIYEALQASKKGKLTISYMLIRKPLQESLFVLESMVLDRKQFIEDFTNDQKKLSPSSTGGLDGHISRIEQVLQKLGLESFDASYIAKLRYDKSIEDSFDGVCNKAMHLFTSRKTLKTESRNINFIFARGEQYPSLWAFLYSRLPYLLYYIYQLVEHVCAELAPTHPNYLDHMNRWIKTLVTYPSVEERYKHESLDNLFVSLASWLKSDCIA-NGFSELDAINFQELVETGLYT....................... 324
15 7.000e-88UniRef50_UPI0009BDAF4F hypothetical protein n=1 Tax=Aliivibrio fischeri TaxID=668 RepID=UPI0009BDAF4F  ali  26  4...................LPNEFKPAHDLCFLIHDIMVELLKSGDESQAFNQTFELTQNEVE--SLDKSEDHIIDWLNENEKYKESSLVIRSTVLPALLSDMLHCVYEAMKASEKGKLTISYMLIRKPIQESLFVLESMILDHEQFIKDFANDQKKLSPSSAGGIEGHTKRIANVLDKLLNTVLSPEYIAQLRYSKVSEDSFDGVCNKAMHLFTSHKSIKTESQNINFIFAKGEQFPSLWAYFYSRLPYLLYYIYQVVEYICAEIAPTSNNYLLHMQRWVSSIVAFPFVEDQYQCKHIDNLNLSFLIWLNNDCIK............................................. 301
16 1.000e-87UniRef50_A0A1H3HM41 Uncharacterized protein n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1H3HM41_9RHOB  ali  20  1.....MPQIGYLSEDRLQNIPKRHWAAHEFSFYLHDLIAHLASAAEQSGAGHIQIQLDTEKDV--EALKAASNPIDFLSATGRTDEERRLMVNHICAALLPDMLHFIHAGLTALEKRKFTLAFACFRKPFTEGLPLIALLCADEENFFTKFKSDPVFLDSGNFNRPTKRLAIEAAIAKCSDASFMSADLLHAYLFDFTNTSGFAGLFDKAMHLVTRNHNIKTEAYNLNLIFKDPRQNDI-YDASYQGLSYVLLCIHLMQIELLKRMQFPADDYLKQLNIR-----AAGTYQALFLKGRS-KIASSMNETLGMKCPICHERVRLKKRTAPMFFVTENLECDQCGHVS............... 335
17 3.000e-87UniRef50_A0A2T6AHZ7 Zn finger protein HypA/HybF involved in hydrogenase expression n=1 Tax=Gramella gaetbulicola TaxID=703340 RepID=A0A2T6AHZ7_9FLAO  ali  46  1........MLYIQEGAESKLPENYRRINNICAIMYDQITEVFADQKYDDLKSTKFTYDENHILVDELEDKKINVLDWFKENNLNEDISNFLIKHLTLSISSDIANFIYESLSCAQRGKMTVAYALLRKPFTDELLILEQLLIDSDNFINRFFHSGDPRNYDPSSRKIEKENIIENAVRNLNPKLFTADFIYKLRYDKSSPNGLNGITNQALHIVTNDKNYKTLNQNLNFVFNKKEDIENYWDHYYYFVPYLLMYTTSIIDSIVFKFVDNEKSENIKNIKALKRFIGILQWMEIRTKEANQKIYSAFQESLKIECQNCKEIVELDKPDFDLFFETEMFLCPKCFTNILNGENAVK....... 351
18 8.000e-87UniRef50_A0A181X067 Uncharacterized protein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A181X067_KLEOX  ali  23  14...................MPDKYRSAHKLCFLLHDIMLQALKSGESSGVFMTSLKISCEDEESLKL---ANNIFDWLDIKERSKDKIKIIRATVLQAVLSDALHCIYEALKCSEKGKLNITYMLIRKPIQETLYLIESLFMDDAGFSKSLSENPLTLRPKNAGGVDNHIERVSKVLKLLGDDPFNAGYIARLRYDKNSEDNFDGICNLAMHLFTEHKAIRTERFNVNFIFSDGDSKISQWSYLYSRLPYILYYFYAIIESILSKIAKTPDRYIYDMQRRIMSSV-CLWWHDVSEDYQNDELFEFYSSKIWLDCHCIKNGFKENKKDLIRMANNGAF........................ 330
19 1.000e-86UniRef50_A0A286D9K9 Uncharacterized protein n=2 Tax=Pseudoxanthomonas wuyuanensis TaxID=1073196 RepID=A0A286D9K9_9GAMM  ali  24  2...............DYGHLPQELHFSHNFCFFLHDQLVAALQLGEEAKIFDVELISDQK----ISEGLTGESLFEWLDDNGHQSVILDMYYRQITAALLADMLHFLYEALRCSEKGKITVSFALLRKPLKENLFYLEWLLADPSDMLAAFKDDRPSAKSVRLLTDVRKKEIIRAVEKTSMGHWLDSELIYDLRYNKRFSSGFEDLFQKANHLVTSFKALETEPANFNFVFSDDHARQSQWNGLYSYLPPLLLHAVEVVEALLATFSKRQEGIDLT---QIRSAIGFAYWIDKHLGADALRNMKSALLSDELPCPSCNAQVFSSDESLITLYNENTVSCSSCG.................. 327
20 1.000e-84UniRef50_M6CWD3 Uncharacterized protein n=2 Tax=Leptospira alstonii TaxID=28452 RepID=M6CWD3_9LEPT  ali  29  5...................LPEQFIESHNIAFFFHDAMLSTIHDLEKNGILSTKLEFNDKETSEEFSKIPKKDTFRFLEERDKKDELYELITKLSYHSLLSDMLHFIYESLKCSEKGKLTVAYAILRKPFKESLFYLEMLATNHIDFYERLKSEDPNELNLSNSKTTKKKIISNAIAKCPYEPIFDSEFIYDVRYNKHCEYGIELLWQRANHLITTFGPIATEPFNFNFIFLNGKDINSLWFHYYRTVPFLLFYTFNVIEAIIGKF--TVFDPQKADTLPLKAFAGFAIWAENSDWDEIGSIGKNVTKDIPFLCAKCNKSFDFDIKIYKQIFYDDFVKCPNCRFKIR.............. 338
21 2.000e-84UniRef50_B2A3Z0 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=B2A3Z0_NATTJ  ali  28  3................YSILPKKHWKKHDYLLYSYDILGNMLRQADSKSLSTVKFNLKEDEVESFE---NAEDIFEWLDNNGYHKIALSQFTSHVFFSLLKDFCYYIYESISCSERGKVTVAYSLLRKPLRDNLLYLEWLLANNEEFYQKIMYQD-IDEYDVSNERVKKIIKLASSKSYMGESLNTNNLIYKFRFESKEEMSLQKIWNRSMHIVTRSNNYRTERNNLNFIFANLDDWNKFWDYYYTVLPQLMAYVLEICEAIFLSILEVDENILLNRMIRLAKYSDVSEFIETSMFKNNPSILDEQNASITFECELCNEVIELNKDILNQFIYNWFVTCTSCHGKHNICRY.......... 344
22 2.000e-84UniRef50_A0A2N1S502 Uncharacterized protein n=1 Tax=Spirochaetae bacterium HGW-Spirochaetae-4 TaxID=2013836 RepID=A0A2N1S502_9SPIR  ali  21  3.................YLIPETYHFSHEYCFFLHDLMVWMVKEGEQKRHFDVKLNPSSEETKVL-QKFHGNELYEWLQENGHQKEADLLTYKQIFVATLADFLQFIFNALRSSEKGHLSVTFSLLRKPLKENLFILESLLSEPKEFLQKFNSSVSYNEAAIDKQNEEKRRIITDVLKKIPLSLMEPDFLYNLRYSKREIHSLERLWQKATHIVTSCQHYQTESGNLNFVFSDINAKKEQWRYLYFILPQMLFYVFQVCRTIYEQVITSESDESWDRALVGNMISMYNLMQDDEMECIQDQLLD-----IKLKCQICGKEVSLTQSMQKQIQFEGSYTCVEGHRNEF.............. 330
23 8.000e-84UniRef50_A0A1E4UGN2 Uncharacterized protein n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E4UGN2_VIBPH  ali  21  1.................MKLPDEFQDAHTTCMYMHDVMVEFLRSGEEQGAFNQKFTFEEHEISSLENI-DDQNILDWLEQNGKFAHRNLVIRTVVLPAVLSDMLHCFFEALESAKKGKMAVSFMLLRKPIQESLYLLEAMAISEVDFVQKLSEDPMFLRPKNGGGPEGHTKRISKVLQKIMAELLSPEYLAELRYQKSSFDSFDRICNQATHLFTEHKAIKTELLNINFVFSGGSQIYSQQRYLYTRLPYVLYYTYFLFEYIASRLCPSPPEYVENINRRIMALISYMQIEDDFLTDYMEALALGFCRNLCL................................................. 297
24 1.000e-83UniRef50_A0A2S4F8Z0 Uncharacterized protein n=1 Tax=Bacillus sp. MBGLi97 TaxID=2070760 RepID=A0A2S4F8Z0_9BACI  ali  22  1...........MPYYDDGHLPEQHLIDHNFCLYLHDVCLSIFEECMENGHR-MSYTIKENGRVSLEGLEKTEDLFSWLRTNGYEKEANLILKRKMFHAILADFLSYVLESLKASEKGKTAISFTLLRKPFKDNLFYLEWLVANGDELLS-FVDAGKIEEYEVGRIRKYKNEKIKKILNKVMKKFPDDNYLYKLRYDYNAPFGLELMWNKANHLVTTAKKIRT--KDFNDIFLTEKDYEERWHYFYTKVPLLLLYSTGVVIRLYEQLFEEISSSTKFYNKIFLLIKWFSRVDNELGKQFIESIFEES--EIPIYCDNCESQTLINKERAFKIPFDWGLECDHCKEFISISRY.......... 342
25 2.000e-83UniRef50_UPI0008398BFD hypothetical protein n=1 Tax=Oceanobacillus sp. Castelsardo TaxID=1851204 RepID=UPI0008398BFD  ali  25  8.................SILPEEFIPKHKLLLFFNDIIADILIKADEYDLSSKKIDIENNKVLPDSMD----SPLDWLIENGYKRIAYDSTKAHVFFSILTDFIYYMHESFSCSERGKITVAFSVSRKPLKDNLFYLCWLLVDSEELIKNILYKKP-QAFDVSRIGIEMKEDIFRKAGQKIEFPIDTDLLVDVIYNKNSPKGLSRIWDQSLHIITANKRYPTSVGNLNFIFSDEKVWQEHWKTYYDKITFIMTFMIEVSIALFEEIYNADENT-----KTFNSLIRNIKYDLTFSNEFNSENYMELFKVLSFTCDECLGKYELKNGVLKEFIYDYLFTCPHCSHMERVGQY.......... 331
26 3.000e-83UniRef50_A0A1C6JV48 Uncharacterized protein n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6JV48_9CLOT  ali  28  10...................LPKEYIKRHELLCYYNDLIVDMLYKADKHHLSSVSIELKDE----NDLPKDEEEMLGWMFQHGYAKEGYRIAKAHIFFSLLRDFILYMHESFNCSERGKVTVAFTISRKPMKDDLFYLCWLLANSEELIDCLLNKD-ISTYDVTKLSELKKRDILNKACRLVNKKEYEDVLYDLIYKRNCDYGLSSVWDQSIHLVTENKHYQTTKGNLNFVFATNDIWNDYWELYYEKLPYIMNIVIEVATQIFEEILKPHE-----VFITLNKTIRDMKFLLTYDDDLDVSVYQDLFQLIHIECNKCGKTYDLKDSVLGEFISEYLYTCPYCGAVERVGEY.......... 331
27 5.000e-83UniRef50_A0A223V5D7 Uncharacterized protein n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A223V5D7_9FLAO  ali  28  1.....MNDILFIYPNDDVYLPEGFHFSHNVCTRLYDDLVWILKDATIQRKFKVRIDFDLSNERPDSEN---VDIIEWLLEKGYKKEVDEIISKNLMSGLISDSCHFIYQALNSAKKIKLTVAISLLRKPFLENLLIIEQLLVDESDFLRRFESEANKFDPGKVKTERKKELIENCIDSIRPNSFLSSDFINELRWDKNNPNSLYAYSNIATHLVTRNPSYKTEKNNLNLIFSGEHEWLSQLDYFYYFLPFILYYSTEVVDTYLLK--NKMITKKKGIERKFLRIIGQMLLHEQHDEEKGKTGLTSLSRKLKVKCKKCNKTNQLYKSDLFNLVNDDYVLCKFCLYDLL.............. 340
28 2.000e-81UniRef50_A0A1Q3YC52 Uncharacterized protein n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A1Q3YC52_9BURK  ali  23  1.....................................MVQLLVQYEASGAHLWITNAFEKALADSNVKDVDIDLFQFLKQHGLLRQYKHHIVSHLTLGLTSDMLHFLYEALICFEKRKFAVGFALLRKPLKENLLFLSWLLSDSDDFIARF--ESNTATALNGIKPERRIQILAGAIARLTKEAFAEDLLHDMIYSKSHEKSFEPIWQRATHLITSQGELRTEDLNINFIFHDAGS-DHLYELLYANLPYVLIYAMQVALECFSQILRANEQTVSHLI-----LSTMGCYESLSSNGKQQHVARLLTKNLHLNCLHCATPLRLTRENAAEMYLKETLTCRKCGLAS............... 305
29 5.000e-80UniRef50_UPI000479049F hypothetical protein n=1 Tax=Peptostreptococcaceae bacterium VA2 TaxID=1476973 RepID=UPI000479049F  ali  22  7...........LINRDYSKLPKQYWANQNLCWYLHDVIMSIFLEVVDEDLINTKIDLTNEENT--DILDDCEDVYAWLKNSGRDNEFTTIFCKDLSMRLIGDFLNYIHEVLSNLERGKITIACDLLRKPFKDNLLYIEWILFNDSE-LSNLVYNEEIDKYAMGRSGLSKIVKYNVSQNRFINAFRSEEFIYDIRYNYDSPNSLELVWNKATHLVTTGRQIK--SRSFNFIYHDMNDYDEYWSYLYGKLPTLLLHTLGVVENIFDKYFRSISETSKKYN--FSLIMGKFFGVEESTRDFADIISSFKDGNLNLICENCKEVVKLNKPEKYMFYNYWDVICPKCKQEINTCRY.......... 347
30 5.000e-80UniRef50_A0A1Q3N9B5 Uncharacterized protein n=3 Tax=Acinetobacter TaxID=469 RepID=A0A1Q3N9B5_9GAMM  ali  16  5........IGYLPYENIQNIPSQHVPAHEFIFFLHDQCANLLVQYEQSNIAKIGIDVEAYSNKFPNNDSDIIEILQFCRNEGLDAPYYHFLISKILMGLTSDLLHFTYEALKAFEKRKFSVAYSLLRKPFKENLIFICLVLNNYENFIELFEQETDKSLNNFYKHSSSRKAIFEEIIPKLLPDLFEAELIDNMIFSKQYPLGLEISCQKATHLITSQGDFKTGRMFINSIFNDPNNLD-QYEPVYTSLPYIMIFTTHVLLEGFQKLVNLNENTYQH-----ITLSTLGCYENLFTDGRKRALTQSYAKAFGLQCIHCGKKIFLTKENSLRMYMTGVLICNHCQFDS............... 342
31 8.000e-80UniRef50_UPI0006BBCAB2 hypothetical protein n=1 Tax=Clostridioides difficile TaxID=1496 RepID=UPI0006BBCAB2  ali  26  5...............DYIKLPKEYWKEQRFCWYIYDVIASILKDCEKKERRKINLKFEAESKAFATRAENSKTIIDAMYENGYKDEARRAMGIDIFRATLSDMCQFICESLSAIEKQKISVSFALLRKPFRDNLLYLEWLLSNPNDFIDLVYKQDIDKYAIEKISKENKIEIIKSAIRQIKYPIIDNKDLYDIRYNYNSTNSLQLIWNKANHLVTTHRKTRTDE--LNFTFLEEKDYLEYTDYFYSKIPILLFYTYNVVVELYNKFFRKLSDITISYNNLYVLNRYLDIVDGEFSKKYLQ--YIDDDNKITFCCEECEKFITVDKDEYKEFMFNGYFDCPNCKNEINVCRYI......... 346
32 1.000e-79UniRef50_R9MNZ7 Uncharacterized protein n=2 Tax=Lachnospiraceae bacterium 10-1 TaxID=1235800 RepID=R9MNZ7_9FIRM  ali  22  10.............TEDQFKIEPQYGPSHNFLVYCNDVLVSFLKYVDCEKLSSVKINFKNKEDESFADLKEGSDIFDWMEEHGYSDEMYELEYRHTFFSLVADFCHYMLESFECAAKKKVAVAYALLRKPLRDNLYYIEWLAAEREDLLDKLAKGKAKDLVINKSNAKKYIEKVEKI-----YGIAHQDGFFNFRYDKNDRMSLEKIWNKANHVITTHSYTKSAQGELNFVFLDEERIDEFTRYYYCVVPLVMSYAVDLIVAMFERIINVNP--MTNVINRVLKLARQACTADG--KFFQDALNILEVDEIPFFCPHCGNEIHMNLDILFEL-MNNMFKCEECGFKIESSNYV......... 339
33 4.000e-79UniRef50_UPI00098A23C2 hypothetical protein n=2 Tax=Bacillus TaxID=55087 RepID=UPI00098A23C2  ali  20  1...........MPYYDDGHLPEKHLIDHNFCLYLHDVCLSIFDECMEDG-YRMSYKIEENGRPSLKGLARTDDFFGWLRANGYEKEANLILKRKMFHAILADFLSYVLESLKASEKGKTAISFTLLRKPFKDNLFYLEWLATHGDELLS-LVDTGKIEEYEVGNIRKFKKEKMMNILNEVMKKFPEDNYLYKLRYDYNAPFGLELMWNSANHLVTIARKIRT--KDFNDIFLTEEDFKERWHYFYTKVPLLLLYSTGVVILVYEQLFEKIPLSTKTYNNIFLLVKWYSRIDNELGKKFIEDIL--ADTRIPLYCDNCEKEILINKDQAFKVQYDWGLECEHCKEIISISRY.......... 342
34 1.000e-78UniRef50_UPI0005599C86 hypothetical protein n=2 Tax=Firmicutes TaxID=1239 RepID=UPI0005599C86  ali  25  10...................LPNEFLSTHELLLYYNDIIVDLLHKADEFDLSSSKFQIKSEQ----SLPTDDEDFIEWMFTHGFETEAYDYLKSHLFFSLLRDFIFYMHESFDCAERGKVTVAYTISRKPIKDTLYYLCWLLVDDKDLLDNLMLNESKE-YDISSINFKTKKRLINEATKITKAPYEKDFIFDLIYKRNFKNGLSKVWDQSLHLVTGSRHYPTEPGNLNFIFAYDDIWDEYWSFYYATMPIIMNFSIEVIIKIFESIAKPDSTTVEA--NKWIRNFKFLNATN-HLTKETNELFRSVLEHLTVTCEKCQKEYQCIGTVADEFINDYLYTCPHCETQERVGEY.......... 333
35 6.000e-77UniRef50_UPI000206D41D hypothetical protein n=1 Tax=Gemella sanguinis TaxID=84135 RepID=UPI000206D41D  ali  27  10...................LPKKYIDKHSLMLYLYDILVDILKKANKYKLSETKFKSSDKKIQDKDF------IYEEIEQKESIELGAELMGRHILFSILSDMCHYLYESFSCIERGKVTVAYTLARKPLQDNLFYLCWLLDNPNDFYEKLKNEDPKE-YDVSILKRNNEDVINNKGNLLSFEPLSAEMLYELIYDRKSKSGLSQIFDKSIHLVTNNPNYKTEKKNLNFIFAGDEIWNEFWEYYYLKFPYILWFIVEVVIQNFERMLLIPKN--LCKFNSLIRNLKFLIILNPDEKGDLEELSTIVKDSLTITCDKCGNNILDNEFAIKEFREDYIYSCSNCGNLERIGQY.......... 342
36 2.000e-76UniRef50_A0A2G1BYJ2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2G1BYJ2_9FLAO  ali  28  1.....MKDTLFIYPRDEVYLPNGYHFSHNVAVKLYDDLVWILKDEKTQKKFNTKIHFEKDGDVPSE---EDEDIVEWLIEKGYKKEVDEIISKNLVLGIISDVCHFIHQALDSSKNIKLTVAFTLIRKPFLENLLILEQLLTEEQVFLEKF-ESDSKKFDPGKINDIKKKQLIENSLKQISNNLLSSDLINDLRWDKKNPNSIYANANLGTHLVTRNPSYKTERQNLNLIFSGEEEWSEQLDYFYYFVPVLLYYFTEVVDSYVKKIITKRKLTERKFLRLIGQLMLHDQFNEKSIKGK--SALNKISKVLKVKCKNCNRINQLFKSDLFNLVSEDYILCKFCLLD................ 338
37 2.000e-76UniRef50_UPI00069E16BE hypothetical protein n=1 Tax=Thalassomonas actiniarum TaxID=485447 RepID=UPI00069E16BE  ali  24  1..................MFPSYLEQAHDLCFLNHDILVELLRSGEKNKIFHQQINFLSEED--KKLLEQSNDIFEWFELTGRKLEYVETLRRTVFQALLSDFLHFIYESLSCSRKEKLTVAYALLRKPIQENLLLLEIMAIDINDFSNKLTENPLALRAKNYGGIEGHTKRIQSVLKVLGEERFNADYLAQLRYQK-SEDGFDGICNKSMHLFTEHKKIKTENMNINQIFSGSESKQTQWHFLYSRLPYLIFYARRLIEHICGTFSKTDPSYLNNIEYRVMTILWYPNVEDRYKNDNLDKFVDSTVNKL................................................... 292
38 1.000e-75UniRef50_A0A1F9WY70 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYA2_FULL_40_6 TaxID=1797958 RepID=A0A1F9WY70_9BACT  ali  34  3.................YFLPKKYKDLHNPCFYFHDILAKIVVEGERKKLFNTIIKSENYED-SKSSEKCKENIFEWLKTKGYKKEMELILIRQILLATLSDFCHYVYEALKCSEKGKLSITYTLLRKPFKDTLLIYEWILADRNKFLDCFQLDP--EHYDIGNIDQAKKDYITKSLGLIKYKTFNADFIYDIRYSKKIHYGLEGLWNRANHIVTTCEHYKTESMNLNFVFSNNIDKEKQWHHLYILLPSLLFYTIEVVQALLDR................................................................................................ 248
39 2.000e-75UniRef50_A0A1Q8RJX3 Uncharacterized protein n=27 Tax=Streptococcus TaxID=1301 RepID=A0A1Q8RJX3_9STRE  ali  26  9..................MLPNKYKKRHQLLLYLYDILVDILVKADKYGLSNLSFKLTNKXXXXXXXXXXXXRQRDI-------EISERVFIPHIFFSILRDLNYYLYESLSCIERGKVTVAFSLARKPLQDNLFYLSWILVRPAEFLEKVQYG-SLEEYDVSALKGNKEDLFSKAKRLISKELLNPELLYDVIYNRRAENSLTSAFDKSIHLVTRNKNYPTEKQNLNFIFADDKIWNDFWNLYYEKIPYILIYLVEVVIAIFEKYVEINQE--VSEINRYIRNLKVILALSKDENRELGSVFIFASNTISMTCDECGNNYDFDKVLIDEIRNDYLYTCRYCGNIDRLGQYFV........ 347
40 2.000e-75UniRef50_A0A0W7TVY8 Uncharacterized protein n=1 Tax=Ruthenibacterium lactatiformans TaxID=1550024 RepID=A0A0W7TVY8_9FIRM  ali  24  14...................IEPKHYFKHNYLTYCNDVLVSMLKYADEEKMASVSISFDDGENEEFEQDENWQ---EWLITHGHREEIYEVYYRHTFFSLVADFCSYMLESINCAAKMKVAVSYALLRKPLKDTLGYIEWLRVNRNSMLDLLVSGKPEDLVITKERAREHTSLIEE--NCNMSSFFD------FRYNKASETSLEHIWNNANHLITTYKLSKTEPGNLNFVFADEAILRSFSDYYYITVPAIMSYAVNLICEMFEEFAPLNKYTV--LMNKLNRTLRSLEMLETISFDDAKKLY--SSGNVPIVCPRCGLKMKMTDKRMLKFI-SNKCTCIRCLKTIKTGRYI......... 331
41 4.000e-75UniRef50_UPI0007107FA1 hypothetical protein n=3 Tax=Acinetobacter pittii TaxID=48296 RepID=UPI0007107FA1  ali  18  5........IGYLDYENIENMPDYYIASHEYIFFLHDHCAKLLVEFDKSNISELGLDLDKYEEKTGSSPLDIIDVLTFYKKNNLDAPYYHFLTSKLLIGLVSDLLHFIYESLKCFEKRKFSVAYSLLRKPLKENLIFICWLFNNHENFIELF-EQETHKSLNNLREAKIKMILKETINNLPLPEMFDFEILYNMIFSKQLSTGLETPCQRATHLITSQGEFKTKERSINSIFDDPFD-DSYYDSMHICLPYIMLFTTHVIVEAFNNLIKLNNNTYQHL-----LLVSIASYENLYIDGRKRKLTKSLSRNFKLGCIHCKKTIKIQKENALRMFMLNQLFCNHC................... 336
42 1.000e-74UniRef50_UPI00047DA979 hypothetical protein n=1 Tax=Alkanindiges illinoisensis TaxID=197183 RepID=UPI00047DA979  ali  18  7..........YLPFENIKNIPSKHISSYEYIFFLHDQCAKLLIEYGSSNIDEVGLDIEAYSINFKNNDFDIVEVLQFFKEKSIDAPYFHFLYSKILLGLTGDLLNFIYESLKCFEKRKFSVAYSLLRKPLKENLTFICWLFNNYENFIEKF-EQETDKTLNKIHESTIKSIILETINKLPLPELFDAELLYNMIFSKQHLFGLEIPCQRSTHLITSHGHLKTGKMFINSIFDNPNETG-QYQPLYISLPYIMLFTSHVIFEAFNKIIRLNNKTHQHF-----TLTSIASYENLYSDARKRPLTKWCGKAIKLKCIYCNKTINLTKENSLRMFMTDKLICNHCHT................. 338
43 1.000e-74UniRef50_UPI000562752A hypothetical protein n=1 Tax=Lysinibacillus sphaericus TaxID=1421 RepID=UPI000562752A  ali  25  1...........MTYYEDIILPEKYLNKHNFCLHLHDVCLSIFLECMEEESLKITIREEDEKKLEVLAEVEDLDIVDWLYNNGYEYEANILLKRKMLHATLADFLSYILEALKAAEKGKTAIAYTLLRKPFKDNLFYFEWLLIQGDELLSHVNQGD-IDKYEVGSVRRNQRAKMKLILNMEINPFLDKDFMFNLRYNYNSSYSLELMWNKANHLVTTAKPIRT--KDFNNVFLTEEDFYNQIEYFYSKVPFLLLYSTGVILNLYEMLFEKISEESKFYNNILIKTKWISMLNADKGKEILLEILKKL-EALPLYCEVCEELTEITEKDIEQVQFNWVIECQKCNQ................. 338
44 5.000e-74UniRef50_A0A2S9SUD0 Uncharacterized protein n=2 Tax=Arcobacter TaxID=28196 RepID=A0A2S9SUD0_9PROT  ali  19  5...........LQNRKGTNLPNKFNFGHELSFLLHDIMTNLYVTAKQTNMFSVNIDI--YEDEYKEFLENSEDIGKWILNTKEKNKSAKVLKTIVFPAVLSDMLHCFYEALETSRKGKLTISYMLIRKPLQESLYLLEEIVLSELSFSDKLINNLNLLESSSAGGLDEHARRIEQIFEIIGSDFLNSHYISQLRYDKSSEDSFDGICNKSMHLFTNHKSIKTENMNINMIFSGYSQFETQWAYLYSRLPYLLFYTWIIVEYLTNSIIET-SQEYLDEIRRRVSALIILWWNEIDDFYKNEKLESFVGFQEEWLNNHCKNGYKITKNNLIKMFKNGSF........................ 330
45 4.000e-73UniRef50_X6JAZ9 Uncharacterized protein n=2 Tax=Mesorhizobium sp. L2C054A000 TaxID=1287100 RepID=X6JAZ9_9RHIZ  ali  22  1........................................MLAELEGADLRRFSFKLDDEHEV--EALRKSSDVMDFLVKTGRMDVAQKSTVGELNLALYADLLHFLFESLRALEKSKFTVAYATLRKPLQENLLYAAWLVADEDDFFKRMKDDPADKLTRSGLTPDEHKQIFRRAIAQMGHDAFHEDVLYDFVYDKNSDVGLAVFMNKANHLVTRGDRLRTEEWNLNFIFKDPRDTDV-YETIYPILAYVLFFILQLQIASYSRLKEINRE-----VQRQLSVSAMGAYEALFAPGR-GPMLRGFSKLLKLKCPFCHEAVTIKKSEAARFFILEHVACRCCGRAHK.............. 302
46 9.000e-73UniRef50_A0A1L9CFQ2 Uncharacterized protein n=1 Tax=Rhizobium pusense TaxID=648995 RepID=A0A1L9CFQ2_9RHIZ  ali  20  11....RMQPLGIIPDERLQYMPRDIIPRHEYCFWLHDEITRLLVEATQSG--HVEFWHDLLQDALRKNGQSADDESIWTKVAEAGGIVSTPIKLDILLGLIADTMHFIYEALTAFEKRKFNVAYALLRKPLTENLIIISKLIQNDDALIKSFADGSLQTKQVMQIDPKDCVSLFDGVIKDLYLQDFTGDLIYKIIFDKKTPNGLQLNMQKSMHLITRHPALATPKFGLNRIFHYEHGDDNY--NVYNTLPILLFFILQISLKGFSKYFQIHEITVNEILIR-----SVGLFGNLY-EGGLDSLSRSLNKQINFKCEWCDQSVKIRKKYAPLFYLKDQVHCKNCERLSHT............. 349
47 2.000e-72UniRef50_A0A1N7CZ25 Uncharacterized protein n=1 Tax=Pseudacidovorax sp. RU35E TaxID=1907403 RepID=A0A1N7CZ25_9BURK  ali  20  1...............................................................MEQQIVEDFDLLKFMKEKNLIEPYKHHLISHLVLRLVGDMLNFLYEAFSAFEKRKFTVGWSLLRKPFKENLLFLSWILANEDEFIEKFESDNHKTLNNVKKE--KQIEIYDAAIKKIPNSAYSAELLWDHIYSKNHATGFEPMWQRATHLITSQGDLKTGDYTINLIFDNPYS-NHHYDLLYGRLPYVMIYLSSIAFECFNRILRMNDRTYNHM-----AIVSLGCYEALFINNRHTPIIKSLNKSFKLKCIHCSKDIKINKRNAPAMYIRDQLTCDKCGLQS............... 279
48 6.000e-72UniRef50_A0A132GA46 Uncharacterized protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A132GA46_9GAMM  ali  24  1........................................MLKSGMEQRIFD--IPIDNEYLRAHEVPVEDIST--WLDSIADKSKIPDLLISRMFPAILSDMLHYVFEALEASRKGKLAVAYTLLRKPLQDNLFVLEAIVDDRDSFAEKFSYSPPKLDHGKNGGLDGHRARIQRVLDKVGKDAFNADFLTQLRYDKSNSDSFDGFCNKATHLFTTKTAIVTKPYQANFIFSSYRDTVSQWSYLYSRLPYVLLYCISILEHISGRFALTPADYSNDMDRRLSAGYILSLTT-VSDEFKSDHLYALAESKLGWLYKHCEESEFINIEALIRMAETGAF........................ 300
49 1.000e-71UniRef50_UPI0006D589A4 hypothetical protein n=1 Tax=Paenibacillus sp. FF9 TaxID=1527293 RepID=UPI0006D589A4  ali  26  2...............RKNIIPMEFKSIHNYIFELHDLIAYISSEASSLEINSMSIKLNSDDVI--DEGLDGVLLWNWLESRGHSDLMKKYEINQVLLAVAIDFCHFIYEALTCSERGKMNVAYSLLRKPFKDNLLLMEWILSDQDDFISNFHNENSEKIAIDKMSEEKKRDIIKKAEIIGDTQLGQHDFIYELRYSKQAAHGLERMWNRANHIVTTIKHYKTKSNNLNFVFNGEEELYEHWGNLYRTLPILMYHSSEIIIKLIERQFPSVDIEYITNKTRWERKNAFVELVGEVMELKRLHYAE......................................................... 288
50 4.000e-70UniRef50_UPI000A26F3B5 hypothetical protein n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI000A26F3B5  ali  25  9..............................................................EDEESLKLAKNIFDWLDVKERSKDKIKIIRATVLKAVLSDALHCIYEALKCSEKGKLNITYMLIRKPIQETLYLIESLFMDDAEFSKSLSESPLTLRPKNAGGIDNHIGRVSNVLKLLGDDPFNAGYIARLRYDKNSEDNFDGICNLAMHLFTEHKAIRTEKLNVNFIFSDWNGKISQWSYLYSRLPYILYYFYTIVESILSKIAKTPDRYIFDMQRRIMSSV-CLWWDDVSEDYQNDELLEFYALSKIWLDRHCG........................................... 264
51 2.000e-69UniRef50_A0A0Q7Y825 Uncharacterized protein n=1 Tax=Massilia sp. Root1485 TaxID=1736472 RepID=A0A0Q7Y825_9BURK  ali  20  1.............................................................................MRATGYAEEARKVILNTIKMAMVSDSLHHLYEALQCMEKRKFVVAFNLLRKPLMDSLIYLSWMLADENAFYQAFSSGDPDLLTNKKIGNIRREILADALAQTAVKGVLSSETIYNLLFTSTEPDGLFQLFQHAVHLITVRPEIQTTPENFNFIFKSPFEDDI-YDHAYAALPIILLYLSHVVLELFDRMKSMEKGAKQGFAVRTILGFRM-LGPEKEIKEVQGALTEALSPNI--QCERCSHQFVATRYNAVRALLTESFRCSKCRCVN............... 266
52 5.000e-69UniRef50_X1EHK8 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1EHK8_9ZZZZ  ali  30  2.........................................VITGEKQNLFSVSFKIRDKKHPSEFKNLSGESFINWLEENGYEDIVMESFYRQIIVATLSDFCHFVYEGLKCSEKGKTTVAFALFRKPFKENLLFFEWLLGDPVEFMKVFYTKETSRYTIDKILKEEKIQIIANSIDKIWPQFFNEDYIYKLRYAKKCAYGFENYWQRATHLVTSFREIKTEPHNLNFIFSNYEDKESQWEFIYLMVPMLLYYTLNVVEHLFLNIAE--FDSFYSNIESLRRTMNFIFW....................................................................... 250
53 2.000e-67UniRef50_N9C5R1 Uncharacterized protein n=4 Tax=Acinetobacter TaxID=469 RepID=N9C5R1_9GAMM  ali  25  1...................MNKLYDRAHKLCFFIHDIMVDFLETGEKNDIFLSKVELSDLEK--KEFWDYDGSILNWLKNKNKQSNYESVIKKTIIQALLSDMLHCIYESLKAMEKGKVSIAYMLIRKPIQENLYLLEEMIL-KDDFIDIFESNPLKLRHKNGGDVNGHDLRIKTILKDLFDQILDSHYLATLRYDKKSEDSFDGVCNQAMHLFTEHQAIKTENLNINFIFGTNESKETLYQFMYTRLPYLMYYIYLVFEKIANSIANTSPIYLLDIQNRISALLAYVNVENNYQTKQFYKLCIMFEAILNFKCE.............................................. 298
54 3.000e-64UniRef50_A0A1X9YZG5 Uncharacterized protein n=1 Tax=Pontibacter actiniarum DSM 19842 TaxID=709015 RepID=A0A1X9YZG5_9BACT  ali  22  1........MDLLDPNGYGYLPEQYHRSHDMCEFLVGQLEAFLTEEPYKGLRHFEVDINPEAVPI-----DDEYTLDYLLRADMKDKHDELVRLHTVYGLLSDSCYFLREALDASRKRRLTVSFALLRKPFIYNMPVLLRLYLDE-EFLEHFNNREDFDASKLPKQDL--LDLIEASLPMLFSQDMSRGEIYDILFNKEEHGSLINWSNKALHPATTHHASLTGAKNLNFMFSTLDDIDKQWEYFYRRLPFLLTYLLECTEQIVFDLLQLNPALYTERLEERAAF............................................................................. 270
55 4.000e-64UniRef50_UPI000761C71C hypothetical protein n=1 Tax=Pseudomonas sp. NBRC 111119 TaxID=1661034 RepID=UPI000761C71C  ali  23  2..............................................................................................VFPAIMLDALTCLFESLEAARKGKMAVAFMLLRKPLQEALYLLESMAIDQDKFASDLAEDPLKLRPHVVGGVQGHEARIQKVLHKTAGVLFDAGYLARLRYDKSCSDSFDGVCNKAMHLITENRHIKTEAYNVNFIFSDYRSVYSQWSYFFSRLPYVMMYLVAVTEYVASQFALTFPEYTEDMMRRLVASLALSS-ARMRDDYRAESLDTLVSAAVEWLDSHC............................................ 224
56 9.000e-62UniRef50_A0A0C1U4B7 Uncharacterized protein n=1 Tax=Clostridium argentinense CDC 2741 TaxID=1418104 RepID=A0A0C1U4B7_9CLOT  ali  30  1........MGNIITRKYIGLPEEYWHKQNFCWYMHD--------------------------------------------------ANNTLGIEIFNAILADMCNFIYESLNTIENGKITVSLALLRKPFRDNLLYLEWLLADPKEFINMVNNQDIEKYAIEKISKDKKINIIKSAIEKLDNQSMDEIFYYDLRYNYKPEYSLQRVWNKASHLVTTGNHIK--SNEFNFIFSGQEDDLDLIDCYYNQVPHLLFYTYNIVIKLYNTFIRETSDATKIYNNHLILYKFCDLIDTVI---PQDYFNEEMKILLSFPCENCKKIIRIDSNEFNGFRNGWGFTCPECGSDVGTCKYI......... 295
57 2.000e-60UniRef50_A0A270BWA6 Uncharacterized protein n=1 Tax=Acetobacter syzygii TaxID=146476 RepID=A0A270BWA6_9PROT  ali  22  3.................................LHDEMLKILHNGIEHKAFSVSIPLDDS--LKTKLENSNSHILDWMKENGLDSERAMTICLTVLPAVMRDMLNCIFESLEMARKGKMSLAFMLIRKPIQENLFLIEEIIISPQSFVENFENNRKLQGTGIGGVSLHAQRLEHILKNMTLTELYDAQYLAQLRYDKNSSDNLDGICNQSIHLFTKNQHIKTEKLNINMIFSKINEIDTQSDFYFSRIVYITSYIYDIISHIGNEIVPTTDEYKIRINNVILTAMWFIQLPEKYTSKEIYNFCLSKTKSLKLSYKECVEII........................................ 294
58 1.000e-59UniRef50_A0A2M6GEN9 Uncharacterized protein n=1 Tax=Cytophagales bacterium CG18_big_fil_WC_8_21_14_2_50_42_9 TaxID=1973956 RepID=A0A2M6GEN9_9BACT  ali  28  1........MEFLERAEYYFLPEKYHRKHDICEFLIGQIESFITEDTYKGLKVYVYEVNANDVE-----THDEHVFDFLLRTNRTKEHDEIITRQIIYGLIIDICYFVQESLLASMKKRLTVTFALIRKPFVFDLIILLRLYL-TEDFIQQFNTIEKFDTT--KLEKDDLIELINFSAKILITTAIQPNDVYNFIFNLSESDSLINITNRALHPTTRNKQNLTGLQNINFIFSTEKEIEKQWDYLYNRLPLLLTYMLEVIEFMVNDTLKIDDDFYFKRLKYRAEFLS........................................................................... 271
59 8.000e-59UniRef50_A0A1I2JL81 Uncharacterized protein n=1 Tax=Sunxiuqinia elliptica TaxID=655355 RepID=A0A1I2JL81_9BACT  ali  24  4.............DNEYLYLPEKYWNKHKQCELFVRQIEEFIVDETYNELRYQKFDLESEND-----LKEDEHIFDYLLRKEKFEEHDNFVRKSLVDALIIDVCYFLQEALAASKRKRLTVTFSLLRKPFVYHLPVFLRLLFD-DEFLNNFNNKETFDVNYLKEEKKKELIKESLSL-LLGAKSLTEEEIYEWIFNQNNPDSLINLTNKALHLTTRNKNNKTEIQNLNFIFSNQDDIENLWSYLYTYIPILLLYLVEVIEPLVFAMIDLPENFYENRLKERILIMT........................................................................... 270
60 9.000e-59UniRef50_UPI0004DFA392 hypothetical protein n=1 Tax=Desulfobacula sp. TS TaxID=1232437 RepID=UPI0004DFA392  ali  22  1..............................................................................................................MICFEKRKFSVAFSLLRKPLKEHLFFLSWILADEDDFISRFESNNYSSFSRVSKE--ERIKIIGKSISKLHGDAFDAETIWRFLYSKKHVNGFEPTWQRATHLTTSYGDLKTEDYSLNFIFENIFD-DYYYEFLSTKLPYIFLYLSQVTLESFNRIYSANEKTVSHLI-----ITTMGCYEALFLDGRKLSISRTIQKQLGLSCIHCNSKFKIKKRNAPELYLHESFICESCGLKS............... 232
61 1.000e-58UniRef50_A0A2J6GU44 Uncharacterized protein (Fragment) n=1 Tax=Streptococcus pneumoniae TaxID=1313 RepID=A0A2J6GU44_STREE  ali  29  1..........................RHQLMLYLYDILVDILVKADKYQLSSLSFRFTNEINV-------EIDLFDELDKQKDLDISEYVYIPHIFFSILRDLNYYLFESLSCIERGEVTVAFSLARKPFQDNLFYLSWILVQPHDFLEKIQYGAPRE-YDVSDLKGKKEFVIDLLLKAFSRELLDPELLYDIIYNRKAENSLTSVFDQSIHLVTKNKNYPTEKRNLNFIFSDDKIWDDFWHLFYEKTPYILIYLVEVAIAIFEKYF.............................................................................................. 245
62 3.000e-57UniRef50_K2PNE5 Uncharacterized protein n=1 Tax=Galbibacter marinus TaxID=555500 RepID=K2PNE5_9FLAO  ali  25  4............ERYDFLHLPEEFHKKHKTCEFLLYQIEDFILKDEYKKLRTQTID-----LESDLDLLDGENILDYLSRNGKSKEHNEIVTSHVLNALIADICQFLQIALFSSLQERLTVTFSLIRKPFVYDLIIILRLYL-TEDFLEKFNTEDYFDTAKLSK--DELIELINASENMLFTKSIKASDVYNFIFEYSDSDSLINMSNKALHPTTRNKNNKTEIQNINFVFSTKESHKSQWDYIYRRLPFLLLYLNEILECVIFNHLEIDDEIYMSRLTERAKFL............................................................................ 269
63 4.000e-57UniRef50_A0A291QPU4 Uncharacterized protein n=1 Tax=Chitinophaga caeni TaxID=2029983 RepID=A0A291QPU4_9BACT  ali  26  6....................................QIEEFLLRKEFKELFVQVIKTDDNDI------QEGEHLLDYLLRKGRQDDYNHIIKMNLIVGLLSDICYFTQEALVCSLKQRLTVTFSLLRKPFVYTLIIILRLLF-EENFIEKFNNEEGFDPASVS--PEDRTALINASIEAIQNNPITADDLNTMIFDKLVANSIINLSEKALHLTTTRKLFNTEKQNFNFIFSNQESIDSQWEYIYSRLPALLLYVLQVADILVFTSIQVDEGTYEKRLKNRIKIFK........................................................................... 247
64 7.000e-57UniRef50_UPI000B386C5F hypothetical protein n=1 Tax=Clostridium perfringens TaxID=1502 RepID=UPI000B386C5F  ali  23  6................IINVPPELNEKREFCWYVLDIIDYLFNRLIDRDLSVTNVEYDSQKENPSKS-------LDWLLDTGREELFVKILSKNLSIKLLDDLISYIRESLSNLERGNLTISCDLLRKPLKDNLLYLEWLLFDDKQ-LTHLVYNQKIDEYALGRSGLSKEYIKEIVTYNVKNNNYSSELIYDIRYNYDSHLSLELAWNKATHLVTTGKKIR--SIDFNFLYDSPTDIEEFFKYLYGKIPMLLIYILGITESIFDKYFKNINTISKQYNIQLV-VNKYLDMHENYLNSNLPPI------EFFLYCENCKEYYCLEKNNFNLVFEE---ICPKCKNKIKLNKY.......... 325
65 2.000e-56UniRef50_A0A2U0DHV2 Uncharacterized protein n=3 Tax=Chryseobacterium TaxID=59732 RepID=A0A2U0DHV2_9FLAO  ali  26  6...............EYYYLPKKYWKKHSYCEFVISQIEELILDERFIELKVQTFEFS--KDIIDKINVSDEHLFDRMSELGFTNELTKVVRTQLVLSLIMETCYFIQESLLCSLKMRMTVCFTLLRKPFLE-ILILVMRILNESDFIDKF---NNLEGFDPIKTTPNEKRDLILKTNYLLNDLFNNEDLYQYIFDKDFGDSLFNITNNAIHLYTRNPVSATEKQNLNFIFGTQENIDDMWEYIYYNIPMLLTFLAFSIDLLVFKSTTVDEDVFLKRHKMREKL............................................................................. 269
66 6.000e-56UniRef50_G1WED7 Uncharacterized protein n=4 Tax=Prevotella TaxID=838 RepID=G1WED7_9BACT  ali  26  2...............DFYYLPKEYQQTHKMCFELIGQIEEFLVRDEYKFLQVTTYPID--EVEIPNIQKEDFDVWDYLREHN-QAGFRLQLNKSIILGLLKDFCYFMQESLDCSNKMRLVVAYALLRRPLVDNLKILLRFVYD-DNFYDDFIKRNDYDPAHLNDDTLR--EYLDKTDSIRMANSIKGSFIYECIYKKENMGSILNLSNRAIHPVTTRPWNKTGEMNFNFMFATHADIEHLWQHYYAYLPAILLFYVELFNNTIFCLFESEIDKDL-YPKKIEKIVDIMQ........................................................................ 268
67 2.000e-50UniRef50_A0A1M3E2T7 Uncharacterized protein n=1 Tax=Chryseobacterium sp. 39-10 TaxID=1895745 RepID=A0A1M3E2T7_9FLAO  ali  26  4............ERYDFLHLPKEFHRQHKSCEFLLYQIEDFVTAEPFKGLRAQTVQFDKEIE-----LSDGEHILDYLLRTDKSNKHDEIITSHILNAVIADSCQFLQIALFASLQQRLTVTFSLIRKPFVYNLLVILRLYL-TSDFLEKFIKEDSFDTTGISQEDI--IELLNATENLLLSKSIKASDLYDFIFNPALSDSLVNMSNKALHPTTRNKNNKTEIQNINFVFSTKDSILTQWDYLYRRLPLLLLYLNEILEIFLFDHLKLDNEIYVERL................................................................................... 262
68 1.000e-47UniRef50_A0A103BKE1 Uncharacterized protein n=4 Tax=Burkholderia cepacia complex TaxID=87882 RepID=A0A103BKE1_9BURK  ali  21  1.................................................................................................................................MLDSLMYLIWMVADEDNFYAEFTSGDSSRITQKMIGNRRKNLIAAAIEMAELTDIIDADDIVSMIFDSRNEFGLYGLFQHAVHLVTVDREIKTSPENFNFIFKNPNEDDI-YDSLYSQLPIILLLLTHVIAILFGRIQSMDAGTFRAL--KFRSINGGRLIQGSPL---SDIVVDVMSRTLSLKCATCDTSIKVTHHNAARLILTDTFRCTTCKRVS............... 214
69 8.000e-47UniRef50_A0A2N6V5V3 Uncharacterized protein (Fragment) n=1 Tax=Acinetobacter ursingii TaxID=108980 RepID=A0A2N6V5V3_9GAMM  ali  26  1........................................................................................................HCIYESLKAMEKGKVSIAYMLIRKPIQENLYLLEEMIL-KDDFIDIFESNPLKLRHKNGGDVNGHDLRIKTILKDLFDQILDSHYLATLRYDKKSEDSFDGVCNQAMHLFTEHQAIKTENLNINFIFGTNESKETLYQFMYTRLPYLMYYIYLVFEKIANSIANTSPIYLLDIQNRISALLAYVNVENNYQTKQFYKLCIMFEAILNFKC............................................... 214
70 8.000e-45UniRef50_A0A110B0L2 Uncharacterized protein n=1 Tax=Mucilaginibacter gotjawali TaxID=1550579 RepID=A0A110B0L2_9SPHI  ali  45  1........MIIIEKGAKVNLPKEYHLVNNICAHLYDHITEILADSYYSEMRSTNIVFGEDEELKKKFIEKKELALDILKSSNKNDDLEIVLTKHIVMSIISDMVNFIYESMIIAQKGKMSVAFALVRKPFTDQLLILEQILVDRKDFIDRFFHKGNPEDYDPSSHKLNKKQIIKNALSKLELSVFDPELIFELR....................................................................................................................................................................... 186
71 6.000e-41UniRef50_UPI000C334E3E hypothetical protein n=1 Tax=Enterovibrio nigricans TaxID=504469 RepID=UPI000C334E3E  ali  21  2.........................................................................................VIRTVVLPAVLSDMLHCIYEALTAAEKGKMSVAFMLLRKPIQESLYLLEAMVIDENDFVEKLSLDPMFLRPKNGGGPEGHAKRINTVLNRIGLEVMSPEYLGELRYNKSSFDSFDRVCNQATHLFTEHKAIK............................................................................................................................................ 134
72 2.000e-40UniRef50_R7KAF0 Uncharacterized protein n=1 Tax=Acidaminococcus sp. CAG:917 TaxID=1262688 RepID=R7KAF0_9FIRM  ali  20  12.....................EEMINAIEYCETCLNICEAFFLELNNQESCTIPI----EDAQLKEQIKKAQSVCEIEEIARTNSLLDNMYNKRLLKYLLMDFCIYVGQSILNIKQFNPQIAFCLARKPFCETLCYLEKMLINPEETVKLVFSDNNKDIDNRNNKGINSKETYHAVLKILGLDDLK-ESIYDMRYAKDIP-SIRAIGDRASHIATSGAGIKVESGELNFIFIEDGVIEDFTKIYCKLLPLLMYYVVYVINHLFNKIFGKEID-----LKEFNKATDEFFWKENY................................................................... 275
73 3.000e-39UniRef50_A0A0F9FJG6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9FJG6_9ZZZZ  ali  25  36...........................................................................................................................................................NEDNYDLTKLSERKIEIIRKAISKILEDMFKAEELYELRFDKQNESGYEPIWNQAAHLVTTHLNYKTDKTNFNFIFSDNDSKMKQWNYIYSTLPYLLYYTVEVVEAIINNFAE-YKNKDLDLTN-IRRIFGLLLWLDEYNLDNTKETMKYLNRKLIFPCLACNKNIKFGVRNLKMLYQKNEVKCFSCK.................. 226
74 8.000e-35UniRef50_A0A088T2P0 Uncharacterized protein n=1 Tax=Candidatus Izimaplasma sp. HR1 TaxID=1541959 RepID=A0A088T2P0_9BACT  ali  21  29.............................................DYEIKFDKTNANNYMRQFINENTTNDVHLLDEALKQNKEVEFLHIYAKTNIKMMLKDFIENLETSFYALDKRRLSSGFTLSRKPIQDTLFYFEQLLIDHISFTRDLLQGKVISIEEKHKLLINKRNDVLSNIKKMNTTSFKIEQIYKIRFDNNYLGGLNFFWQKGNHLFTTRGAYKTVRADMNFVFSMKEDEDVYLEAYYHNLYYMLEYSMFILLELTTKTFSIVRKNTSEFIEKVRKITK........................................................................... 274
75 1.000e-32UniRef50_K1TEV7 Uncharacterized protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1TEV7_9ZZZZ  ali  27  17.............................................................................................................................................................................................FFDFRYNKASETSLEHIWNNANHLITTYKLSKTEPGNLNFVFADEAILRSFSDYYYITVPAIMSYAVNLICEMFEEFAPLNKYTV--LMNKLNRTLRSFEMLETISFDDAKKLY--SSGNVPIVCPRCGLKMKMTDKKMLKFI-SNKCTCSRCLKTIKTGRYI......... 175
76 2.000e-32UniRef50_A0A116PVT8 Uncharacterized protein n=1 Tax=Streptococcus suis TaxID=1307 RepID=A0A116PVT8_STRSU  ali  27  10...................LPAKYIKRHQLMLYLYDILVDILVKADKYKLSSLSFKFTNEVDEQLE-------LFDELERRKDIDISEKVFIPHIFFSILRDLNYYLFESLSCIERGKVTVAFSLARKPLQDNLFYLSWILVQPHEFLEKMQYGSPKE-YDVSDLKGKKDFVIKNSSLDFSQELLNPELLYDLIFSKKCHKCLI............................................................................................................................................................. 204
77 7.000e-32UniRef50_A0A081Q952 Uncharacterized protein n=3 Tax=Streptococcus TaxID=1301 RepID=A0A081Q952_STRMT  ali  22  1.............................................................................................................................................................................................MYDIVYNRKVENSLTSVFDKSIHLVTRNKNFPTEKRNLNFIFTDEKIWNDFWNLYYEKTPYILLHLVEVATAIFEKYL--DIDIEIAELHRYIRSLKIILALSGEENKELENIFEFISDNLSMVCEECRKAYEFNTIFVKELKEDYLYTCQRCGLIERLGQY.......... 162
78 7.000e-32UniRef50_UPI00066CD6B2 hypothetical protein n=1 Tax=Pseudomonas putida TaxID=303 RepID=UPI00066CD6B2  ali  24  11...................LPEKFHEAHKFCFAAHDIAAQLLVSGMKQGIFFANITCRDEKERIDLEQAND--LLDWLQKSDRLDDEAEVLITMAFPAVLSDMLHCIFEALEASRKGKLAVTYMLLRKPLQESLYLL................................................................................................................................................................................................................................ 126
79 1.000e-28UniRef50_A0A1Y4B5G6 Uncharacterized protein n=1 Tax=Flavonifractor sp. An306 TaxID=1965629 RepID=A0A1Y4B5G6_9FIRM  ali  22  9..................................................................................................................................................................SYEIVRKKDKIRKHIERIPPNPSDPLDMYKFRYSYKDQLTLNGILQATNHLITSRPALKTSPSGLNFIFPDDEIRHRNIGFYYASIPYVLKYTLDLVMKMFGEIAELSDYTM--LINLTNSTLKSLQMISEYADVKQ----LLHLDQINVFCPKCGHRH--NSDEMWIQFAYDHFECENCHNKINTYQFL......... 191
80 1.000e-24UniRef50_UPI0006D17F9D hypothetical protein n=1 Tax=Bacillus sp. JCM 19035 TaxID=1460653 RepID=UPI0006D17F9D  ali  27  1.................................................MSSKKINIENNKVIPDDI----ESPLDWLIENGYKKVAYDSTKAHVFFSILTDFIYYMHESFSCSERGKITVAYSISRKPIKDNLFYLCWLLVDYEELITNILYKKPQDFDVSRMGIEMKEDIFRKAGQK...................................................................................................................................................................................... 126
81 2.000e-20UniRef50_UPI0006D04CD9 hypothetical protein n=1 Tax=Bacillus sp. JCM 19035 TaxID=1460653 RepID=UPI0006D04CD9  ali  22  2................................................................................................................................................................................................................................GNLNFIFANEKVWLEHWKTYYDKITYIMTFMIEVSITLFEEIFNANENT-----KTLNSLIRNMKYDLTFSKEFNTKTYTDLFEILSFTCDECLKEYELKNGVLLEFIHDYLFTCPYCSHMERVGQY.......... 123
82 6.000e-19UniRef50_A0A1Y4BNT0 Uncharacterized protein (Fragment) n=1 Tax=Flavonifractor sp. An306 TaxID=1965629 RepID=A0A1Y4BNT0_9FIRM  ali  26  43...............EDTFLP--FHDFLNYCRICINIIQRADQEQLTKETINFKTAADASAYAKICEEQGDIKE-EWLIQHGYKETLYKVYYKHLFFSLLVDFSNYYNTSIDLAYHGNINVAWALLRKPFQETLAYIEWLYVDRNEL...................................................................................................................................................................................................................... 172
83 5.000e-17UniRef50_UPI000DE514F9 hypothetical protein n=1 Tax=unknown TaxID= RepID=UPI000DE514F9  ali  39  33...............................................QDFAKTTFDFSHDKSKLKELESCQTNTLDWLKNAGLDDELVTTLVKHVTMSVLSDLVNFLYESISNAQKGKMSVAYALLRKPLTDELLIFL............................................................................................................................................................................................................................... 124
84 3.000e-05UniRef50_A0A127VDB3 Uncharacterized protein n=1 Tax=Pedobacter cryoconitis TaxID=188932 RepID=A0A127VDB3_9SPHI  ali  21  1........MIVIEKGTKTVLSSRFHLANNICAYLYDQITEILDAPEYEKMANTDINFNGDPELRSIFEREIATPWIF............................................................................................................................................................................................................................................................................................ 69

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.