current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|60682029|ref|YP_212173.1| putative bifunctional CbiF/CbiG cobalamin biosynthesis protein (BF2549) [Bacteroides fragilis NCTC 9343] (Range: 1-599), from B.fragilis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .
# E-value Template Links and tools%idFirst MKTAIIVISEAGIALAKTLEQELPESEIFSTGTDTDCHSISNLQEAVPEIFHKFDAIIFIGAMGICIRAIAPHIEDKHKDPAVVCVDSTGRYAVSVLSGHIGGANGLTRYVASILGAEPVITTRSDRTGLWALDTLGKKYGWQTVPAESSDMNHLITLFVDCKPTALLLDIRDEGTTQLEHTLPPHVDVFYKFEDMDLRKYDLLLLVTPFIYNTSDTPALYYVPPVLHMGVGLARDAHPVDTVITHLMDVVVQANMIPLAIRTVSSIEEKKDEPVLKLLAEAYQTRLYTASQLSKIEVPTPSEVVNKHMGTPSVSEASALLSSGGGPLLLPKQKGANFTVAIAMDAASVRQGHIEIVGAGPGDPELISVRGRHFLEEADLILYAGSLVPRELTECAKAGATIRSSASMTLEEQFALMKEFYDRGQLVVRLHTGDPCIYGAIQEQMNFFDQYGMHYHITPGISSFQAAAAALQSQFTIPERVQTIILTRGEGRTPMPEKEKLSLLARSQSTMCIFLSAGVVDQVQRELLEHYPPTTPVAACYHLTWKDERIFRGQLQDLAKIVNENHLTLTTMIVVGDAIDNREGLSRLYSHQFKHLFRKLast
1 0.000e+00UniRef50_Q1N4M1 Siroheme synthase n=6 Tax=Oceanospirillales TaxID=135619 RepID=Q1N4M1_9GAMM  ali  19  161...................................................................................................................................................................................................................................................................................................YRSKVKAKFSDVNRRRGFWETVLHGKVANLVFAGQDTQAESTLQALLEDAADEA---KAQGEVYLVGAGPGDPDLLTFKALRLMQQADVVLY-DRLVSEPILKLCRRDAKMINVHTVPQDGINQMLVDYAKKGHRVLRLKGGDPFIFGRGGEEIERLSDNGVDFQVVPGITAASGCSSYAGIPLTHRDYAQSVRFVTGHLK-DNSANLPWSELAYKNQTIVFYMGLMGLPIICEQLIAHMGNETPIALVQQGTTLNQKVIIATLDTMVDVLSTQQIKAPTLIIVGDVVKLHDQLKWF........... 459
2 0.000e+00UniRef50_F3ZW49 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=1 Tax=Mahella australiensis (strain DSM 15567 / CIP 107919 / 50-1 BON) TaxID=6972  ali  32  1MSTAIIALTEDGCRIARRIAEDLENADLYMPSRYAVVYSESELKALTAELFRGYDALIFITAVGIAVRCISPYLKDKYNDPAVVVIDDMGKFAISLLSGHIGGANNLTKQVANIIGACPVITTSTDNRGLWAVDLFADEHGLKIENK--SDVKTVSAALINGGRVAWYTD-------DLSIEVPFGLYNVPGISDID-KNYSAAVLCTIVAARQLPVPAVWLRPAVVSAGIGCQRGEKSCN-IEKAIYEACGMAGISFNAVARICSIDIKENESGLKECASNIGLHFYSAEEIKMVEHLFSSAFVSSKVGVGNVAQSCAYLDSMLGELLLPKTIISGIT.................................................................................................................................................................................................................................................................... 336
3 0.000e+00UniRef50_Q30XG4 Uroporphyrin-III C-methyltransferase n=15 Tax=Bacteria TaxID=2 RepID=Q30XG4_DESAG  ali  25  1...............................................................................................................................................................................................................................................................................................................................................................MKVYLIGAGPGDPGLLTIKGRDILKRADVIVY-DYLANDAFLNYAAPGAEIIYVHTLSQEGINRLIVEKAREGKVVARLKGGDPYVFGRGGEEAEELLDAGVNFEVVPGVTSAVAGPAYAGIPLTHRSYSSSVSFITGHEDPSKPESHNWKALAASASTLVFFMGMKNLPEISRKLIAGMDPDTPAALVRWGTTSRHRSLAATIATLPEEGKKAGFSSPSLIVVGHVVKLRDRLNWF---EQLPLLGR 252
4 0.000e+00UniRef50_A0A2N0W0W8 Siroheme synthase n=16 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N0W0W8_9GAMM  ali  22  162....................................................................................................................................................................................................................................................................................................RSRVKAQFSEMSDRRRWWEKLFNHHRLAQSLANNDDVQSGQY-----LEELFSEPVDKHGEVILVGAGPGDAGLLTLKGLQQMQLADVVVY-DRLVSDGVLNLVRRDAERIGHHCVPQERINEILLEQAQMGKRVVRLKGGDPFIFGRGGEELEALKAAGIAFSVVPGITAASGCSAYSGIPLTHRDHAQSVRLITGHARQDG--ALDWACLAQGQQTLVFYMGLTQAAEIQRRLLEGLPAQTPVALVENGTSQQQRVVTGNLTDLENLAK--QVQSPSLIIVGSVVSLRPKLNWF........... 454
5 0.000e+00UniRef50_A0A2N8QBC8 Precorrin-3B C(17)-methyltransferase n=3 Tax=Burkholderiaceae TaxID=119060 RepID=A0A2N8QBC8_9BURK  ali  17  5...AIVILGTGALATARRIQTLHAGSQVHALQRVEADVSYAELRAHLCDLYARGTPIVALCAAGIVIRCIAPLLSNKGVEPPVLAVAEDGSAVVPLLGG-LAGVNVMAREIAAELAVPPAITTSGELRFGTCVLNPPEGYAL----ADIAQGKRFVSDLLAGESTRIEGEAPWLDDAQLPRSESARLAIRVTPRAWEGRDDELVIHPRSGAGAGASSGSPSATNANLSANSRSDSRTGSGARIAALVRDALDTHGLAPLSLAALLAPSEHMLDPALADAAASLNVPLRFA-QPRPQDGEPPSNLLHAALRVP---------YQTLHDDADAGVALALAALAIDPHTIGRARGRLTVIGLGPGRADLMVPAARTALNEATDILGYETYVK--MAGPLRADQRVHGTDNREEMQRARHAFELAGTGRSVVMVSSGDPGVFAMAAAVLEALEEGGVELAIVPGVSAAMATAAQAGAPLGH----DFCMLSLSDNLKPWTIIERLRHAAEADLVMAFYNPISRLDKALDILREYRTAATKVVLGRDIGRPG-----GTLRTITRELRSSDVDMRTMVIIGSSTTRGDGGEWVYTPRWY..... 598
6 0.000e+00UniRef50_P42437 Uroporphyrinogen-III C-methyltransferase n=259 Tax=Bacteria TaxID=2 RepID=NASF_BACSU  ali  27  1..........................................................................................................................................................................................................................................................................................................................................................MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILY-DRLANPKLLEFASPDCQFIYCGKLPQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSKGTPNLDWEGLARSVQTLVFYMGVKNLSYICQQLISGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIVNF-QTHSWFES---KPLIGR 256
7 0.000e+00UniRef50_A0A2N2T3G6 Uroporphyrinogen-III C-methyltransferase n=5 Tax=Betaproteobacteria TaxID=28216 RepID=A0A2N2T3G6_9PROT  ali  23  1...........................................................................................................................................................................................................................................................................................................................................................MPDVGRVYLVGAGPGDPELLTLRAVRLLQQADVIVY-DHLVSPGVLDFVSPTAERIYAHTMRQEQINLLLVKLASEGKQVVRLKGGDPFIFGRGGEELQELAKHGIAFEVVPGVTAASGVASYAGIPLTHRDYAQSCIFVTGHLKDG-TADLDWPSLIRLHQTVVIYMGLGGLAEICHQMMHGASPALPIALVQDGSIASQKVVVGTLSNMPERVASENLKSPCLTIIGEVVKLHDELAWF........... 246
8 0.000e+00UniRef50_A0A2V1JMJ7 Uncharacterized protein n=1 Tax=Eubacterium ramulus TaxID=39490 RepID=A0A2V1JMJ7_EUBRA  ali  22  1.........................................................................................................................................................................................................................................................................................................................................................MEQKKEGKVWLVGAGPSDAELLTLKAKRVLEQAEVVVY-DRLVGESILLMMPEAAEKIDNHTMPQEQMNELLLKKAQEGKCVVRLKGGDPFLFGRGGEELELLAKHNIPFEVVPGVTSAISVPAYNGIPVTHRDYASSVHIITGHKKKDEPLNLDFTTLAKLEGTLVFLMGVSALTDICQGLCNGKAKETPAALLSRGTTAKQRRIVSTLEKLPEEVKKNPMETPAVIVVGEVCGLSDEFNW---YEKLTLFGK 257
9 0.000e+00UniRef50_B6EHI0 Siroheme synthase n=419 Tax=root TaxID=1 RepID=B6EHI0_ALISL  ali  22  11............................................................................................................................................................................................................................................................................................................................................FWNPIMPSIQAQSEQKKQNGFVSLVGPGPGDADLLTVKGYRLIQQADVVVY-DRLVSKEILALANDTAEMIYVGKKPQDKINQILVDKAQEGKHVVRLKGGDSFIFGRGGEELETLAENGVRFEVVPGITAAAGATSYAGIPLTHRDHAQSVQFITAHVQKDGAEIE-WDALVRSNNTLVFYMGLKQSSHISTQLIEHLAADTPCAIIERGTTQKQKVFTGTISELAQMAKNA--ISPSLIVVGSVTTLHHKLDWF........... 269
10 0.000e+00UniRef50_UPI000C7AC5DA cobalamin biosynthesis protein CbiG n=1 Tax=Lachnoclostridium edouardi TaxID=1926283 RepID=UPI000C7AC5DA  ali  26  1MNIGVISFTAAGGELGRKLKIGLEGVRLYIQERFFNKEETEPARDWAGKRFLDSQGLIFIGAAGIAVRSIAPFIKDKYKDPAVAVIDQQGRFSISLLSGHVGGGNDLAEAAARILGAVPVITTATDIENCFAVDVFAKKNRLEIT--DRTAAKNISAAVLEGKKIGFFSDFPVKGQAPECFCMLD--------KEEDLSETSLNIYITLKKNIGW-RNTLYLTPKQLVLGVGCKKGTEK-DVILHEIKEFLKDYNLNGRGIKMIASIDLKAKEQGMIQAAKELGVDFFSAEELKNVPGNFESDFVKQVTGVGNVCQRAAVLGSCMGRLITGKQ.......................................................................................................................................................................................................................................................................... 336
11 0.000e+00UniRef50_A0A1V5DUG4 Uroporphyrinogen-III C-methyltransferase n=1 Tax=Smithella sp. PtaU1.Bin162 TaxID=1811697 RepID=A0A1V5DUG4_9DELT  ali  25  10.................................................................................................................................................................................................................................................................................................................................................................VYIIGAGPGDAGLITVKGADCLGRADVVVY-DYLVNEELLEYARPAARFVYAHTLPQDKINELLVREAQDGNTIARLKGGDPFIFGRGGEEAEELARNNVPFEIIPGVTSAVAVPAYAGIPLTHRGLTSTVAFVTGHEDPAKESDIDWPTLA-GIGTLVFLMGVKNIARITDALIKGKSPSTPAALIRWGTTPRQEVVTATLDAITVRAEACGFAPPAILVVGNVVDLRETLKWFD---GKPLFGK 258
12 0.000e+00UniRef50_A0A149W0K2 Siroheme synthase n=2 Tax=Ferrovum TaxID=416212 RepID=A0A149W0K2_9PROT  ali  27  339.................................................................................................................................................................................................................................................................................................................................................................VFLVGAGPGDPDLLTVKALRLMNQADIVVY-DNLVSPGVMALLPPGATCLYVHAVPQESINELLVRLALEGKRVLRLKGGDPFIFGRGGEEIETLAAHGISFEVVPGITAASGIAAYAGIPLTHRDHAQSCIFVTGHLKDG-TMDLDWVNLARPQQTLVVYMGLHGLEILCRELISHLSPTTPAAIIQQGTTRHQRVMTGTLETLPAQVRTEPLQAPTLIIVGGVVSLHRTLHWFNQETSSP.... 585
13 0.000e+00UniRef50_P25924 Siroheme synthase n=5607 Tax=root TaxID=1 RepID=CYSG_SALTY  ali  20  157...............................................................................................................................................................................................................................................................................................YAGQLRARVKKQFATMGERRRFWEKFFVNDRLAQSLANADEKA-----VNATTERLFSEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIVVY-DRLVSDDIMNLVRRDADRVGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTGGE--LDWENLAAEKQTLVFYMGLNQAATIQEKLIAGMQADMPVALVENGTSVKQRVVHGVLTQLGELAQ--QVESPALIIVGRVVALRDKLNWFSNH........ 457
14 0.000e+00UniRef50_D5EA84 Uroporphyrinogen-III C-methyltransferase n=20 Tax=root TaxID=1 RepID=D5EA84_METMS  ali  27  1..........................................................................................................................................................................................................................................................................................................................................................MNSGYGKVYLVGSGPGDPELLTIKARKLIDSAEVIVY-DQLPGEAILQSMPETAEKIDNHKLTQTEINDMIVKKAEEGKNVVRLKGGDPYMFGRGGEEAEKLVQAGIDFEVVPGITSAIAVPAYAGIPVTHRDHASMVTFITGHEDTKKETGLDWENLARFPGTLVIFMGVKRLEQNMNALKKGKSPTTPVAIIEKGTHPDQRITTGNLENIAEKAKKAGVKAPAITVVGDVVSVHDIL.............. 246
15 0.000e+00UniRef50_N1ZNG0 Uncharacterized protein n=1 Tax=Clostridium sp. ASF356 TaxID=97138 RepID=N1ZNG0_9CLOT  ali  28  1MKVYVISFTKKGTLLAQKICQKLERAMCFSMKVVQDDIEVTSLEKWTQKAFEEADGIVFVGACGIAVRAIAQYLKNKYQDPAVVVIDEKGQFAISLLSGHIGHGNALAKKVAEITNGTPVITTATDVNGIFAVDTWVKENGFLYLNKQQKAMKEISATLLEEKAVGF-------DSMFYYSKLPKGLV--------ATKDCEVGISVSIYKQNKIFQQTLALIAPIVHIGIGCKKNT-SFEEIEQCVFSVLEEENIAIEAIEAVATIDLKQNEKGLLTFCQSYQLNIFSTEELSAVKGDFTSDFVLEKTGVDNVCERAALCSAQNGKIIVSKRAKNGVTVALAM............................................................................................................................................................................................................................................................... 334
16 0.000e+00UniRef50_A0A2E0HDE9 Siroheme synthase n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E0HDE9_9GAMM  ali  19  158...............................................................................................................................................................................................................................................................................................FVGEHRDHVKSVIPNEKQRKTFWEH-VLQGAIGEAIYSGNTEHAK---VLLDSALDQPEAYNLQGEVYLIGAGPGDPDLLTLRAFRLLQQSDVVLY-DRLVSDGVMALIKPDTETIYVHTVPQVDINQLLVEYAQQGKRVARLKGGDPFIFGRGGEEIEQLLDLGIPFQVVPGITAANGCSSYAGIPLTHRDYAQSVQFVTGQFQDG-TTTLNWDELVSPRKTLVFYMGLKSLPVICHSLVHGMDPEYPVALIEKGTTKSQKILVSSLSKLPDQLDKQTISSPSLLIIGEVVKLHRKLNW............ 458
17 0.000e+00UniRef50_A0A158D7B7 Precorrin-3 methyltransferase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A158D7B7_9BURK  ali  19  2...AIVVLGAAALDTARRIQARFPESRVHATGRADADIAYEDFGAHVRALYASGVPIVALCSAGIVIRAIAPCLADKGNEPPVLAVAQDGSAVVPLVGG-MSGVNVLAREIGAALQVTPAITTSGELRFGQCLLAPPEGYVL----ADIEQGKRFVSDLLAGKATRIEGRAPWLDDADLPR----------------ADDAPRAVRITPHALH--DEHSLVIHPRCVVAWIDNDKDV------AERVRSALRERNLAPLALAALTAPAHYMASRSLDDAARALNVPLRFCD-----TAPFDIDDARAIALHVSDAPIDAQSIGRARGTL-------------------------TVIGLGPGSAELMTPAARSALVVAQDVLGYETYV--RMAGPFRDDQRVHMTDNREELQRARHAFELASEGRRVVVVSSGDPGVFAMAAAVLEALDDERVKLAIVPGVSASLATAARAGAPLGH----DFCVLSLSDNLKPWSVIERIAHAGEADLAMAFYNPLSQFDRAIDIVRRYRDSKTPVVLGRDIGRPAEALRIVTLGE----VKSELVDMRTMVIVGSSTTRVMG-DWVYTPRWY..... 537
18 0.000e+00UniRef50_A0A2N1UKC7 Uroporphyrinogen-III C-methyltransferase n=2 Tax=Nitrospira TaxID=203693 RepID=A0A2N1UKC7_9BACT  ali  27  8.................................................................................................................................................................................................................................................................................................................................................................VYLVGAGPGDIGLLTVKGMRCLEKAEVVIYDFHL-NAQILNYIDNDAEFIYHHTMTQDEINAAILQKAKEGKRVCRLKGGDPFVFGRGGEEALILANEGIPFEVVPGVSSAIAAPAYAGIPLTHRLYSSSFAVIPGYEDTKEKSSIDWAKLATGVGTLVFLMAVKNIDLLTEKLIEGRSPDTPVAVIRWGTRPDQKTLVSTLKDIAKLVREKDIRPPAVTVVGDVVNLRNELNW---YEKKPMFG. 256
19 0.000e+00UniRef50_A0A095XGQ3 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=A0A095XGQ3_9FIRM  ali  25  3.KICIIAFTDNGMMTAGKIKKIFESGTRINPSNCINEKYFVEIRSYVAEKFNDYDAFIFVGATGIAVRYIAPHIKSKDVDPAVIVLDEHAGFVIPLLSGHLGGANELANLIAHELGATPVITTATDINAKFAVDLWTKKTNQSIT--DISKIKDVSSAILRNEKIGIYSDFEIIGTLPKKIIECSNDV---------DENPNIGIAVSLDEKKKPFKNTLNAVPKIVVLGVGCRRNTESA-KFENFILKILRNENISIKAVDMIASIDIKKDEKCILDFSNKYGIPFATADELMTVPGEFSSSFVKSITGVDSVCERSAAYFSKNNKILLGKTSHNGMTCSIAVRDWKCKF........................................................................................................................................................................................................................................................ 356
20 0.000e+00UniRef50_G5RLP7 Siroheme synthase n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=G5RLP7_SALET  ali  24  1..................................................................................................................................................................................................................................................................................................................................................................MLVGAGPGDAGLLTLKGLQQIQQADIVVY-DRLVSDDIMNLVRRDADRVGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTDGE--LDWENLAAEKQTLVFYMGLNQAATIQEKLIAGMQADMPVALVENGTSVKQRVVHGVLTQLGELAQ--QVESPVLIIVGRVVALRDKLNWFSNH........ 239
21 0.000e+00UniRef50_A0A2N6EB32 Cobalt-precorrin 5A hydrolase n=5 Tax=Desulfuromonadales TaxID=69541 RepID=A0A2N6EB32_9DELT  ali  31  1MNIAIIAITPGGAALARRLDGSLPGAEVHLPERFRQDYFREPLAEVLPRLFAEGRPLVCVMAAGIAVRLLAPHLQGKSVDPAVVVMDERGAFAVSLLSGHLGGANALARQLAALSGGQAVVTTATDVNGLPAWDEVARQEGMTIEPL--AAIRTLNRLLLEGGKILLADEGGLLGYRYEGV---AGVRRIATVEEALRGDAEGKVLVTHHLRSEGEGNVLFLRPRNLAVGIGCNRGT-SAEEIEKTVFSELERAGLSPRSIACLATVEAKRDEAGLLRFAEAHGLPFYSAEELNRVEAPSASPHALAAVGARGVSEPAAILASGGGPFLLPKVKRGNVTVA.................................................................................................................................................................................................................................................................. 344
22 0.000e+00UniRef50_UPI000BB6D246 uroporphyrinogen-III C-methyltransferase n=1 Tax=Enterobacter hormaechei TaxID=158836 RepID=UPI000BB6D246  ali  20  50...........................................................................................................................................................................................................................................DVWAQEGMLTQVQGEFDESLLDTCWL-TIAATDNDDVNQRVSDACEARRIFCNVVDAPKEASFIMPSIIXRRRFWEKFFVNDRLAQSLANQDA-----KAVEETTEQLLSEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQQADIVVY-DRLVSDDIMNLVRRDADRVGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTGSE--LDWHNLAAEKQTLVFYMGLNQAATIQAKLLEHMEADMPVALVENGTAITQRVVDGVLTQLGELAQ--QVESPALIVVGRVVALREKLNWF........... 410
23 0.000e+00UniRef50_UPI000DCFE915 uroporphyrinogen-III C-methyltransferase n=1 Tax=Catenovulum sp. RQJ05 TaxID=2234133 RepID=UPI000DCFE915  ali  18  18....................................................................................................VGGGDVAFRKVTALLKSQAHV-------EIISPD-LCKELAALLSHEHLTWLKEYAAEHIQDKRLVVAATDDSVINKQIFDYCEANKILINTVDQPEFCRYT-----TPSIIDRSP----------IVIAISSGGNAP---VLARRLRAKIET--LVPQSTKTLAE---------------------FSGKIRDRVKNEFSSFKARRHFWERFFNSSFA----SNIDKYTETEQQQALDSLLAKEQALTTNGEIWLVGAGPGDPELLTLKAMQKMQQADVILY-DRLVSKDILDLARKDAEFVGFHSVPQDNINNLLIEYAQKGLKVCRLKGGDPFIFGRGGEELEQLLELNIQFQVIPAVTAASGCSAYAGIPLTHRDHAQSVVFVTGHCRNSGE-HPNWRTIAQPNQTIVIYMGLTQSAEISQRLMNGVAADMPVALIENGSTPEQRVVLSTLDNLSKTIEEQNVQSPALIIVGNVVTLHNKLKW............ 457
24 0.000e+00UniRef50_A0A1I3WJT7 Siroheme synthase n=8 Tax=Enterobacterales TaxID=91347 RepID=A0A1I3WJT7_9GAMM  ali  24  157...............................................................................................................................................................................................................................................................................................IAGNWRERVKQRFSSVRQRRYFWEKAFNGRFATLVANGQRQQAEEQLEQQLSE-------NQAQGELALVGAGPGDPGLLTLKGLQVIQQADVVLY-DHLVSAEILELVRRDADKIGNHSVSQEETNALIIKLANQGKKVVRLKGGDPFIFGRGGEELQIAADAGIPFQVVPGITAAIGATAYAGIPLTHREHSQSVTFITGHCREDGHE-LDWPALARGNQTLAIYMGTIKAALISQKLISHRDANTPVAVIGRGTRPDQQVLTGTLSELDRLAQEAP--SPALLVVGEVAQLHHQIAWF........... 453
25 0.000e+00UniRef50_B0G7Q6 CbiG n=5 Tax=Lachnospiraceae TaxID=186803 RepID=B0G7Q6_9FIRM  ali  25  1MKAAILSFTANGRKTAGKVRKALSAEDWLVKCKEEADSYEGSLKEWTGEHWKVSDVLIYVGAAGIAVRAVASFVVSKKEDPAVLVIDELGKYCIPILSGHIGGANELAEKLSQMLSMEAVITTATDLNQKWAVDIFAKKNRLYIE--DMKLAKLVSADILAGKQVLAEIEPECS----VIGQIPKELKFIHESDKCDSRTLKIHIGIKNDAPAGSGTQVLYLIPKAVVLGIGCKKGTD-AEKIEKHVTQVLEDYGIFPEAVKLAASIDLKKEEPGLCTYCEKYDIPFFSKEELEQAEGKFTSEFVKQTTGVDNVCERSAMCAGGEKILVHKTAH......................................................................................................................................................................................................................................................................... 335
26 0.000e+00UniRef50_A0A109CAT8 Uroporphyrinogen-III C-methyltransferase n=11 Tax=Bacteria TaxID=2 RepID=A0A109CAT8_9BACT  ali  24  8.................................................................................................................................................................................................................................................................................................................................................................VFLVGAGPGDIGLLTLKAHRCIQKADTILY-DFHVNSRLLNLAKEGAELIYRHEMTQDEINKSLLKKAVEGKIVCRLKGGDPFVFGRGGEEAEILAAHGVDFEIIPGVTSAISVPAYAGIPLTHRKHSSSFAVVTGNEDTKKDSKLNWPAIAQGFDTLVFLMGVKNIDYITSKLIKGRDPLTPAAIIRWGTRPEQVTLTTTLKDISETAKGQKIRPPAVMVVGSTVGLRDTLNW---YEKKPLFGQ 257
27 0.000e+00UniRef50_A0A1I2S391 Cobalt-precorrin 5A acetaldehyde-lyase n=2 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1I2S391_9FIRM  ali  31  1MKTAVICITRRSYNLGSQIKRKLGETDLYSSARADDTIYFKSLSGLVREIFPLYRQIIFIMALGIVVRVIASLVKSKTTDPAVLVIDENGNNVISVLSGHLGGANKLTRHIAELIGAKPVITTATDVQGLPAVDDLAREYNYALDPV--SAVKAVNSAIVNGGMVYFY------GSKKLKIAGDTSLNFLALSDYPNRHRADFNVIITNEIIPNRLANTLFLRPRNLVVGIGCRSGT-SADKLLDAINTSLEICNRSPLSLRAIATIQLKAAEPGLIQTAAALKIPVFSADEINCFINETHSDFVQKNVGVPAVCEPAALMATGKGELLLPKQKFPGITVA.................................................................................................................................................................................................................................................................. 352
28 0.000e+00UniRef50_A0A140LED3 Cobalt-precorrin-5A hydrolase n=15 Tax=Clostridiaceae TaxID=31979 RepID=A0A140LED3_9CLOT  ali  29  1MHKAIITLTKGGLQLGLKLHGEMADSVLYVHRKFEIEKIHGPMKEFVGEIFHQYQCLIFIMAAGIVVRTIAPHIQDKKWDPAVIVLDEKGKNVISLLSGHMGRANGYTLEIAQLLGANPVITTASDVNEKIAVDTLAMALDCSIENF--RDATRVTAHIVNGERVGMISHIPV------EVALPENMVLIDE-EQAVQEKFAGLIYITEKRIPKIAWDYVVLRPKNIILGIGCKRG-KSKEEIMDAILDTLHALGVAEASIKHIATVDVKKDEPGLLEAAQALGVPLVSREALKAVEDEFESDFVRKSIGVGSVCEPAAFLTSSGGIWLQRKTIHNGITIAVLREGGNPYGNHC..................................................................................................................................................................................................................................................... 353
29 0.000e+00UniRef50_F0SZ42 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=6 Tax=Clostridiales TaxID=186802 RepID=F0SZ42_SYNGF  ali  28  1MKASVFSFTRNGAGLGLQLKDLLQEVGIYSAKALSEPLYDPDLNTVVKQAFQSCSLLVFIGACGIAVRLIAPYIRDKRSDPAVICLDEKGTFVIPLLSGHIGGANKLALFIAEQTGAQPVVTTATDLHGLMAVDLWAAEHNLYIQ--DMEAAKKISALFLEGKTVGLESEFEIAGEVPPYI--------------LSGRNSPVGICIALDDRRKPFATTLNLIPRIACLGLGCRKGV-SLNVIEELVEDVLGEEHISRRAIAGIATIDLKKEETGLRELAAKYRLPLFTARELGSVCGEFTSPFVRQVAGIGNVCERAAVLLSGNGKLIVPKRVQNGVTLAVAQKNW............................................................................................................................................................................................................................................................ 342
30 0.000e+00UniRef50_UPI000C160040 cobalamin biosynthesis protein CbiG n=1 Tax=Lachnospiraceae bacterium Marseille-P3773 TaxID=2002841 RepID=UPI000C160040  ali  28  1MKLAIVSFTKAGSILNDKMVRLLEPAHSYYKGRCEAGVIEEDLQDWCERQFADMDGIIFIGACGIAVRTIAPFVKDKTKDPLVLVIDEGASFVISLLSGHIGGGNELTLEISRLLQATPVITTATDINGRFAVDVFAKREGLFIT--DMKMAKEVSAAVLEGQRIGLSTRLQIEGEIPKELVLPPVSDVVMPFDNDDENTIDTGICISYDE-EKPFTNTLNLIPKRFILGIGCKKNIESK-KLEEFLLNLLQEVQISVHAIKTIASIDLKVDEACIRAFSDKYEIPFYTAEELKAVEGDFESDFVKQVTGVGSVCERSAIKACRKPATLFMRKRAYEGMTA.................................................................................................................................................................................................................................................................. 354
31 0.000e+00UniRef50_UPI00097DD6CB uroporphyrinogen-III C-methyltransferase n=1 Tax=Mailhella massiliensis TaxID=1903261 RepID=UPI00097DD6CB  ali  27  1...............................................................................................................................................................................................................................................................................................................................................................MYVYLIGAGPGDPGLLTCKGRQALSEADVVVY-DYLASDELLALARPDAEFIYVHAMKQGDINRLLIAKAKEGKVVARLKGGDPYIFGRGGEEAEELVDAGVPFEEVPGISSSIAGPAYAGIPLTHRAWSSSVTIITGHEDPTKPGSVNWDALARSASTLVFLMGMKNLPDIAAKLIAGMDKDTPAALVHWGTTSRQRSLASTLADLPDAAVREGFTNPSIIVVGDVVRLKDKLDWF---EKKPLFGR 252
32 0.000e+00UniRef50_A0A1M6DTZ5 Cobalt-precorrin 5A hydrolase n=9 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1M6DTZ5_9FIRM  ali  28  1MKISIISFTKTAARLNKKIRDRMEGKQIVSYSKGKNSPVIESVTEWTGEMFESQDAIIFIGACAIAVRSIAPYLVNKSKDPAVLVIDEKGNYVIPILSGHIGGANELAMETASVLGAIPVITTATDLNGKFAVDVFAAKNRLHI--SDMMCAKEISAAILNGEVVGFASELPVEGRIPPELNMSEHT--------------EYGIRIALNELPVLSEKTLQLTPKIVTIGIGCRKDKDPSD-IEKALLSFLDSQGIPMHAVERIASIDLKKDEKGILDFAHKYKIPFHSAEELGSVRGAFSSEFVESVTGVSGVCERAAVLAGGNCTLMVRKTIINGVTLA.................................................................................................................................................................................................................................................................. 335
33 0.000e+00UniRef50_A0A285GSB8 Uroporphyrinogen III methyltransferase / synthase n=2 Tax=Orenia metallireducens TaxID=1413210 RepID=A0A285GSB8_9FIRM  ali  28  1.............................................................................................................................................................................................................................................................................................................................................................MAGKVFLVGAGPGDEGLITLKGLNAIKEADVILY-DRLANPKLLEYSKDSVELFYVHYRTQDEINQLLIEQAQAGKVVTRLKGGDPFIFGRGGEEGQELLQAGIDFEIVPGITSPISVPAYAGIPLTHRNYNSSIALVTGHEDPTKDKNVDWQKLATTIGTIVILMGVGNLPKIVPQLIAGRNPQTPVALIRWGTRPEQETLVGTLDNIVDKVRSANFKAPAIIVVGEVVRLRKELNWF---ERKSLFAK 254
34 0.000e+00UniRef50_A0A2M7F4X6 Cobalt-precorrin 5A hydrolase n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A2M7F4X6_9BACT  ali  25  16MKIAVLSVTRNGREIGKRLCEALPACHGYTLSNLAGEPFDPPLSDLVARIWGRYRSMIFVMAAGIVVRVIAPLLEDKRTDPAVLVIDEKGEHVISLVSGHVGGANALCRKAAQAIGADPVITTATDLSGFPAVELWAGEMGLAVENPE--AVKKINASLVNGLCVGIFREVPWIGDA------DGSWVSFDTLEGLLGSSCEARIIVSSRRIREQDPGTLILRPRNLVLGIGCNRGT-SGTEIHEVVTELLKREGFALQSVGRIATIDVKKDEAGLLNFAAKLGVPFYTRDELNAMDGSGPSVWAEKELGVKGVCEQAAMKGAGADSLVISKAVSGNVTAA.................................................................................................................................................................................................................................................................. 362
35 0.000e+00UniRef50_A0A1V6AQL1 Uroporphyrinogen-III C-methyltransferase n=12 Tax=Bacteria TaxID=2 RepID=A0A1V6AQL1_9DELT  ali  26  10.................................................................................................................................................................................................................................................................................................................................................................VYIIGAGPGDAGLITLKAVECLRQADVVIY-DNLVNEELLKYAPTHARMIYAHTLSQDRINELLAKEARGGSTVARLKGGDPFIFGRGGEEAEVLAAYGIPFEVVPGVTSAIAVPAYAGIPLTHRGLTSTVAFVTGHEDPTKDSDINWQALS-GIGTLVFLMGVKNIGQITEALMQHKSPDTPAALIRRGTTPSQQVLAGTLSTIAGLARTRHFKPPAILVVGPVIQLRDTLRWFDS---KPLFGK 258
36 0.000e+00UniRef50_A0A1W9VXW1 Uroporphyrinogen-III C-methyltransferase n=4 Tax=Fusobacteriia TaxID=203490 RepID=A0A1W9VXW1_9BACT  ali  24  1..............................................................................................................................................................................................................................................................................................................................................................MGKVYIVGAGPGDLELLTLKGKRCIEEADCIVY-DRLVNPQILSLAQRECEMIYLGKGNQDEINRTIVEKAKEGKIVTRLKGGDPFVFGRGGEEILALNKAKIPFEVVPGITSSISVPSYSGIPVTHRNIARSFHVFTGHTSKEGTWH-NFDAIAKLEGTLVFLMGIKNLDLITNDLIKGKSPTTPVAIIEKGSTSKQIVIEGTLETIAKIAKEEKVVPPAIIIIGEVVNLRSEFNWF---EKLPLFGK 251
37 0.000e+00UniRef50_A0A2W4ZKM8 Precorrin-3B C(17)-methyltransferase (Fragment) n=1 Tax=Phormidesmis priestleyi TaxID=268141 RepID=A0A2W4ZKM8_9CYAN  ali  25  4.NLAAITTTPAGLRCLAPLIET--TAQLWVAPKLSPEIYDTSLAAFLQANWHEYEGFIFCLASGAVVRLIAPLLTDKSNDPAVMVVDYSGKFAISLCGGHQGGSDRLTHHISQLLNAQPVLTGSANALNLPAIDTLGTPFGWR---KGKGNWLGVSSAIARQAPIQVIQEAGSDLWAHLPADHPFQFGFPEFEDRNRQPQPAARVWISPSDLPTSDLPKVQWHPRVLWIGIGCERDTDEA-LIQFAVETVLKQHHLAIEAVAGVASLDLKADEVGLLAFVQAQGWPCFSADTLKAIAVPNPSEIVAHEVGTPSVAEAAALFAASACDLPVKDLTVKKQAVAQAEQEYTGRIGKLHLVGTGPGHLDQITPAAKGAIANADVVIGYALYV-DLIRSLLTAGQIVEALPITQERQRAERAIELANWGLTVAVISSGDCGIYGMAGLVLEQLQAEKWDVQVFPG........................................................................................................................................... 503
38 0.000e+00UniRef50_A0A2H0LYR2 Uroporphyrinogen-III C-methyltransferase n=5 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2H0LYR2_9BACT  ali  23  1............................................................................................................................................................................................................................................................................................................................................................MQKSTVYLTGAGPGDAKLITVKALELIKRADCVIY-DYLANPDLLKFAGEKCKVIYVHTLPQAKINRLLVSSAKKYKTVVRLKGGDPFIFGRGAEEAVFLKKHKINFEIVPGVTSAIAVPAYAGIPLTARAHNSSVGFITGHEDPGKESNIDWQALARGLGTLVFLMGVGNLASITKKLIAGKDKSTPVAVIRWGTTTEQKTIVGNLGNIAGLVKKNKIKPPAITVVGEVVGLRKELSWF---EKKPLLGK 255
39 0.000e+00UniRef50_A0A124ILG3 Uncharacterized protein n=1 Tax=Gracilibacter sp. BRH_c7a TaxID=1734398 RepID=A0A124ILG3_9FIRM  ali  25  1MKATVFSFTRKGARLSAKISKVLEQTDCYTLNEFLSESPETNLSTVVGKAFLDSSLLIFIGACGIAVRSIAPYIRDKQTDPAVICIDEQDRYIIPLLSGHIGGANRVAKNIGLQIKAEPIITTATDINGLIAIDEWAKRNNVVI--SDMSIAKKVSANLVDGQNVGFASDFEISGEIPEQFSV------------GSTRNCDVGICISLDESQKPFKTTLNLIPRIAFLGIGCKKGI-SSEAIEELVLEMLEKNNISIKALAGISSIDIKEGEKGLQEFSSKYDLPFYSANELNLLRGEFSSDFVAEITGVDNVCERAATLLSQGGNLVSKKTVKNGVAAALAFKSWRVIFE....................................................................................................................................................................................................................................................... 349
40 0.000e+00UniRef50_A0A1G3KX86 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWB1_27_13 TaxID=1802173 RepID=A0A1G3KX86_9SPIR  ali  29  1MQYGIIALTKGGVNLAKKIKSFFLQSDIFTLPKLNQGDFEENFADFVGEIFTKYKTLIFIMATGIVVRSVAKYIRNKTVDPAIVVIDEAGQFVISLLSGHIGGANDVAKDIAQKIGATPVITTASDVQKKISVDMLAKKYNLIISSMD--DAKKITSLIVNNEPVFVESEIKLDIPDYLKI---------------DKSLAKGLICVTNKDQIYEEKPFVKLIPQNIILGIGCKKDV-SYEKMIKFVENELKILNIDKKSIKYIATIDIKKEEKAILELAKYLDVQFFMKEDIEEIEANFSSEFVKKNVGVSNVCETTAFLASAKGKFLLNKKASDGITLAITQMNM............................................................................................................................................................................................................................................................ 336
41 0.000e+00UniRef50_I5AQX9 Cobalamin biosynthesis protein CbiG n=3 Tax=Clostridiales TaxID=186802 RepID=I5AQX9_EUBCE  ali  28  1MKLAGICFTTEGKKIARRILDDFYNSDWYGKGKYLEGAEDEPVQEWAGARFQECDVMIFIGAAGIAVRSIAPFVRDKRTDPAVLVIDEKGKFCISLLSGHIGGANTLVTELSERMGSTPVITTATDVSHRFAVDVYATENNMIISN--MTYAKEVSAALLAGEPVGFYTHFPVEGD------LPEGVFWSDKLEEARLARAELGIYISPSYNRAYFDHTLWLIPKCLVLGIGCKKGT-SAAVIEKLVADTLREYSLYPEAIAAVASVDLKKDEPGLLRFCDTHFLPFYTADELAKAEGDYTSGFVQQILGVDNVCERAAVLAGGNNLVIRKT........................................................................................................................................................................................................................................................................... 348
42 0.000e+00UniRef50_A0A2T6C8D4 Uroporphyrinogen III methyltransferase/synthase n=1 Tax=Melghirimyces profundicolus TaxID=1242148 RepID=A0A2T6C8D4_9BACL  ali  29  9...................................................................................................................................................................................................................................................................................................................................................................IVGAGPGDPGLLTVRGQKMLREADVVLY-DRLVNPRLLTEASPHCRKIDVGKRPQEQIHQMLLEHSKTGATVVRLKGGDPFVFGRGGEEAAFLKKEGIPFEVIPGISSSTAVPAYAGIPVTHRDAGSSYTVVTGHEHPDKKQSVCWEHLAKGAETLVILMGVKHLPTIRDALLKHRSPDTPVALVRWGTRADQQTLTGTLANIVQKVRETGFRAPAVIVVGQVVLKRGELAWFED---KPLFGQ 256
43 0.000e+00UniRef50_G5R6N1 Siroheme synthase (Fragment) n=9 Tax=Enterobacteriaceae TaxID=543 RepID=G5R6N1_SALSE  ali  23  36.............................................................................................................................................................................................................................................................................................................................................................HRGEVVLVGAGPGDAGLLTLKGLQQIQQADIVVY-DRLVSDDIMNLVRRDADRVGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCHAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTGGE--LDWENLAAEKQTLVFYMGLNQAATIQEKLIAGMQADMPVALVENGTSVKQRVVHGVLTQLGELAQ--QVESPALIIVGRVVGLRDKLNWFSNY........ 279
44 0.000e+00UniRef50_A0A2P6L3W7 SerS n=2 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6L3W7_NEPCL  ali  21  550...........................................................................................................................................................................................................................................................ASNGASPVLSRQLRTQIETIVPHGMGKLAE------FSGQWRKQVKEKISNPDERRIFWENLYASPLKEQVFNDNLELANQLIQQALTE------WSAPKGEVYLVGAGPGDPELLTLKALRLMQQADVVIY-DRLVSGPILDLCRRDAEKIYVHSVPQEGINALLVEYAQQGKRVCRLKGGDPFIFGRGGEEIQELVEANVTFQVVPGITAASGCSAYAGIPLTHRDYAQSVRFLTGHLKEGSPE-LPWSELVYENQTLVLYMGLVGLERICEQLIAGQRPTMPVALISKGTTPEQKVVVGTLADIATKVSEHHIVAPTLTIIGEVVSLREQ............... 875
45 0.000e+00UniRef50_D3FZ63 Methyltransferase/uroporphyrinogen-III synthase n=21 Tax=Bacillaceae TaxID=186817 RepID=D3FZ63_BACPE  ali  26  1...........................................................................................................................................................................................................................................................................................................................................................MNNGGYVYLVGAGPGDLQLMTLKARRCVEMADVILY-DRLVNPLLLEWTKPDCEHIYCGKLPQEAINEKLVQYGSEGKIVVRLKGGDPSVFGRVGEEAHALDEAGVQYEIVPGITAGIGAATYAGIPVTHRDHSASFTVVTGHDKSEKEPLIDWQALARGSDTIAFYMGVKNLGYIANQLLHGKPKETPVILIQWGTLGSQKTVSGTLETIAEEVSKSNLTNPAITLVGDVANIRKEPSWF---ERKPLFGQ 256
46 0.000e+00UniRef50_A0A1W1VW47 Cobalt-precorrin 5A acetaldehyde-lyase n=1 Tax=Thermanaeromonas toyohensis ToBE TaxID=698762 RepID=A0A1W1VW47_9THEO  ali  29  1MKLAIITLTKQGLKTARRIAFLYKGAHIYTPLALLEEPFKRPLKYSCGQLWKSYQGLIFIMATGIVVRCLAPYLQDKKKDPAVVVLDEKGEYIISLLSGHLGGANRLAREIAHFLGGKAVITTSSDIQGLPALDVVAQELGFKVIPGER--FTQVMGALVNGKKVGVWAEEPW--QERLEREL-KGLKVEPWFKYRGPEGWEAGILVTSRRCKLPPGPWVFWRPQELVAGVGCRKGID-YKSILKALGVAFKTAGRSLLSLKALATWEFKAKEEGLVIVAQRLNVPLFSKEELLKVWEETPSSLAQERLGLSGVCEPAALLGSRKGELICKKIALNGVTVA.................................................................................................................................................................................................................................................................. 359
47 0.000e+00UniRef50_A1HPX3 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=2 Tax=Sporomusaceae TaxID=1843490 RepID=A1HPX3_9FIRM  ali  32  1MKLAIISVTNKGAFLAERLANALGRVDVYAKAPQGIPQVYDCLRDLVDKVFHQYDGLIFIMATGIVVRVLAPHIHDKRFDPAVVVVDEAGEHAISLLSGHIGGANDLARLVANAIGARPVITTATDVSNLPAADILAVKLDLTIEPFDQ--LKHINAAIVNGKQVAFFIDQTLANASYIHLAAEMGVVLRNMGELVYTDKYDAAVVITDKELYMV-KPHVYLRPATLAVGIGCRRGTTSAE-ILTALGDACRKIGRSMKSIAVIASSVVKQDEVGLLAAVQQLEVPFFTNEQLQQCIDKHTSRFVEEKIGVGNVCEPAALCGGQTQTLLLPKTVYPNVTVAIAEVKYRWW......................................................................................................................................................................................................................................................... 356
48 0.000e+00UniRef50_F8B4E8 Precorrin-3B C17-methyltransferase n=79 Tax=Actinobacteria TaxID=201174 RepID=F8B4E8_FRADG  ali  25  33.................................PDSRHYDGTAREALTAAVTECAGVVCFLATGATVRLLAGLLTGKDSDPGVVCVDEARRWAVALVGGHSGGANDLAERVAATLGATAVVTTASDAAAVPALDSFGADIGLRVEPGSR--LATVGTALLAEEPVTLYTDAVWPLPPLPGTVRPADLTDLTGRTGPADHPVPAGIVITDRVVAPPAPAV-VYRPPSLVVGVGASRGV-PADEIIGLVERALADAGLSPLAVRHLATVEAKRDEAGIVAAARAFGWPLHPAAALAAVDVPHPSEVVRAAVGTPSVAEAASLLGPDGGGTSTGTVPKQVSAHATVAVARHRPRGRLAIVGLGPGDRDLLTPRAARELARASVIVGLDQYL-DSVRDLIRPGARVLASGLGAEEARAGAAVDAARAGHAVALIGSGDAGVYAMGSPALER-ADGSFDVVGVPGVTAALSAAALLGAPLGH----DHMMISLSDLHTPWDVIEQVRAAARADVVVAFYNPRSQLPRALTLLAAHRPLSTPVGIVTDAFRPAQQVTVATIGELTATPAPELVGMTTTVVVGST..................... 616
49 0.000e+00UniRef50_A0A1X6WPH1 Uroporphyrinogen-III methyltransferase / Uroporphyrinogen-III synthase n=1 Tax=Vagococcus fluvialis bH819 TaxID=1255619 RepID=A0A  ali  26  1.............................................................................................................................................................................................................................................................................................................................................................MRGQITLIGAGPGEPELLTVKAVRKLQEADAVFY-DRLINQDLLNYCSNECEMIDVHKVPQSEIENLIIEKAKEGKRVVRLKSGDPYVFGRGGEEGRKIKENDLEFEVIPGITSAIGGLAYAGIPITHRDFASSFHVITGHLKTE-DNQLDWENLAKTEGTLVFLMGMSELETITSQLMKHKSVETPVAIVRWATRKEQKTVTGTLETICDIAEKAKMTSPSLIVMGDVVTQREHLN-FY--ENRPLFGK 252
50 0.000e+00UniRef50_UPI00063F3D83 uroporphyrinogen-III C-methyltransferase n=2 Tax=Aneurinibacillus TaxID=55079 RepID=UPI00063F3D83  ali  28  6.................................................................................................................................................................................................................................................................................................................................................................VHLVGAGPGDPKLITVRGLEALKKADVVIH-DRLANPKLLEHAKERAQFIYNHALSQDEINAAILKHALEGKRVVRLKGGDPYVFGRGGEEAEACVEAGVPFEIIPGITSGIAAPAYAGIPVTHRNFSSSFAVVTGHACEGNEIHVDWARISTAVETIVFYMGVRNLPLITKKLLEGRDKNTPVALVRWGTCAVQQTLVGTLDTIVEKVREAKFTSPAIIIVGETVRLHEKLSW---YENKPLFGK 255
51 0.000e+00UniRef50_UPI0009753D31 hypothetical protein n=1 Tax=Negativibacillus massiliensis TaxID=1871035 RepID=UPI0009753D31  ali  27  1MKAALICFTQNGAKLAEQLIGQLNEEYGFVSSRTKLDQKEGSLSDWTGEWFSKVQCLVFVGACGIAVRAIAPFVRDKFADPAVIVIDEQGKFCISLLSGHIGGANEWTARFAEVLGAEPVITTATDLNHKFAVDVFAKKNNLLIT--DRALAKEVSAAVVRGETIDFYSHEMPKGKIPPE--LCWYQDTKEACGVSSGPSTGISIHVGA-LEKQPNPKELWLIPKNLVLGIGCRKGT-PMEQIERFVLEKMEEYHLDFRRVRAVASIDLKKEEKGLIDFCRKYDLAFYSKEELLLAKGNFPSDFVKGVTGVDNVCERSAVVFAQEDD................................................................................................................................................................................................................................................................................ 333
52 0.000e+00UniRef50_A0A1F9V913 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_12_FULL_39_28 TaxID=1797951 RepID=A0A1F9V913_9BACT  ali  30  6.KIAVIAITKHGALLAEKLHLKLEKSELFISAKFKKEFFETPIKELTGKIFNSFDALIYIVSLGAVVRTIATYLKDKHTDPAIIVIDDKANFAISVLSGHVGGANELTEELSIILGATPVITTASDVGKTIPVDILGREFGWTTELDE--NITKVSACVVNEEAVGIYQDAGEKNWWKRENPIPKNFKFYSSLDECAASDSKAALLITDRIIPEKYQDLLIYRPKSLAVGMGCDRGTL-QEELDELLNKTFEFHGLSVKSVKNISTVDLKNREAGLLAFCERHNWECYTREELAELKNPNPSEMVMKYLKIPGVSEPAAMLTAKTDTLVVEKTKGKMSTLAVARIH............................................................................................................................................................................................................................................................. 362
53 0.000e+00UniRef50_U4K894 Putative Cobalamin biosynthesis protein CbiG n=8 Tax=Vibrio TaxID=662 RepID=U4K894_9VIBR  ali  28  1MKIAIYAITLHGARQARRLAQTFPFADVFVAPVGKEEYPDAPLSGFFTEKFADYDHHICFFAAGIVSRMIGPLLRDKRTDPGVICIDDHGQFVIPMLSGHRGGANAIALQISQALSATPVITTASDVAGSLSVDMLGAPFGWTLDPECEPAITATSAAVVNEKRVLIVQHAGEKNWWQHKRSMPRHIMTYPDLSHADPAEWDGLVLISDEETPKWQSKTVLWRPKSLVLGIGCDRNT-PLKVLQAGIHQFLKEHNLSKYSISALASIALKADEQGILALSEQEQIPFYSTSELDGVEGENPSDYVKKITGVSSVAEASALKHSARTQLLVPKWKFKQDGFNMTLACCRITYE....................................................................................................................................................................................................................................................... 368
54 0.000e+00UniRef50_D3E2H9 Cobalamin biosynthesis protein CbiG n=3 Tax=Methanobrevibacter TaxID=2172 RepID=D3E2H9_METRM  ali  30  1MKISIIGFTDNGMEIAYKLSNSLSEDNNISFTRCGK----GELSIWTEEHFSDSDALIFIGAIGIALRAIAPYIKTKTKDPAVVVVDELGQFSIPILSGHIGGANELALQIADILNAIPVITTATDINNLFAIDTWAKSQGLKILNPE--CIKLVSSKLLKGETIHIKSDYPIQGNLPKK----------VQINDLEDSNSDYDVIISHNDYSMENKDILLLIPSIITIGIGCRKDI-SFDNIERSVLNILDKENYHILSLNAIASIDKKANEKGILEFARKYNLPFYSAEELNSLEGDFTSEFVKSVVEVDNVCERSAVIESNGNLIRRKDTC......................................................................................................................................................................................................................................................................... 321
55 0.000e+00UniRef50_A0A0J7KIJ1 Uroporphyrinogen-III methyltransferase n=1 Tax=Chitinispirillum alkaliphilum TaxID=1008392 RepID=A0A0J7KIJ1_9BACT  ali  26  1..........................................................................................................................................................................................................................................................................................................................................................MDKKKGKVYLLGAGPGDPSLITVKAAQVLRVADVVVY-DYLASPRLLEMVDRKAEKIYVHTVTQQKINSILIEKAKQGALVARLKGGDPFVFGRGGEECVALFEAGMDFEIVPGVTAGIASAAYAGIPVTHREKASSVAFITGHEDPNKESSIDYNYLARGVDTLVFYMGVGNLKSIVQKLIAHRSADTPAAVVMWGTMPYQKVVTSTLSSIEKCVEEAALKPPAVIIIGNVVELRNKLCWF---ERKPLFGK 257
56 0.000e+00UniRef50_O87697 Cobalt-precorrin-5A hydrolase n=466 Tax=Terrabacteria group TaxID=1783272 RepID=CBIG_BACME  ali  30  19...AVVAITKHGVEIARNLGRIFQQSDVYYMSKFEKQMFSGSVRMLLPSLFESYKGLIIIISLGAVVRMIAPILKDKKTDPAVVVIDDKGENVISVLSGHIGGANELTREVAAALRAHPVITTASDVQKTIPVDLFGKRFGWVWESAE--NVTPVSASVVNEEEIAVVQESGEKSWWHYEHPVPANIKTYSSIQTALEASPHAALVVTHRDLKKEEEAILLYRPKVLAIGMGCNRGT-SAAEIETVIEKTLAELQFSMKSVKALCTIELKKDEEGLLEVASKYGWEFYSPQELNSISIQQPSDTVFKYTGAYGVSEPAAMLYSGADTLELVK........................................................................................................................................................................................................................................................................... 358
57 0.000e+00UniRef50_A0A2A2I0G7 Uroporphyrinogen-III C-methyltransferase n=9 Tax=cellular organisms TaxID=131567 RepID=A0A2A2I0G7_9ALTE  ali  25  8..............................................................................................................................................................................................................................................................................................................................................................QGQVFLVGAGPGDPDLLTLKADRLIRKADVVLY-DRLVSDAIMARINPKARLIHVHTLPQDEINERLIGLARQGLCVVRLKGGDPFIFGRGGEEIEWLSRAGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKNDSC-DLPWDDFVQSHQTLVFYMGLVGLPVIVRELVAHMRPDMPVALVSKGTLPDQQAVTGTLETIVETVNDRGVRAPTVIIIGDVVRLRDQLDWV........... 250
58 0.000e+00UniRef50_L0H151 Siroheme synthase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=L0H151_9GAMM  ali  20  159.................................................................................................................................................................................................................................................................................................AGYRSRVKERFTDQRERRRFWDRVLQGGVAERVFSGHLDEARAAMERELAEGPAGS----TLGEVYLVGAGPGDADLLTFRALRLMQQADVVVY-DRLVAASILDKVRRDARRIYVHVMRQAEINRLLVELAREGHRVLRLKGGDPFIFGRGGEEIDTLAEEGIPFQVIPGITAASGCASYTGIPLTHRDYAQSVTFVTGHLK-DNTINLNWEQLAQPHQTIVFYMGLVGLPVIVEQLIAHVSPQMPVALIQQGTTHKQRVYSGTLLDIVEKVRRDPPQPPTLVIVGEVVRLRERFNWFQVP........ 461
59 0.000e+00UniRef50_A0A1M5BVI4 Cobalt-precorrin 5A acetaldehyde-lyase n=6 Tax=Peptococcaceae TaxID=186807 RepID=A0A1M5BVI4_9FIRM  ali  26  1MNIAIFAITKNGTELAAKVSRHLHQVRLFRPGRFEGEPFNGPVSRIVAEEFYRCQGLIFIMALGIVVRLLAPLIKDKRSDPAVVVMDEKGQFVISTLSGHLGGANELAQDLAGAFQAIPVITTATDVNGLPSVDVLARKYTLVMEPFN--AVKQVNAALVNGEMVAFCSEFPLPFPPM------QGFKLIPWDKLPITRPPGWLVVITNREISLPHEKTLFLRPRNLIAGIGCRKEIDP-EKIKEALLHALKLARRSPTSLRLLATIDLRVQERGLQQVAREMGIPLFSREQIQRVKNLQHSSFVQKRIGVGGVCEP.......................................................................................................................................................................................................................................................................................... 320
60 0.000e+00UniRef50_A0A0J8GYJ8 Siroheme synthase n=2 Tax=Alteromonadaceae TaxID=72275 RepID=A0A0J8GYJ8_9ALTE  ali  15  18....................................................................................................VGGGEVAFRKITALLKAKAELT-------VISPELSPELQNLLAQKKFTYIAQAYSEALIKDMRLVVAATDNETLNESIYHYCEANKILINAVDQPSACRYT-----TPSIVDRSP----------VVIAISSA-GASPARRIRAMIETSL------PKSLGEIAS---------------------FAGSIRSKVKAKFNTIDLRRDFWERFFT-------SSIMTRFDSMSSQDKSELVERLLNKENTGGEVWIVGAGPGDEELLTIKALQKMQYADVIVH-DRLVSQNILNLARKDAEFICVHLKKQDEINDLLVELALEGKKVCRLKGGDPFIFGRGGEEIETLVAADVPFEVVPAVTSASGCSSYAGIPLTHRDYARKVVFITGQSKAGVEP--DWEALVRPYQTLVFYMGLTRADLIKQNLVRGMAENMPVAIVEKGTTPQQKVYIGDLAALPEMREKYQIGSPALLIIGEVVNLHNKLAWF-TPEK...... 459
61 0.000e+00UniRef50_B8I0Q4 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=6 Tax=Clostridiales TaxID=186802 RepID=B8I0Q4_CLOCE  ali  26  1MRITLAAFTKQGGRLCLNLKQKLNNAEGYCKYHLDGEVLKDDLEEFTKNAFGASDAIVFIGAAGIAVRAIAPFVTSKDCDPAVLVIDERGKYVIPILSGHIGGANELASIIAKVLNAQAVITTATDINGRFAADSWAVNAGCHIMNINM--IKKVSAAILNGEKVGLHSDFPIEG------SLPDNVIISDSE--------KVGICISDS-SKPIFSETLQLMPKQYVLGIGCRRNTKYSE-LLNFVNFILDINGISPYAIEAIASIDLKSNENAICSLSTDWKIPFYSANELAELPGDFSSGFVKEITGVDNVCERAAVK-ANSGRLVVPKCSWDGITAALSKRDWRCRF........................................................................................................................................................................................................................................................ 340
62 0.000e+00UniRef50_A0A1T4KIM8 Cobalt-precorrin 5A acetaldehyde-lyase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1T4KIM8_9FIRM  ali  27  1MKLAILTLTKGGYKTAQRVKKYMDPVKIYTK-----DSFSGTLKNLVGELFQRYEYLLFIMATGIVVRVISPYLKDKTTDPGVMVMDEKGRFVISLLSGHLGGANAYTQKIAKSIGATPVITTASDVLDLISVDLLAKQLHCEIESL--QKAKEVTADIVNKKRVGILSDISVDIPEKENIQI---------IKSKEIQDCDSVIYITHKIISDPFPRSVQLIPQNILVGIGCKRGTESKKMIQQ-LYEVFQDLEIHIKSLKKISSIDLKQDEKGILELGEYFKIPFIERRKIKRIENLFSSEFVKKSIGIGAVAEPCGYLISHGGKCLMKKRKKSGITLSIW................................................................................................................................................................................................................................................................ 330
63 0.000e+00UniRef50_A0A0A7LBU4 Cobalamin biosynthesis protein CbiG n=1 Tax=Candidatus Methanoplasma termitum TaxID=1577791 RepID=A0A0A7LBU4_9EURY  ali  27  1MKIRMIAFSRRGCVLAQKICETLDGCEIYSKTSSDAEKVDGPATAWTEESFKVSDAIIFIGATAIAVRYIAPFLKSKTSDPAVISVDEMGKFVIPLLSGHIGGANDLAEKISEGIGAVPIITTATDIHGRFSVDSFAVKNNLHIGS--MSAAKDISSQIVDDKKVGLVSDVPILNGVPPELDL--------------NGNEDTGIFISYCASKGPFKRTLKLTPRCHVLGIGCRRGV-PADRIEVLVDETLKKENISIKSVRAVASIDLKNDEPGLKEFTDKIKAEFFSSDELGSLPGFTASERVKTVTGVDNVCERAAYAASKNGAMVVKKTSKDGVTLAVIREPVC........................................................................................................................................................................................................................................................... 340
64 0.000e+00UniRef50_A0A1I6QLI8 Uroporphyrinogen III methyltransferase / synthase n=2 Tax=Marininema halotolerans TaxID=1155944 RepID=A0A1I6QLI8_9BACL  ali  29  1............................................................................................................................................................................................................................................................................................................................................................MEKGVVYLVGAGPGDPGLITVHGRQRLMEADVVLY-DRLADARLLEFVPEHCELIDVGKRPQSEINRALVQQAEAGKCVVRLKGGDPFVFGRGGEEAAFLREAGIMFEIVPGISSALAVPAYAGIPVTHREYNASFAVVAGHEDPDKDEAVRWEHLAKGPETLVILMGVKNLSIICERLLQGRSPSTPIALIRWGTRSNQATLTGTLADIVERVEEAAFRSPAVIVVGEVVKERKRLAWIEN---KPLFGQ 255
65 0.000e+00UniRef50_R6M979 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=2 Tax=Firmicutes TaxID=1239 RepID=R6M979_9FIRM  ali  26  1MKIASIAFTENGAKIVKMLVREIGKGYVFEKYKTDGLETFNNVSSLVRDIFKKYNAIVFVGACGIAVRSIAPYVKDKAKDPAVVVVDEKGNFAIPILSGHIGGANDLAEKIAALTSGVAVITTATDINKKFSVDTFAVRNNLHI--GDTKLIKEISSRILNDKKVGLYTDYEL-----------------KNVPDCFEESNEVGICISDDD-KKPFRTTLNLMPKNVVLGIGCRKGC---ETVEESILAFLKVNGVSVYSLFAVATVDIKKNEKGIVEFCEKFDIPLFSAETLAAVEGEFTSEFVKKTVGVDNVCERAVCAVGAK.................................................................................................................................................................................................................................................................................. 306
66 0.000e+00UniRef50_A0A0S2JX67 Siroheme synthase n=2 Tax=Pseudoalteromonas phenolica TaxID=161398 RepID=A0A0S2JX67_9GAMM  ali  22  161..................................................................................................................................................................................................................................................................................................SFRDKVKARFKHFADRRQFWESVFDSSVVSKVQVGDTEAATEQLHEMLDAKAEPE------GEVYVIGAGPGDPELLTLKALQLMQQADVVVY-DYLVSDEIMDLVRRDADLICVHSVKQEDTNQMLVDLAKQGKKVCRIKGGDPFIYGRGGEEVQVLKAHDVRYQIVPGITAAAGCSAYAGIPLTHRDHAQAIQFVTGHCKKDGQE-LDWQGLAKPNQTLAIYMGVIKSPHIQAKLLEHRSANTPVAIVENGTRKNQRVVRTELGQLAEQIEAHEIVSPALLIIGEVAALHEELAWF........... 457
67 0.000e+00UniRef50_UPI000835640C hypothetical protein n=1 Tax=Clostridium sp. Marseille-P299 TaxID=1805477 RepID=UPI000835640C  ali  27  15MKLHIISFTRAGSALNQKLCEALSNRDISCKGYTMERYAEDSLRKWTENSFEECDAIIYIGACGIAVRAIAPFVKDKFTDPAVISMDELGGYIIPLLSGHVGGANELAMEIANITGGVAVISTATDVNGAFAVDVFAKKNELKLTNKE--LAKLISADILDGKHVTFETELPVDGEFPVGIDEFIGTAFVKRTENTDELRSAYKIHVTSKSSMDEEHSTLQLIPQVICLGIGCRKNTRK-EDLELFVDKELEKHNISKEAIAYIASIDLKKEEEALCFLAAKYNSKFYSSEELKQVKGDFESDFVHQTTGVGNVCERATLLVSNYGSMIQKKIARDGMTLAITKINRRIFFE....................................................................................................................................................................................................................................................... 402
68 0.000e+00UniRef50_A0A097ANZ4 Porphyrin biosynthesis protein HemD n=37 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A097ANZ4_THEKI  ali  22  1.............................................................................................................................................................................................................................................................................................................................................................MSGIVYLIGAGPGDIGLLTLKAVELIKNADVLVY-DRLINEDILKMAKKDAELIDVHKVPQSKINEIIAQKALCGKKVARIKGGDPFVFGRGGEEAEYLSRKGIPYEVVPGITSAIAVLSYAGIPVTHRELSSSFHIITGHEWEGKDKNLDWEVISKLDGTLVFLMGIKNIEKIVKKLLYGKDPNTPTAVVMEGTTPNQKAVTGKLIDIPRLVLKEGIKNPAVIAVGDVVALRDRLKW---YENKKLFGK 253
69 0.000e+00UniRef50_A0A0J8D6Y7 Cobalt-precorrin-5A hydrolase CbiG n=2 Tax=Clostridium TaxID=1485 RepID=A0A0J8D6Y7_CLOCY  ali  27  1MKIAVVSFTRNGAKLTKSISLKLADVEGYTLEKFSKEYISSGLKAWTEDMFASRNAIVFVGACGIAVRSIAPFIKDKTKDPAVIVVDELGRHVISLLSGHIGGANSLATTIATITGGEAIISTATDINNRFSVDTFAKANDLYI--SDMAIAKEVSSRVLENEKIGLLCDFSIDSNIHSDLKL--------------TTSSDIGIAITLDDMKKPYKRTLSLIPRIVSLGIGCRRNT-PLENIEELVLKTLKENNISLKGVRNVSSINIKADEKGLVDFCTKYNLNFFTPDELNEAKGDFTSGFVKSITGVDNVCERAAVLGSDNGSLIIRKTCRNSVTLAVAVKKW............................................................................................................................................................................................................................................................ 340
70 0.000e+00UniRef50_A0A2D7AHI7 Precorrin-3B C(17)-methyltransferase n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7AHI7_9PROT  ali  21  55..................LRDALGGGDVLAG---------AGFSDALRTAFAAGRPTVGLCAAGILIRLLADQLHDKHSEPPVVMATEAGDFV-PLLGGHH-GANRLAQDLGEAGTGFALISTASDAALGAAVEDPAPGYALV----NPEHATAFLRRLAAGEAIRVVGDWPLRSDGPTRQSPDATLSIGTEGECSE--------------------RHLRYCRRDLVIGLGCERGAEPHAL-AAAVTVALDQAGVDHLALAGIASVDLKQDEPAFTQLAERLGLPFFSAEALAGVSVPNPSAVVAAEIGTPSVAEAAALLGACNGQSGVTEQPTHAGTPITDFDAVGQPRGRLQLIGLGPGRADWRLGGTAAALRSAEHLVGYRYYI-DQVSPL--PHQQVHTFDLGEEERRCQFALDLAATGKSVALICSGDAGVYAMGALTFELAAQSDQAVEIIPGISAMFGAAARLGAPLGH----DFCAVSLSDLMTPWSVIERLKGAASADFVVCFYNPVSRLGAARDILLDHRPPETPVVICRQIGRAEESYTHRTLGTL----DPAEIDMFCMVLVGSSQTRRNGPTHLYTPRGY..... 644
71 0.000e+00UniRef50_UPI0005B4F9CC hypothetical protein n=1 Tax=Lachnospiraceae bacterium TWA4 TaxID=1392836 RepID=UPI0005B4F9CC  ali  30  1MKISIISFTAHGGAINQKLSNYFH-CEGYSIPRYADDYKTESLSEWTKTAFKTSDAIIFIGATGIAVRAIAPFVKDKKSDPAILVIDEMGNYVISLLSGHLGGANELALEVSKLIEATPVITTATDVNHTLAIDVFAKKNGLFIDS--MHEAKVVASTILDKKPLGFVSDYPVIGAIDSVFKV--------------EGKKEVGVVISCEANRTDFDETLQLIPPIIHLGIGCKKDT-PFELIERKVLALLKEKNLSIHSIADMTSIDLKKDEKGLLGFSEKYKIPFYSGEELMKTTGTFSSSFVKSITGVDTVCERSAVYAGQKD................................................................................................................................................................................................................................................................................. 315
72 0.000e+00UniRef50_A0A2E2XHD2 Siroheme synthase n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E2XHD2_9GAMM  ali  19  159...............................................................................................................................................................................................................................................................................................WAESWRTKVKAAIDRPVVRQRFWDRLLSGIAAEHVLADRATAADSIISDRLAQAEAG----QHHGEVFLVGAGPGDPELLTLKALRLIQQADVVLY-DRLVSEPILSLLPVSCERIYVHALPQDDINQTLVDLAKQGRNVLRLKGGDPFIFGRGGEEIELLAENNVAFQVVPGITAASGCASYSGIPLTHRDYSQSVRFVTGHLRSN-EVNLPWPELAQEGQTLVFYMGLTGLSAICQSLIDGREQETPAAVIERGTTPEQRVIVGNLESLPGLIESQQVKAPTLLIIGEVVALHGTLSW............ 459
73 0.000e+00UniRef50_A0A151AKJ9 Uroporphyrinogen-III C-methyltransferase n=13 Tax=Bacteria TaxID=2 RepID=A0A151AKJ9_9CLOT  ali  25  1.............................................................................................................................................................................................................................................................................................................................................................MKGKVYLVGAGPGDYKLITLKGMDCIKIADVIVY-DRLVNRTLLKNARKDCEFIYVHTKTQDEINDIIAHKAKEGKIVTRLKGGDPYVFGRGGEEGEYLREREIDFEVVPGITSAIGGLCYAGIPITHRDYASSFHVITGHLKDEDKE-LDWESLAKLNGTLVFLMGIANLNKIATSLIEGKDKTTPTALINWATTQNQKVVEGTLENIHEIALKEKIESPTLIVVGEVVKLRKHLNFFES---KPLFGK 252
74 0.000e+00UniRef50_A0A255IX08 Uncharacterized protein n=1 Tax=Lachnotalea glycerini TaxID=1763509 RepID=A0A255IX08_9FIRM  ali  28  1MNLAIISFTKAGSILNAKIAKLLNKEHHYYKGRCEEQEVEVPLKDWCKEVFHTMDGIIFIGACAIAVRTIAPFVQDKMNDPLVLVLDEKASFVISLLSGHLGGGNELTQALSEQIGAIPVITTATDVNHKFAVDELARKEKLTI--SDRKLAKEVSATILDGERIGFVSR------LLIQGELPMELEHINEEDDI---KHELGICITCDEYDTPFINTLILMPRVITIGVGCRKNTD-TEQFESFILRILKENHISIRAVKNIASIDLKENEPCIRAFANKYEVDFFSAKQLEQAEGEFESEFVKLTTGVGNVCERSAMLACRQPTLLLRKKAFEGMTIA.................................................................................................................................................................................................................................................................. 339
75 0.000e+00UniRef50_Q9AQ45 Uroporphyrinogen III synthase/methyltransferase n=353 Tax=root TaxID=1 RepID=Q9AQ45_SELRU  ali  23  1..........................................................................................................................................................................................................................................................................................................................................................MTYMAGMVYLVGAGPGDYRLISMKAVDCLKMADVVVY-DRLADDRILRWAPEDAEFIYVHTMKQEDINQLLVDKAKEGKCVVRLKGGDPFVFGRGGEEGLLLRENNLPFEIVPGITSAISVPAYAGIPVTHRAVATSFAVVTGHEDTKGKSNMRWEHLATGVDTLVFLMGVANLPHITGKLIEGRSADTPAAVIRWGTKPEQRTLITTVGKAAEDVAKNGIKPPAIFIVGEVVKLRDSLQWFDNLSQRPLFGK 260
76 0.000e+00UniRef50_UPI000B999779 cobalt-precorrin 5A hydrolase n=1 Tax=Clostridiales bacterium SK-Y3 TaxID=1792311 RepID=UPI000B999779  ali  29  1MRTAVIALTLGGSKLAAKLAET-TGAHLYLPEKFCSDPIKSKLLELMETIFYQYDALVFIMAAGIVVRTIAPFIKDKRTDPAVVVMDEKGTNVISLLSGHLGGANQLTLEIARITGANPVITTASDVNNTLAVDLFAQRLGCGIEND--QFLTAVTAAIVNGKKVAFYSEYD------NFFDLPDNVISVDSITGID-STYGGAIFLTHYIFEDYSIPSVYLRPKSIILGIGCRRGITK-QKIAEAVKECLEDLHISKKCIQHIATVDVKQDEQGLVRFAQELQVPLIARKDIQKIEHQFESQFVKDTIGVGCAAEPAAILSGKNARLIGSKYKKDGVTVA.................................................................................................................................................................................................................................................................. 338
77 0.000e+00UniRef50_A0A143Y1A6 Cobalamin biosynthesis protein CbiG n=1 Tax=Clostridiales bacterium CHKCI001 TaxID=1780378 RepID=A0A143Y1A6_9FIRM  ali  27  1MKRYIIAFTRAGIALGKSIQQKKSEIDGWYKYVEEDAIPFDHTKRLLEKIWKQAENILFIGAAGIAVRSIAPFLTDKVSDPAILVMDEKGKFVIPILSGHLGGANAYCERLAREIGAIPVITTATDCNQCFAVDLFAKKNKLWIV--DWHRIKEISSRILDKEPIGWISEYNIAGT------LPSELIQIEKKEGVQSSKIEAGVVIASKISPPYFQWECRLLPKNLVLGIGCKRG-KPLEEIELFLEQELKQHGFQKQQVNKIVSIDRKQQEKGLIELSGKWKIPFYSSEQLNAVEGAFSSDFVKQTVGTSNVCERAAYLGSGCGKKRIGKTVKDGMTMAVY................................................................................................................................................................................................................................................................ 346
78 0.000e+00UniRef50_Q1Q2H6 Strongly similar to uroporphyrinogen III synthase/methyltransferase n=39 Tax=root TaxID=1 RepID=Q1Q2H6_KUEST  ali  24  1............................................................................................................................................................................................................................................................................................................................................................MKRSIVYLVGAGPGDPGLITVKGHECIKKADVIVY-DYLVNVELLKAAKPDVEMIYVHTLEQEDINKLLVEKALEDKIVTRLKGGDPYIFGRGGEEALVLREYKIPFEVVPGITAAIATPNYAGIPVTHREYTSTFGLITGHEDPAKESSIDWSKISTGIGTLAFYMGVKNLPYITEQLMKHRSGDTPVAVIRWGTTFRQETVVGTLNTIVAKAK--NIKPPAITIVGEVVKLRDQLNWFEN---RPLFGK 253
79 0.000e+00UniRef50_S0FWY5 Cobalamin biosynthesis protein CbiG n=6 Tax=Clostridiales TaxID=186802 RepID=S0FWY5_9FIRM  ali  25  1MKIQLTSFTKAGGILCKRLRQELEAEGCCKYATDDLMLLTEDIRTHTKKAFENCNAVIFIGAAGIAVRAIAPYIRSKDSDPAVLVIDEKGRYVIPVLSGHMGGANSLAVRLADILSAQPVITTATDINRKFAVDSWAEEHGCFIANIE--NIKYISAAILRGETVGLYSDFPVDGSLPEYID--------------TSDNAHAGIYIS-REYKKKFSHTLHLIPKQYVIGIGCRKNTV-YENLLEVINSVLCSHGISACEVGAMASIDIKAGEKALIMLAKHLKIPFYSARELSEVQGSFSSDFVRETTGVDNVCERAAVKAGNGRLTACKYSRNGITVAIAQKEWRCSFEDNTGIFGS................................................................................................................................................................................................................................................ 349
80 0.000e+00UniRef50_A0A0S8IIU2 Uncharacterized protein n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8IIU2_9BACT  ali  29  8...............................................................................................................................................................................................................................................................................................................................................................KKVYLVGAGPGNTFLITVRAQNLLKQADVIIY-DYLANDILLELTSPAAEKIYKHTMEQDAINNLMLEKVRQGKQVVRLKGGDPFVFGRGGEEAEFLHDNGIPYEIVPGVTSATAALAYAGIPLTQRGLASTAAIITGHENPFKEDSINWSALAQLSGTLVFFMGVRRLPDIVNRLLQHKAKDTPAALIRLGTTPRQQTVTGTLENITERVKEAQIAPPALIVVGEVVKMRKKLKW---YEFLPLFGK 259
81 0.000e+00UniRef50_A0A0P0RCU2 Cobalamin biosynthesis protein CbiG n=424 Tax=Bacteria TaxID=2 RepID=A0A0P0RCU2_9BURK  ali  17  9...AIVILGVGAQDTARRVQSLYDGAQVHGLRVADADVAYTELNAHLRELYASGTPIIAVCAAGIVIRCVAPLLANKGAEPPVLAVAEDGSAVVPLLGG-LSGVNAMAREIAAALDVPPAITTSGELRFGACV--LNPPDGYTLASLDQG--KRFVSDLLAGEATRIEGDAPWLDGVQLPR----------------ADDAQRAIRVTPLAWHGA-TDELVIHPRSVVVAV-C--GTGSGDSLPQRIREAAQTHGLAAQALAVLLAPATLTGDSALRQAADELQVALRFTTDSNT---DNSANYGVPHSAARMLSQTLRVPHKALDAPADAPIAFAVAQAPLDPATVGRARGKLSVIGLGPGDASLMVPAARAALTQATDILGYETYVK--MAGPFRADQRVHGTDNREEMQRARHAFELASAGRHVAMVSSGDPGVFAMAAAVLEALDDARVELDIVPGVSAALATAAQAGAPLGH----DFCMLSLSDNLKPWSIIERLRHAAEADLVMAFYNPISRLDKALDIVRECRAPATTVVLGRDIGRPGATLKTTTLAEL----KSADVDMRTMVIIGSSTTRASGREWVYTPRWY..... 585
82 0.000e+00UniRef50_A0A2E5FCG4 Siroheme synthase n=38 Tax=Proteobacteria TaxID=1224 RepID=A0A2E5FCG4_9GAMM  ali  19  71.............................................................................................................................................................................LGFHLVISATDNDLTNAQVSKEAQSNNIPVNVVDQPTLCSFIFPAIVDRSP--ITIGI-SSGGVAPV--LARLVRAKLET--LLPHGLGKLASL---------------------AAEYRQTVKNHFTNAKQRRLFWETIFNGPIADLSYQGQQAEAEKGLLQALAQANDVA----PAGKVYLVGGGPGDPELLTLKALRVLQQADIIIY-DRLVSADVLNLARRDAERIYVHSVPQENINALLLRYAKDGQRVVRLKGGDPFMFGRGGEEIETLIDDKVAFEVIPGITAASGCASYSGIPLTHRDHAQSCTFVTGHLK-DNSVNLDWDQLAKPNQTLVIYMGLLGIRQISEKLIQNLPSNTPVALIQKGTTHEHKVIISDLMDIADKVEQLKPKPPTLIIIGTVVSLHNKLNW............ 457
83 0.000e+00UniRef50_A0A1G9UAB1 Uroporphyrinogen III methyltransferase / synthase n=1 Tax=Romboutsia lituseburensis DSM 797 TaxID=1121325 RepID=A0A1G9UAB1_9FIRM  ali  22  1.............................................................................................................................................................................................................................................................................................................................................................MKGKVYLVGAGPGDYKLLTLKGLECIKKADVIVY-DRLANINYLKEAKPNCEFIYVHALPQDDINRVIADKAKEGKIVTRLKGGDPYVFGRGGEEGEILFSEGIDFEVIPGITSAIGGLCYAGIPITHRDHASSFHVITGHLRDDDKENINWNALANTNGTLVFLMGVANLEKISANLIEGKSKDTPVALVSWATRYNQRVITSTLENVYETAVRENVKPPTLIAVGEVVGLRDKLNFFEN---KPLFGK 255
84 0.000e+00UniRef50_A0A1G7AQA4 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1G7AQA4_9PROT  ali  20  10...AIVVLGQGSLETARRIQAALPEVHGLAGRVEGADIAYDGFGETLRGLHRDGVPLVALCASGIVIRALAPLLQNKRVEPPVLAVAEDGSAVVPLLGG-LQGVNGLARRIADALGVAPAITTTGDVRFNVTLEAPPAGY----VARDPGASKAFMSDLLGGASVRLEGRAPWLAESRLPFT----------------PDGARCIRVTPDDRAPEDG-TLVFHPKTVVVGL-----AGGGEDLPDRXXXXXXXXXXXXXXXXXXXXXXGEAARKDVQRVADVLGVRFVP-------DATDPSALVAAAVPEADRDRPV---------WSDGAVAIAVARAPDLVRSVGRPRGHLAVVGLGPGGADLLAPAAREALRRADHWVGYEFYMAERLVGAPRPGQAVHPSDNREELDRTRHALSLAAAGARVAVISSGDPGIFAMAAAVMEALQDHGVAVAVVPGITAAQAAAARVGAPLGH----DFCVLSLSDNLKPFDVIERLEHAARADLAMALYNPVSQLGRALDRLRTVRAPDTPVVLARDVARPDEAVRVTTLG----AVRPEDADMRTVILVGSSATQTDGGAWVYSPRWY..... 573
85 0.000e+00UniRef50_A0A1T1CRY5 Precorrin-3B C(17)-methyltransferase n=2 Tax=Candidatus Synechococcus spongiarum TaxID=431041 RepID=A0A1T1CRY5_9SYNE  ali  23  56.........................................GLAHFLATRWPQLQLLVAAMASGALIRSLAPLLRNKHRDPAVLLLDGSGCHLIPLLGSHGRHGDQLAMAMAAYRGGQVWRSGYSSGSGQLAPDCFGSSLGWQRGLGNWDGLAK---AFAQRQNMALVQESGSTSWRATAAAARLQPAAGPLP------PGEPWLYVGHR---SATGATAHWHPPVLWLGLGCERHTR-QAVLEAVVEESLASAGLAAAAVAGVASLDRKGNEAGLLELCQHHQWPLFTAAQLAAIPVPNGSLIVARQVGTPSVAEAAALAAAGTSAQLERASGAATCAVALATNPWAPGRGALDLVGSGPGALDQLTPAARSALAAATTWVGYGPYLNR-LEPLRFPHQLRLDGVLGKEQERCATALALACQGQRVALVSSGDSGIYGLAGPALDLPEQERPDFAVHPGISALQMAAARLGGPLMH----DFCVISLSDKLTPWATIQRLQAAALGDFVVALYNPVRQLQEARRILLAERSGSTPVAICRQLARPEERITLTTLAAL----ESNMVDMLTLVLVGNRQTRRQD-SWLLTPRGY..... 606
86 0.000e+00UniRef50_C6JBG7 Uncharacterized protein n=13 Tax=Clostridiales TaxID=186802 RepID=C6JBG7_9FIRM  ali  27  1MKVALICFSLTGQQTGERLYRGLEAAGLTAKSKYLPDSIQISTSAWAGEKFSDSDALIFIGATGIAVRSIAPYVASKKSDPAVLVVDECGKFVISLLSGHLGGANELALKTAEILEAIPVVTTATDLHHRFAVDVFAKKNNCNI--FNMKAAKEVSAALLAGKKVGFYSEFPTDGELPEGLIRCDEYGNPVSSMDDRSENIDCGVAVTVHTSCNPFISTTQVVPKCLTLGMGCRKDKD-ARGIAEAAQKVLDRSGFHKEAFEQIASIDLKKEEKGILSLSQDWQIPFYTEEELKQVPGEFPSPFVKKITGVDNVCERSAVLASGNGRLLQRKTGENGVTTAVAAREWRIHFE....................................................................................................................................................................................................................................................... 373
87 0.000e+00UniRef50_A0A1V5D0B8 Uroporphyrinogen-III C-methyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V5D0B8_9DELT  ali  25  1..............................................................................................................................................................................................................................................................................................................................................................MGKVYLVGAGPGDLKLITLRGLELIQRADVIIY-DFLVNPRLLDFRREGAETIYVGKQPQPDINTLIVEKAGGNEVVVRLKGGDPFIFGRGGEEAEVLAENGIPFEIVPGITSAIAVPAYAGIPLTHREHASTVAFITGHEDEKKTASIRWEELAAGPDTLVFLMGVKNLKTIKERLVKGRSPDTGACLIQWGTLPKQKVVTGTLGDIDVLARKEGIKPPAIILIGDVVRLRDHLSWF---EHRPLFGK 253
88 0.000e+00UniRef50_A0A1X9M7P0 Uroporphyrinogen-III C-methyltransferase n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A1X9M7P0_9BACI  ali  27  1............................................................................................................................................................................................................................................................................................................................................................MKRGYVYLVGAGPGDIRLITVKGQQCLESADVVLY-DRLVNPLLLEKTKPGAELVYCGKLPQEAINDLLVQYALEGKTVVRLKGGDPSVYGRVGEEAEELEKHGIDYEIVPGITASIGASTYAGVPVTHRDHGASFAVVTGHDKSPDGQPLDWKSLAKAIDTIAFYMGVKNLPYICKQLIDGRDKDTPVLLIQWGTLGKQKTLKGTLGTIAQLVAEHKFSNPAVTIVGNVANLRKSESWF---ERQPLFSK 255
89 0.000e+00UniRef50_A9U865 Predicted protein (Fragment) n=9 Tax=root TaxID=1 RepID=A9U865_PHYPA  ali  26  1.............................................................................................................................................................................................................................................................................................................................................................MAGRVFLVGAGPGHAKLITVKGLECLQKADVVVY-DRLAGPQLLHSLKPGTEKIYVHTMKQEEINQLLVDLALQGKTVVRLKGGDPTIFGRVGEEAELLRRNGIPYEIVPGITAAIGVPAYAGIPVTHRDLASSLSIITGHESPDKDRMIEWDKVTNATGTLVFMMGVAKIGYIAEQLMRGRKPDTPVALIRWGTRAEQAVLAGTLADIAEKVKQADFQPPAVIVVGDVVRQREQLKW---AESQPLFGK 254
90 0.000e+00UniRef50_A0A1X7CRR7 Cobalt-precorrin 5A acetaldehyde-lyase n=5 Tax=Desulfovibrio TaxID=872 RepID=A0A1X7CRR7_9DELT  ali  29  5.KTAIYSLTAKGADLARKIAFA-TGSVSYVLERYAEDIPFTGFTSLISDTFSAYESHIFIMASGIVVRAIAPHLKSKDTDPAVVVLDQEGRFAISLVSGHLGGANELARMVAGQIGATAVITTATDCAGVPSIDMLARASGLVI--GDTGSIKHVNSALLDGDKVGVYDPEIFLN----IDGLSEFFYKVDNVADLDELRCGVCI---DWRIHDLPENVLKLYPKCLRLGVGCRRGV-PAEEINALVTDVLADHGIALQSIVSLGTIDAKNDEVGMLEFARQLKINFFSADELEEIKGTTPSGLVMKHMGVGSVCEAAAMKQSGGDNLIVPK........................................................................................................................................................................................................................................................................... 328
91 0.000e+00UniRef50_A0A167UJA0 Cobalamin synthesis G family protein n=63 Tax=Bacillales TaxID=1385 RepID=A0A167UJA0_9BACI  ali  31  3...AVVAITKHGVTIARQIGEQLPGARVYYASKFARGLFEGNVRLLLPSLFVTYRGLILIISLGAVVRMIAPLLKDKKTDPAVVVIDDKGEHVISVLSGHLGGANELTREVAQLLHAHPVITTASDVQKTIAVDLFGRSFGWVWESDD--KLTPVSAAVVNEQHVAIIQESGERNWWRYDAPLPSNIRVYASIADALAAKPDAALVVTHRLLAKNEEAILQYRPKVLVLGVGCNRGT-SAEEIEAVIMETLKELQFSWKSVKTICTIDLKKDEEGLLKIVQKYGWEFYSPAQLNQVEIEQPSETVFRYTGAYGVSEPAAKLYSGADTLALVK........................................................................................................................................................................................................................................................................... 342
92 0.000e+00UniRef50_Q1H3L5 Siroheme synthase n=50 Tax=root TaxID=1 RepID=CYSG_METFK  ali  20  165.......................................................................................................................................................................................................................................................................................................VKQRFSTGQQRRIFWEDVFQGVIGEQVLSGQEEAARHAMQQVLSGRGE-----LHHGEVYLVGGGPGDPDLLTFRALRLMQQADVCVY-DKLVSKEVMALVRRDAELIYVHTLPQEDINQLLVRLAKEGKRVLRLKGGDPFIFGRGGEEIETLMENGIPFQVVPGITAANGVSSYAGIPLTHRDYAQSCLFTTGHLKDG-SVNLDWDALVRPNQTVVIYMGLVGLPEICRQMVAHGAPELPIAIVQQGTTQRQRVVEGTLATLPGLVERAGLRAPCLIIVGQVVRLREKLAWF........... 457
93 0.000e+00UniRef50_UPI000D6A92A2 cobalamin biosynthesis protein CbiG n=1 Tax=Murimonas intestini TaxID=1337051 RepID=UPI000D6A92A2  ali  29  1MKLAVISFTEKGGRLAGQIARALSVCEAWGMKKYAAAPLEEGLREWAGRMFREADGILFIGAAGIAVRAIAPYVKDKREDPAVVVMDEKGMFVIPLLSGHLGGANELAGILSNLTGAVPVITTATDVNGRFAVDIFAKKNRLYIGS--MRLAKEISADVLDEKKIGFYSDFPAASDIPRELCPVGENEVFEGTN---------GICVTLDEKKCPFKQTLHLIPGIVTAGVGCRRGTG-ADVIEKKVLEVLEENGLSIHCLESLASIDLKTDEKGMIMFSEKYGIPFYTKEELEAVPGEFESEFVRSVTGVGNVCERSALLGSGMGKLVNKKKSGDGVTVALAVKEW............................................................................................................................................................................................................................................................ 347
94 0.000e+00UniRef50_G8LU07 Uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase n=6 Tax=Clostridiales TaxID=186802 RepID=G8LU07_CLOCD  ali  21  1............................................................................................................................................................................................................................................................................................................................................................MGQGFVALVGAGPGELGLLTLKAKECIEKADVVVY-DRLVSSEILDLIPSGAKKIDNHKITQENINQILLTEAQKGNFVVRLKGGDPFLFGRGAEELELLAESNIPFEVVPGVTSALSVPAYAGIPVTHRDFSSSVHIITGHRKKDEKLKINYKALSQLEGTLVFLMGVANLKEIMDGLIANMDSLTPVAVIENGTYPNQRTVVGTIENIYEKATRCNIKPPAVIVVGKVCNLSVKYDWF---RKRPLFGK 254
95 0.000e+00UniRef50_A0A2E1UUW7 Siroheme synthase n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E1UUW7_9GAMM  ali  23  161..................................................................................................................................................................................................................................................................................................EYRSKVKDHFSSIKERRNFWEAFLDGPLSEMVLSGHIDKAKK----ALDKSIKEEKIPDKNGEVYLVGAGPGDPELLSFKALRLMQKADVVIY-DRLVSEPIMNLIRQDAEKIYVHAMPQENINELLARLALEGKKVLRLKGGDPFIFGRGGEEIESLINDDIPFQIVPGITAASGCASYAGIPLTHRDHSQACIFVTGHLRDG-TVNLNWKMLAHEKQTLVFYMGMHGSKVICEELIKHLKEKTPAALIVKGTTSDQEVIIGDLLSMPKIIKENKIIPPTLLIIGDVVKLHNKLKWFDPFSFK..... 465
96 0.000e+00UniRef50_A0A268E797 Uroporphyrinogen-III C-methyltransferase n=2 Tax=Bacillus TaxID=55087 RepID=A0A268E797_9BACI  ali  27  1............................................................................................................................................................................................................................................................................................................................................................MGEGKVYLVGAGPGDSELITVKGMEALKRADVILY-DRLVNPKLLRFAPANCELIYCGKLPQEEINHVLVDKALEGLTVVRLKGGDPSIFGRVGEEAEALANAHISYEIVPGITSGIAAPLYAGIPVTHRDYAGSFAMVTAHDKKNGKPDIDWEGLARGVQTIAFYMGISNLEHICENLIKHKSADTPVIIIRWGTWSRQESVVGTLSTISEKVRSANIINPAITLVGDIVASREKLKWF---EKKPLFGK 255
97 0.000e+00UniRef50_A0A1Y1SFI6 Siroheme synthase n=59 Tax=cellular organisms TaxID=131567 RepID=A0A1Y1SFI6_9GAMM  ali  19  16.............................................................................................................................................LVVGGGEIAARKV---RLLHKGQARIRVVAPQLCAELAEQQRNGQVSWLQQPFDADAGQPTLVIAATDQPEVNRQVASVRGVPVNVV------DDAQSSTAIMPSIVDALSSGGTAPVLARRLRDQIEKSLPSGYGRLAA------LSGAIRERVMQTLPEPRSRLRFWERVFDGPVAQRAVSGDLDSARAMLDDSLRQAQDAD---MPQGEVFLVGVGPGDPDLLTLRAHRLMQLADVVLY-DRLIPEPIMDLVRRDAERIDVHTLPQEDINALLVRLARQGQRVLRLKGGDPFMFGRGGEEIEELMEAGVPFQVVPGITSALGCAAYAGIPLTHRDHAQSCVFVTGHPKADGTLDLDWPRLAHAQQTLVVYMGVGSLPALCAELIAGLAADWPAALIFNGTRPDQQVITGQLDNLPQRVEAAGITGPGLLIVGQVVRLRERCDWLQATR....... 465
98 0.000e+00UniRef50_A0A1I6P4K3 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=1 Tax=Saccharopolyspora flava TaxID=95161 RepID=A0A1I6P4K3_9  ali  24  2..IGLFAVTAAGRRAAAELAGRLG---------PEALVADGPIGPAVRRLWDHLDAAVFFLASGATIRLVAPLLQDKHTDPGIVSVDEAQRFAIALAGGHGGGANALAEQVAELFGCTPVITTATDSTGTTALDELVDQLDATVD----GDLPSCGVAILDGEPVRLVNPHGFPLPALPPNV------------AADVANPAWTVVIDDRRPTEDEERTLRLIPRTLVVGVGSARGV-SRTAVTETIARLDSEHGLDPRAIRAFASVDLKADEAGILDAVQDLGLLTYSADVLAGVEVPNPSEVVRSEVGTPSVAEASALHAAAYGAPVELVADKIKGDNVTVAAARISPRGRLAIVGIGPGAPDLRTPRADAELRRASVVVGLDQYL-DQVRHLLRPGTEERATGLGAEEARAAEAVELAKQGRAVALIGSGDAGVYAMASP---ALEKADVDIEVVPGVTAALSASSLLGAPLGH----DHALISLSDLHTPWEMIERVRAAAEGDMVVCFYNPRSQLGRALEILAEHRPATTPVGAVRQASRADEKVWCAPIAEF----DPAEVDMFTT........................... 555
99 0.000e+00UniRef50_UPI000B7ED0C3 uroporphyrinogen-III C-methyltransferase n=2 Tax=Clostridiales TaxID=186802 RepID=UPI000B7ED0C3  ali  25  1..........................................................................................................................................................................................................................................................................................................................................................MTNKYHTAYLVGAGPGDYKLITLKAVECLKKADVVIY-DRLANKKLLDFAKEGSEFIYVHALPQDQINKLIVKKAKEGKTVVRLKGGDPYLFGRGGEEAEELRQEGIPFEIVPGITSAISVPAYAGIPVTHRDFVSSVHIITGHERPEKNVSVDYQVLAQLKGTLIFLMGLSNLSSICNNLIKGKDPDTPVAVISKGTTPDQKKAVGTLATIEEIVQNIKLLPPSIIIVGEVVGLHDRLDWF---QKKPLSGK 257
100 0.000e+00UniRef50_A0A1W9N127 Uncharacterized protein n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W9N127_9DELT  ali  31  2..LAIWAITPNGATLARKIADFLPGSEVFLSESLENTIAFQRLSDAISHNFNCYQGHIFIMSTGIVVRMIATHIRHKTLDPAVVVVDDRGQHAISLLSGHIGGANALTHRVAECIGAAPVITTATDVNQLPAIDMIAKEKGLIIENPE--AIKHVNMAILTGKTVNIHDPFGHLTPRPPSLKGQGENSPLLSGEGL----GEGLVFI-DDIIINLPPKTLILRPASLIAGIGCNRNTDLSE-IKGLLSDVLQKFRLSPHSLSGIASIDLKNDEAGLIALAKELNLPFFSKEELEQVKEQTPSEMVKKHIGIRSVCEAAAILAANKGKLIVPKHSTKNVTVA.................................................................................................................................................................................................................................................................. 339
101 0.000e+00UniRef50_A0A1V2A8H9 Uroporphyrinogen-III C-methyltransferase n=5 Tax=Bacillaceae TaxID=186817 RepID=A0A1V2A8H9_9BACI  ali  30  7..............................................................................................................................................................................................................................................................................................................................................................MGKIWLVGAGPGDPDLITVKGLKAIKQADVILY-DRLISMELLEYAKEGTELIDRHFVQQENINEILVEHAKEGKQVVRLKGGDPYVFGRGGEEAAFAVKHGIEFEVIPGITSGIAAPAYAGIPVTHRDLGASFAIVTGHRKEGADEEMKWASLAKGIDTIAIYMGVKNLPYIQEQLVKHKPPETPAALIHWGTTAKQQTVTGTLSNIYDVAQKEGITNPSMIIVGEVVKMRDQLKWF........... 250
102 0.000e+00UniRef50_A0A2N2A874 Uroporphyrinogen-III C-methyltransferase n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2N2A874_9FIRM  ali  26  1............................................................................................................................................................................................................................................................................................................................................................MNNGIVYLVGAGPGDPKLITVKGLDCIKNADVIVY-DRLSSPRLLSYAKPGAELIYRHTLKQEEINRVLVSRAKAGRFVTRLKGGDPFVFGRGGEEAEFLLAQGIPFEIVPGVTSGIAVPAYAGIPVTHRNFNSTLAFITGNEDPVKEDSIQWDKVSTGCGTLVFYMGMSNLPHIVEKLVAGRPLDTPAAVIRWGTRPEQQTVTGTLADIVAKAREAIMGHPAIIVVGEVVTLREKLQWF---EKKPLFGR 255
103 0.000e+00UniRef50_Q3A9I0 Uroporphyrinogen III synthase/methyltransferase n=4 Tax=Carboxydothermus TaxID=129957 RepID=Q3A9I0_CARHZ  ali  29  1.............................................................................................................................................................................................................................................................................................................................................................MPGFVYLVGAGPGDPDLITVKGLNLIKKADVIVY-DRLVNPVLLTYARKDAELIYAGKAPQEEINKLLVEKALAGKTVVRLKGGDPFVFGRGGEEALELTRHGIPFEVVPGITSAIAVPAYAGIPVTHREVAASFCVITGNEDTKKESQINWEKVALAADTLVFLMGRKNLPQIVANLLKGRSPQTPVAVIRLGTRAEQRTVTGCLQDIEEKVRKADLKHPVIIVVGETVKLREQLNWFETKR....... 250
104 0.000e+00UniRef50_A0A2T5C3F7 Cobalt-precorrin 5A acetaldehyde-lyase n=1 Tax=Mangrovibacterium marinum TaxID=1639118 RepID=A0A2T5C3F7_9BACT  ali  29  1MKVATISISLQGNQLAREIKQHFPEADCFTLDKWKAEPIEGKLSQFCQQLFQNYDSLIFIMATGIVVRSIAPWIQDKTSDPAVLVLDDAGKHAISLLSGHLGGANELTNQLANLIGAHPVITTASDVNQLPSVDLLAQQAGLVISS--MEDAKVVTACLVNRQAVELCDPDNWLGAVELP---------------PFEGEPAARIIVSNKTTIPADLPTVQLIPRNIYLGIGCKKDSSP-EELWAFIEQQLEQLQLDKRSVAAICSIELKSSEPAILEVAKKLNCKFYEAEALQTVEHLFESDFVKQITGVRSVSSPAAYLAGGEGEFLLQKARQTGMTLSVFETKQYQCKE....................................................................................................................................................................................................................................................... 343
105 0.000e+00UniRef50_A0A1H5XIH1 Uroporphyrinogen-III C-methyltransferase /precorrin-2 dehydrogenase n=4 Tax=Oceanospirillales TaxID=135619 RepID=A0A1H5XIH1_9GAMM  ali  21  164.....................................................................................................................................................................................................................................................................................................DQVKRLFPTLKLRERFWSQQLEGAAGELMISGREAQSQQLLADNIAAAEEVSAKEGVRGEVYLVGGGPGDPELLTLRAVRLIQQADVVLY-DRLVAPEIVDLCRPDAERIYVHAVPQGDINQLLVDLALQGKRVLRLKGGDPFIFGRGGEEIETLSQHRVPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDG-STNLPWDELATPAQTLVFYMGLVGLPEITRQLVAHRDADTPAALIQQGTTRNQKNYIATLGTLAEHIADKEVEPPSLIIVGEVVSLHETLNWFD.......... 466
106 0.000e+00UniRef50_F9DSS6 Multifunctional enzyme siroheme synthase CysG n=695 Tax=cellular organisms TaxID=131567 RepID=F9DSS6_9BACL  ali  27  1..............................................................................................................................................................................................................................................................................................................................................................MGKVWLVGAGPGDPDLLTVKAMRVIQQADVILY-DRLINQEILEYARPDAELIFVGKLPQDMINLLLVKHAKQDKQVVRLKGGDPFIFGRGGEEAAFVVQHKLEFEVVPGITSGIAAPAYAGIPVTHRDYSASFAIVTGHRKEGAEEEEKWQALAKGIDTLAIYMGVSNLPYIQKQLIRHKHPETPVAFIHWGTTETQHTVTATLETMTETAREENVLNPSMIVIGEVVRLRDELQWFEEFR....... 248
107 0.000e+00UniRef50_A0A1M4SBC3 Uroporphyrinogen III methyltransferase / synthase n=2 Tax=Schwartzia TaxID=164984 RepID=A0A1M4SBC3_9FIRM  ali  25  1.............................................................................................................................................................................................................................................................................................................................................................MPGMVYLIGAGPGDYRLITLKGRECLEAADVVVY-DRLADDRILGWAPKDAEYIYVHTMKQEDINQLLVDKAKEGKCVVRLKGGDPFVFGRGGEEGLLLRENHIPFEIVPGVTSAISVPAYAGIPVTHRAVATSFAVITGHEDTKGGSNMRWDKLSTGVDTLVFLMGVSNLPKITQKLIEGRPADTPAAVIRWGTKPEQRTLVTTVGTAAEDVKKNGIKPPAIFVVGDVVKLREELAWFDNEDQRPLFGK 257
108 0.000e+00UniRef50_A1AVU5 Siroheme synthase n=225 Tax=root TaxID=1 RepID=CYSG_RUTMC  ali  17  91.................................................................................................................................................................................................ELSNQNNIPVNVVDSPDLCTFIMPSIVDRSP--IVIAISS---AGKAPVLARLIRAKLEST--LPHAYGKLA------------ELAGNF---------RDKVKEKFSNIEDRRYFWEKTFSGIIAEKVFSGKIQEAKADLQVQLDGSTK-----TQVGEVYLVGGGPGDPDLLTFKALRLMQQADVVLY-DRLVSNGVMGLVRRDAQLIYVHVVPQGDINQLLVNLAKQGRRVCRLKGGDPFIFGRGGEEIETLAENGISFQVVPGITAASGCSTYSGIPLTHRDYSQSCRFVTGHLKDG-SMNLPWHELSVEQQTIVFYMALNGARHLSEQLIHGMSPDMPVALVEKGTTPEQKVYTTTLKKLPDLVKNEIIHAPTLIIIGEVVTLREKLNWFDAKKKSYLFG. 471
109 0.000e+00UniRef50_Q7TUN9 Bifunctional cbiH protien and PRECORRIN-3B C17-METHYLTRANSFERASE n=35 Tax=Synechococcales TaxID=1890424 RepID=Q7TUN9_PROMM  ali  24  69............................................................................KDKDPAVIVLDAHGKHVVPLLGGHQAGAEQLAMELAAELGGHAVLTGDANSQNRLALDSFGKGWGWRR-SGSRENWNQLMLTQAQGGKLLLLQH---SGATFWQTTAAAQDVFDANANADQARPAELTI-------GPQSSMSCSWHPASLWIGIGCERDT-SLSLLERAVAAALAEAGLAPEAVAGLASIDRKADETALLALAQAKDWPFFNADALAEVDVPTPSAVVAKAMGTSSVAEAAALLAASNKSTLLLTKQIHHAQNAEANQPFAPQRGELHLIGSGPGDLAFLTHDARAALARSAIWVGYDLYL-DLLEPLRRPDQARLDGQLTRERDRCLKALELAQQGARVALISSGDSGIYGMAGLALELLTQDRPQFQVHPGLSALQLAAAKVGAPLMH----DFCSVSLSDRLTPWSKIERLKSAASGDFVVALYNPRSQLTRAIELLLEHRAPSTPVVVARQLGRAQEDIQLHTLQTLPVK----EIDMLTIVLIGNS-SSRLQDNHVVTPRGYPG... 588
110 0.000e+00UniRef50_N8YD18 Siroheme synthase n=18 Tax=Bacteria TaxID=2 RepID=N8YD18_ACIGI  ali  20  128...........................................................................................................................................................................................................................................................ATNGASPVLSRQIRTQLEASIPHGMGKLAD------FSGKWRKAVKEQITNPDERRIFWEDLYASPLKEQVFNDNLIEADRLIEQALTK------WQKPKGEVYLVGAGPGDPELLTLKALRLMQQADVVIY-DRLVSPAILELCRRDAEKIYVHSVPQDGINALLVKYATEGKRVCRLKGGDPFIFGRGGEEIQELFAANITFQVVPGITAASGCSAYAGIPLTHRDYAQSVRFLTGHLKEGSPE-LPWNELVYENQTLVLYMGLVGLEKICENLISHGRPNMPVALISKGTTPDQKVVVGTLADIASKVEENHIQAPTLTIIGEVVSLREQLQW............ 456
111 0.000e+00UniRef50_Q820Q4 Siroheme synthase n=151 Tax=root TaxID=1 RepID=CYSG_NITEU  ali  22  123......................................................................................................................................................................................................................................................IIVAVSSGGTSPILARLLRSRLEALIPSAYGRLAE------YAARFRDKVRQRFIHQENRRFFWERMLQGPFAEMVFAGRDQAAQDYL----SEALENSTDQFPTGEVYLVGAGPGDPDLLTFRAMRLMQQADVVIY-DRLVSPAILDMVRQDATRIYVHTLPQTSINELLVKLAQEGKHVLRLKGGDPFIFGRGGEEIETLSQHHIPFQVVPGITAASGVASYAGIPLTHRDHAQSCVFVTGHLK-DNTIQLDWPALARPNQTIVVYMGLLGVTELCRQLIAHLQATTPAAIVQQGTTPNQRVLTGTLETLPDIIQQNPLKPPTLIIVGNVVKLHQKLAWF........... 459
112 0.000e+00UniRef50_A0A1B9F565 Uroporphyrinogen-III methyltransferase n=1 Tax=Dissulfuribacter thermophilus TaxID=1156395 RepID=A0A1B9F565_9DELT  ali  25  9................................................................................................................................................................................................................................................................................................................................................................FVYLVGAGPGDPGLFTLRGKEVLEQAEVVIY-DRLANPRLLELAPDNAEFIYVHTFNQDGINKIILEKALTGKIVVRLKGGDPFIFGRGGEEAEILVKAGVPFEVVPGVTSAIAVPAYAGIPLTHRSYTASVAFITGHRSCENEADVDWEGLAKGVGTLVFLMGVTNLPKIAENLIRGRSPDTPVAVIRWGTTPDHFSIDGKLSNIAEKVKEAGIRPPAIVVVGEVAALRNELAWF---EKRPLLGK 258
113 0.000e+00UniRef50_A0A0T5ZWA0 Uroporphyrin-III C-methyltransferase, uroporphyrinogen III methyltransferase / synthase n=24 Tax=Bacteria TaxID=2 RepID=A0A0T5ZWA  ali  28  1...........................................................................................................................................................................................................................................................................................................................................................MNKKGIVYLIGAGPGDPGLFTIKGQEYLAKADVIVY-DYLVNPEILKYAKEEAEIIYAGKMPQEEINQLLVERAKEGRIVARLKGGDPFIFGRGGEEAEVLYEHGIPFEVVPGVTSASAVPAYAGIPLTHRDFTSSFAVVTGHEDPSKEESLPWEALAKI-GTVVFLMGVGKIKESMKKLIEGKSPKTPAAIISWGTFPNQRTAKGSIETIGEIAKQRGIKPPAIIVVGEVVNLREKLNWFES---KPLFGK 255
114 0.000e+00UniRef50_A0A031WI33 Bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase n=57 Tax=Clostridia TaxID=186801 RepID=A0A031WI  ali  23  1.............................................................................................................................................................................................................................................................................................................................................................MKGKVYLVGAGPGDYKLMTLKGLECIRKSDVIVY-DRLANSSYLREAKPDCELIYVHILPQEDINRIIAEKAKEGKIVTRLKGGDPYVFGRGGEEAETLVDEGIEFEVVPGITSAIGGLCYAGIPITHRDHASSFHVITGHLKGDDSGELNWNALANNKGTLVFLMGISNLEKISENLMEGKDKDTPVALISWATRYNQRVVTSTLENVYETAIKEEVKPPTLIVVGSVVGLREKLNFFES---KPLFGK 253
115 0.000e+00UniRef50_A0A1M5AGT9 Cobalt-precorrin 5A acetaldehyde-lyase n=14 Tax=Firmicutes TaxID=1239 RepID=A0A1M5AGT9_9CLOT  ali  32  1MKIAVISFSRSGYALGEALHAGLHEVTTYTKSKYTAKPVDESIGAWTSLRFQNSDALIFIGACGIAVRAIAPYVKDKKKDPAVVVVDEQGNYAISLLSGHIGGANALTLDVSRITGAKPVITTATDINEKFAVDVFAKRNGFYI--SDMGLAKDVSAALVAGKEVGFYSDFPWIGE------LPEGLKIAHE----DEERPELGIAITSSYLEHPFVHTLYLVPRVITLGLGCRKDTAK-EEIQNAVRKACDEQLIPTVAMEQVVSIDLKKDEPGILEYCRERNLPFYTKEELAQVEGKFTSEFVESITGLDNVCERSAVKGSEDGRLIVRKHAENGVTVALAMKKW............................................................................................................................................................................................................................................................ 363
116 0.000e+00UniRef50_K9PM67 Precorrin-3 methyltransferase n=14 Tax=Nostocales TaxID=1161 RepID=K9PM67_9CYAN  ali  21  11....IVVLSQNSVAVARQIITIFPGGAIYAGRTSGIDVSFTDFGETLRELFAEGKPLIGICAAGILIRTLAPLISDKRQEPPVLAIAEDGSAVVPLLGG-LMGVNDLARRIAEVLDVPAAITTTGDIRFRTALLSPPPGYHL----ANPEDAKKFISDLLAGAKVKLEGTASWLSNSQLPI----------------DPNGDLTIRITERLVTPA-ANCLVYHPATVAIGM-------SGNETVALIQQLLVDAELAPASVAGIFAPITAASNPAIHAVASALEVPFFTSNQLETYLSQGYSPAQAAAIAATGVSSLSSQIAIASQPIDTNTTGQPRGRLA--------------IIGTGPGGLQWMSPEVQAILKSVTDLVGYKTYL--DLVGSLGDGKQRHESDNREELARAKMALDLAATGRYVAVVSSGDPGIYAMAAAVFEVLDRHNVEIQVAPGISAMQAAAAAVGAPLGH----DFCAISLSDILKPWSIIERIAAAAEADFAIAFYNPVSQLTAARDILLHYRTPDTPVVLARNLGRPGQNVKAIALHQLAPDVA----DMRTVILVGSSKTRAIKRSAVYTPRQY..... 567
117 0.000e+00UniRef50_Q2Y6L7 Siroheme synthase n=772 Tax=root TaxID=1 RepID=CYSG_NITMU  ali  17  12..........................................................................................................................................DRNCVVAGGGEVAARKVAMLLRAGAHVTVVAPSELLEQLNEQSREGKLAYRAETFQDEHLADAVLVIAATDDVNQRISEAAKRLRPVNVVDNPGLCSFIMPSIVDRTPVVVAVSSGGASPVLTRLLRARLETMIPMAYGRLAA------YAGEFRDRVKHRFSQPAQRRRFWERVLQGPFAEMVFAGKDQAAKAWLERELENETEEP----VKGEVYLVGAGPGDPELLTFRAMRLMQQADVVVY-DRLVSPEILDMLRRDTPRIYRHTMPQESINDLLVRLAKEGKRVLRLKGGDPFIFGRGGEEIETLAGHGIPFEVVPGITAANGAASYAGIPLTHRDYAQSCIFVTGHLKDG-SVDLDWPMLARPKQTIVVYMGLLGLTVLCKQLIAHLPNNTPAAIVQQGTTRKQRVLAATLETLPELTAAAHLVPPTLVIVGEVVNLHRKLAWFQPEGNLPG... 470
118 0.000e+00UniRef50_A0A224VMT1 Siroheme synthase n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A224VMT1_9NEIS  ali  18  63.....................................................................................................................................................................GLFTDDMVSGMRLVIAATDQRVVNQQVSQVAQQHNIPVNVVDDPEISTYITPAIIDRSPLVIAVSSG-----GSVPVLARLVRARLES--IIPAGFGLLAA---------------------FSARFRERVKARFADVEARRTFWESVLEGPVAEAVMNGREAVACEEMEKRLASAEDSP-----SGAVYLVGAGPGNPDLLTFRALRLMQQADVVLH-DKLVAPELLELVRRDAERIYVHTLPQEDINQLMVRLAKSGKRVLRLKGGDPFTFGRGGEEIETLAEHNIPFEVVPGITSANGAASYAGIPLTHRDHAQSVTFVTGHKKDG-SIDLDWPALTRPDQTVVVYMGLTMAAELCAAFIAHKPADTPAAVIEWATTPRQRTLSGTLQTLPTLISSYGVASPALIIVGSVVSLADKLAWFRRVENGP.... 464
119 0.000e+00UniRef50_A0A0B3B9Y9 Cobalt-precorrin 5A acetaldehyde-lyase n=12 Tax=Bacteria TaxID=2 RepID=A0A0B3B9Y9_9THEO  ali  31  1MRIAIIALTKNASKLANEIGTKLKG-DVYVKEKYEGYAIEGDFIEFVHKIFRKYQGLVFVMATGIVVRAIAGVVKDKFTDPAVVVVDEKGKFAISLLSGHVGGANRLALKVASIIGAQPVITTATDVEGVISLDVIAKDYGYQIENKE--DLKKVSAAFVNGENVGFILDEDVEKIPLLK----------DYVKNEDDRQIDAFVYITDKEIKKPEKPYVILRPKNIVIGLGCKKGIA-FEDLFLFVSEIFKKLNLSLKSIESIATINIKKEEKGIQQLAKFLKVPFYTKEDLKKVEDKFPSDFVFHTVGVGSVARPSAYLASSGGK................................................................................................................................................................................................................................................................................ 320
120 0.000e+00UniRef50_A0A097ANY9 Cobalt-precorrin 5A acetaldehyde-lyase CbiG n=9 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A097ANY9_THEKI  ali  32  1MRIAIIALTKNASKLANEIGQKLKG-DVYVKEKYAVSAIEGDFVEFVHKIFSKYEGLVFVMATGIVVRAIAGVVKDKFTDPAVVVVDEKGRFAISLLSGHVGGANRLALEVASAIGAQPVITTATDVEGVISLDVIAKDYGYQIENIE--DLKKVSAALVNGENVRFVFDEDVEEIPLLK----------DYVKNDDDGEVDAFVYVTDKEIKKLEKPYVILRPKNIVIGLGCKKGIA-FEDLRTFVSETFKNLNLSLKSIKSIATIDIKKEEKGIHQLAEFLKVPFYTKEDLKKVENKFPSDFVFHTVGVGSVARPSAYLSSDGGK................................................................................................................................................................................................................................................................................ 320
121 0.000e+00UniRef50_A0A2G9ZZU5 Uroporphyrinogen-III C-methyltransferase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A2G9ZZU5_9DELT  ali  25  1.............................................................................................................................................................................................................................................................................................................................................................MRNKVYLVGAGPGDTGLLTLKGKACIEQADVIVY-DYLAADELLAYARTDAEIIYAHTLTQSQINQLLVEKAREGRTVTRLKGGDPFIFGRGGEEIEALIDAGIPFEVVPGVTSAIAAPAYAGIPLTHRKYTSTVTFITGHEDPNKDSSIRWKALADMGGTLVFLMGVKNLPNIVNQLRAGMAGETPAALVRWGTTVRQQTVAGTLDTIVENVQAAELKPPCIIVVGEVIRLRDKMTWF---ERRPLFGK 254
122 0.000e+00UniRef50_A0A0J0U6R4 Porphyrin biosynthesis protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0J0U6R4_PAESO  ali  23  1.............................................................................................................................................................................................................................................................................................................................................................MKGKVYLVGAGPGDYKLMTLKGLECIRKSDVIVY-DRLANSSYLREAKPDCELIYVHILPQEDINRIIAEKAKEGKIVTRLKGGDPYVFGRGGEEAETLVDEGIEFEVVPGITSAIGGLCYAGIPITHRDHASSFHVITGHLKGDDSGELNWNALANNKGTLVFLMGISNLEKISENLMEGKDKDTPVALISWATRYNQRVVTSTLENVYETAIKEEVKPPTLIVVGSVVGLREKLNFFES---KPLFGK 253
123 0.000e+00UniRef50_A0A1H8DZY5 Cobalt-precorrin 5A hydrolase n=22 Tax=Bacillales TaxID=1385 RepID=A0A1H8DZY5_9BACL  ali  31  6...AVVAITKHGVELARRLAGQLPGADLYYMEKFGVKLFSGSVRLLLPDLFQRYSGLILFISLGAVVRMIAPLLKDKKTDPAVVVIDDRGEHVISVLSGHLGGANELTRRVAAILDARPVITTASDVRQTIPVDLFGSPFGWEIESFER--ATPVSAAVVNEERVIVIQESGEPDWWTYDKPLPEHIRVFSSTREAWEQEFDAALVVTHRLLSEEEENGVLYRPKVLVLGLGCNRGTE-LEEIEQVVKETLSEQRLSIKSVRNIATIDLKKDEPGLLALCRKYGWRMYSPPELNTVALPHPSETVYRYTGAYGVSEPAALLSSGATDWMLTKKKAGNVTISIAMVPH............................................................................................................................................................................................................................................................ 361
124 0.000e+00UniRef50_A0A150MBJ3 Uroporphyrinogen-III methyltransferase n=20 Tax=Bacillales TaxID=1385 RepID=A0A150MBJ3_9BACI  ali  30  1..............................................................................................................................................................................................................................................................................................................................................................MGKVYLVGAGPGDPELITVKGLKCIQQADVILY-DRLINEELLSYAKKDAELIGYHTMQQETINHFLVRYAKKGKTVVRLKGGDPFVFGRGGEEAEALAKHGIEFEIVPGITSGIAAAAYAGIPVTHRDFSSSVAFITGHKRKGSEEDLKWESLAKGIDTLAIYMGISNLPYICDQLTKGKAPSTPVAVIQWGTTSEQRTVTATLSTIAEVVAKEKIENPSMIIIGNVVKLRENIQWFE.......... 245
125 0.000e+00UniRef50_A0A1X7GID6 Precorrin-3 methyltransferase n=4 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1X7GID6_PARCY  ali  18  9...AIVVLAPSALATARRLQAACAGAQVHLQSRVEADVAFAELGAHLRALYASGTPIVALCAAGIVIRCVAPMLANKGMEPPVLAVAEDGSAVVPLLGG-LAGVNAMAREIARALDVAPAITTSGELRFGTCLLSPPQ--GYALASLEQG--KRFVSDLLAGHATRIEGEAPWLDDATLPR----------------DPSAAHTIRITPQTSAER-ADELVIHPRSVVAAVCPQRAASDELSIAARIRQALRESGLAPLSLAAVLAPMWAMSDPALAEAARALGVPLRFAAVTGESSGGDSAPGSGADLPSNSVNSNSAAHAGHAENESGANGWPASWLLAAALHQPHEALAPCYVVGLGPGSTELMAPAARAALTEANDVLGYETYV--RMAGPFRDDQRVHASDNREELQRARHAFALASEGRTVAVVSSGDPGIFAMAAAVLEALDAHAVELRILPGISAAMATAAEAGAPLGH----DFCVLSLSDNLKPWAVIEDLRHAAQADLVMAFYNPISRLDRALAIVRAHREPHTRVVLGRDVGRPGAAITTTTLGEL----RSDQVDMRTTVIVGSSTTRGPHGEWIYTPRSY..... 608
126 0.000e+00UniRef50_A0A0N0E5M6 Precorrin-3 methyltransferase n=246 Tax=Bacteria TaxID=2 RepID=A0A0N0E5M6_9PSED  ali  18  7...AIVILGNGSLATARRLQQIYPNALIHAERVEGADRSYSEFGATLRQLYQQDTPIIALCAAGIVIRSLAPVLLEKGAEPPVLAVAEDGSAVVPLLGG-LGGVNVMAREMAAGLGVAAAITTSGELRFGTCLLNPPSGYAL----ADLELGKRFVSDLLAGESVRVEGDAPWLAEARLP----------------EHQDARLSIHVGSAERTPTTDELLIY-PRCVLAAVS-----AEVPELAERVRAALREAGIAQQSLACLLAADTQMASPALHEAAGQLGVPL-----------RFGVAAADIETLARQALPSASLRISGELTLAVA-------AQPLDPLQIGRPRGRLAVIGLGPGAAELMVPAVRAELDRANDVLGYETYV--RMAGPFRADQVLHCTDNREEMQRARHAFELAAAGRSVVVVSSGDPGVFAMAAAVLEALHEQGVELEILPGVSASLATAAQAGAPLGH----DFCVMSLSDNLKPWTIIERLDLAAEADLALAFYNPISRLGRALEIVARHRTPQTPVVLGRDIGRPGQTLRVTTLGKL----TPDQVDMRTLVIVGSSTTRAEGGEWVYTPRWY..... 560
127 0.000e+00UniRef50_A0A2E7Z8S9 Uroporphyrinogen-III C-methyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7Z8S9_9CHLR  ali  18  18....................................................................................................VGGGDVATRKVERLLAAEASIT-------LVAMQLTPQLDQWRQEEKISVKQREFSSTDLYGKRLVIAATASSSLNQRIYAEAEATGVIANAVDDPEYCRF-----ITPAVIDRSP----------LVVAI-SSGGTAPSRMLRQRIET------LVPAAYGRLAR---------------------FAGNFRARVKSSLSSVQARRHFWETVLTGPIADKVLNGHES--KAVTLFNTELEKQSHDQTRQLGQVSLIGAGPGDPELLTLKALRLIQQADVVLH-DKLVSPPVLDLVRREALKIGHHSISQEDINSKLIQLARQGKRVCRLKGGDPFIFGRGGEELTALVDAQIPFQVVPGISAANGCSTYAGIPLTHRDHANSVTFVTGHTQNDGELDVPWPSLVNNRQTLVFYMGLTSLPLICEQLIHGLAHDTPAAAIQQGTSTDQHLAVSNLADLGSAVENAKLHSPTLIIIGQVVQFAEKLHWFGELSGK..... 467
128 0.000e+00UniRef50_F8C343 Uroporphyrin-III C-methyltransferase n=14 Tax=root TaxID=1 RepID=F8C343_THEGP  ali  27  1............................................................................................................................................................................................................................................................................................................................................................MKKGKVYLVGAGPGDPGLFTLKGKKVLEEADVVIY-DYLANPRLLDFCKEEAEKIYVHTLPQEEINKLLVEKAKEGKIVVRLKGGDPFLFGRGGEEAEALVEENIPFEVVPGITSAIAVPAYAGIPVTHRDYTSTLAIITGHEAENKEESIDFLALSKI-GTLIFLMGVKNLPYIAKRLIEGKNPNTPVAVIQWGTIPNQKTVTGTLENIAEKVKEKGITAPAIIIIGEVVKLREKFNWFES---KPLFGK 254
129 0.000e+00UniRef50_A0A2R6AH48 Precorrin-6y C5,15-methyltransferase (Decarboxylating) subunit CbiE n=3 Tax=Candidatus Marsarchaeota group 1 TaxID=2203770 RepID=  ali  23  3.KIAVVSVSSPGAAVGDKITQKLNELGFFAHHYHKGVSYKGSVSQVFKQVYKVVDGIVAIMALGGLVRVITPLLRSKLSDPAVVCVDDAARFCISVCSGHLGGANELASIVAKILGATPVITTATDSLGKASVEEMAEKFGCEIKNL--GSLLEVNAAIVNGKKLGVVV---------LTPVFAQGERVNEEQLLEKEKRYDALVVISDKEPKGLTKPYVWLKPKRVVIGIGSVKGV-SSDEVVKAITQALEKAGISLSDVQAVASI---KEENAFVEACKRLGLRFVEKDSLKAFNHPEPSEQVLKHVGLSGVAEPCALYVAGEGSTLILKKFWRRITLAIASVPISAQSAKLFVVGVGPGSQEYLTDCAKRAILDAKVVAGYAH--PLRIVRHLLSGKVVLTFTIKDSKQKIEQICQRVKQGESCAIVLTGDACFS-----EKELLQKIPCDFEIIPGISSIQVAAARCGVSL---DKAHVLTLHESGERELLEQKLRVDSIKRSKPVLLLPRPYDLMPEIASLLISGAPKHTTVRVYENLTLENETQTQATLASLPRK...................................... 554
130 0.000e+00UniRef50_K9VLW5 Precorrin-3 methyltransferase n=13 Tax=Cyanobacteria TaxID=1117 RepID=K9VLW5_9CYAN  ali  20  7...AIVILGQNSLPIAKKISAHFPGSQIYIDRTNDTDINFSNFGETLRELFATQTPIIAICAAGIIIRTLAPLLSDKRAEPPVLAVAEDGSAVVPLLGG-LHGVNDLAREIAAALGVQPAITTTGDIRFRTALLSPPQGYSL----ANPEDAKTFISNLLAGEKVRLEGAASWLSESNLPLAKPA--PTGATPTQRIAPDPKLTIRVTEKAIAPTP-DCLVYHPQIVAVALAKLSNIEP-EIAVSLVQQVLENAGLAAASVAGFFALKEEMGNPALEAVSQYFKVPFFNLSELVELDSIELIENQAAQIALTAAGANSQLIE--RDRPNALNCAIALAAEPLDASAIGVSRGKLAIVGTGPGGAPWMSPEVKEILREATDWVGYKFYL--DLAGTLREGQKRHDSDNREEIDRARFALDLAASGKSVAVVSSGDPGIFAMAAAVFEAIDWQGIDIRVAPGISAMQAAAAAIGAPLGH----DFCAISLSDILKPWEVIERISAAAIADFAIAFYNPISQLSRAIEILLQSRDAKTPVILGRNLGRPGQSVRVCTLGEF----QPQDADMRTLVIVGSSQTRKYGDVWVYTPRRY..... 596
131 0.000e+00UniRef50_UPI0004785278 hypothetical protein n=1 Tax=Aminiphilus circumscriptus TaxID=290732 RepID=UPI0004785278  ali  22  6...AILILSSRGEETARRLASTLGGDVL--------SPAPGELKTLLTSLWERLSGIIGVGAAAIYLRAAGPLLRDKASDPPLVCVSEDGHMVVPLTGGHLGGGFDLARSCAKALDATLAATCSSDRAGLTAPDLLCRRWGFVLEGKE--HLPAVNGALLDEGILPLRADPEFLRLPFPPCYRVEPAEEKDGETAPGEDAPHPKVLVSFRNAPLPPG-AVRLVPPCIVAGVGCRKGVA-AEDVVEALRASFREGGYTLSALAECRTIPEKEFEPGLVEAANLLGVPLRSREELLALPGPFTPSVAERHLDLPGVAEPCAATAGP----LLAPRTSSRGVTVALSLRPLRFQGRVDVVGTGPGDARFLTAEARAAIEGAEVLVGYALYIDQIPEAW-RRNKWVKRFSMGEEEERVRLALNLAERGYAVALLSGGDPVLFGMAGLTHSLAAETSVPVRVIPGISAIQAAGALLGAPYTNGLTC----ISLSDYLQPWEEVLQLRGAALGGLTVALYNPVRRLAAVREIFLEG-----PVLLVRDVGRPEESFRAIPLEALS----PAEVDMRTLVV......................... 560
132 0.000e+00UniRef50_A0A0D0NGR6 Wenxma_21, whole genome shotgun sequence n=183 Tax=Bacteria TaxID=2 RepID=A0A0D0NGR6_9RHOB  ali  21  7....VIALTARGAKLGRRVADAAGGTLHGAGRVRDADATFENAADHVRDLFAAGVPVIGVCASGILIRAVAPLVSDKRAEPALVAVAEDGSAVVPLLGGH-GGANRLARRVAEALGIGAAVTTAGDLGLGVALDEPPAGWRLV----DPAAAKGVAAGLLAGEAFVLAGRAEWLAPAALPNVRVQGGAGAVTLTPMAGGEGLRWAQVTD------------------VLGLGCARGAAPAEALR-LIGETLEAEGVDPAALACVATLDLKADEPAVHAVAQAFGLPIFPAAELEAVAGRNPSDVVFAEVGCHGVAEGAALAAAGEKRKSAAVTCAVARAPEPVTAPAGRPRGRLSVVGIGPGQGAWRSPEASRLIAEADELVGYSLYL--DLLGPLAVGKARADFPLGGEEARCRHALERAGEGANVALVCSGDAGIYAMGALVFELLDRAGVSAEVVPGISALQAAAARAGAPLGH----DFCTISLSDLLTPREDILRIRAAAEGDFVIAFYNPVSRLAEARDILLRHRPAETPVLLASNLGRPEEALAYRRLDE----VKVDEVDMLTVVLVGSSNTRLAKLGRMYTPRGY..... 595
133 0.000e+00UniRef50_A0A174L8Y3 Precorrin-4 C(11)-methyltransferase n=2 Tax=Bacteroides vulgatus TaxID=821 RepID=A0A174L8Y3_BACVU  ali  63  1...................................................................................................................................................................................................MPQSEFKLIIAVTPYIY-SAEIPMLCFHPAVLHLGIGCRKQCDPS-GIADYIEAVMHRHGLCPFSLASLNTIELKKDEPLLEILHRRWETHIYPAEELKDITVPHPSEKAFEVTGVYGVAESTALKSSGEGTLVLEKQKGMHFTFAIAVSATAMRGGHIEIVGAGPGDPELISVRGKRMLEKADLVLYAGSLVPRELTFYAKEGATVRSSAGMDLEEQFALMKEFYDKGLFIVRLHTGDPCIYGAIQEQMAFFDRYKMSYHITPGISSFQAAAAALRSQFTIPEKVQSIILTRGEGRTPMPEKEQLHKLAQSQSTMCIYLSASIVEQVQEELMQAYPPETPVAACYKLTWKEEKIYRGELKDLAKIVRDNNLTLTTLLVVGEAIDNRKGLSRLYAHEFKHLFRK 410
134 0.000e+00UniRef50_A0A1K2HXC8 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=10 Tax=Rhizobiales TaxID=356 RepID=A0A1K2HXC8_9RHIZ  ali  21  13....ILSLTGSSEPMARRIAEIVGGELHLGVK-----------ADGVAPLFLDGRAVIGVCAAGILVRLLAPHLSDKRSEPPVIAVSQDGQHVVALLGGH-GGANALARRIAEGLGVTAAITTASETRFACALDEPPP--GWTI--AERNDAKPAMIALMAGAKIALNGHAPWLAEAGYPLS----------------SMGAITVMVTEKAGRIP--RGLVYHPKTLVAGVGCERGT-SGAEIIGLIEAALNRQGLAPQSLACLATIALKADEGGIIEAAAHFGVPLFSTAELAQERYRTPSPVVEAEVGVPGVAEAAALKAGPKIKSKRATCAIGRSTRPLDVERFGRPRGVVHIVGIGPGDGPSRTGSAVAALRAASDWVGYGLYL--DLVSDLRTDQVEHRFDLGEEEARVRHALELAADGAQVALISSGDAQIYAMASLVFELIEAEGVGVESHPGISAVQAASAAAGALIGH----DFCCISLSDLLTPRPDILRLKAAAEGDFVTALYNPRSQIEAAHAIFAANRPPETPVIIARSLGRPEETVTVVPLSEF----DPTAIDMLTIVLIGSSQSLSDGRTIAYTPRGY..... 585
135 0.000e+00UniRef50_A0A2H6B2C7 Putative cobalt-factor III C(17)-methyltransferase n=14 Tax=Bacteria TaxID=2 RepID=A0A2H6B2C7_9BACT  ali  24  1MRIAILAPRPRDLGLAGRIRAILDG---------DTDIVAGSLRQSLPSAFRSGTGVVVIGAAGMVVRLLGPELSHKDRDPPVVAVAPDGSCAVPLVGGHR-GANRLARRIAAGLGAFAAITTASDTLLGLALDEPPPGWRLR----PPPDFAAFAGALLDGAPVRLVDETGAGDWLR-------------AAGLRFADDARHEILVTVRDRAPTPE-CLVCHPPQLALGVGCSRGADP-EALSVLARSVLAEAGLAPEAVACVVSVDLKADEPAIHALAEELGVPFFPRERLAEERSRHASEAVERAIGIPSVAEAAALAAAAKRKGRGATVAVAEATRPIDPAAVGRPRGRLAIVGLGPGDPAFLTRAAEAALARATDLVGYRLYL--ELAKPLARGKRLHPFALGEEEERCRRALELAAEGREVALVCSGDPGIYAMASPLFELLAWQRIALEVVPGISAMQLAAARSGAILGH----DFCAISLSDLLTPAATIERIEAAAEAGFVIALYNPVSLLLRARDILLRHRPASTPVVVGRALGRVGEEVRIITLADL----TPSGLDMLTTVVVGAPSSRTLTLAWAFTPRGYRL... 586
136 0.000e+00UniRef50_C0RJQ2 Precorrin-3B C17-methyltransferase n=762 Tax=Bacteria TaxID=2 RepID=C0RJQ2_BRUMB  ali  20  18MIPAILVLAEAALPTTRQIAAALERAEVLGLRVSTADKTFAHFGEALRALYEEGRPVIALCAAGIVIRALAPLLQNKRMEPPVLAVAEDGSAVVPLLGG-LSGVNDLARQIAAALGIAPAITTSGELRFG--INLLHPPSDLTLANPD--DAKTFTSNLLAGERLKLNGKSNWLRQSKLPF----------------ADDGKLTITITPHNRT-PRTNELIYHPQCVAIGI-----ETPDESLQGQIETALAGAGLAKTSLALLLAHEKDCTSPFLHETARRLNV------QLRFVTG-APDA---RELALRSVEHPLDLIESSGLALAVAK-------APADVLFVGRKRGRLAVVGLGPGARDLMTPAVQRELEQAEDILGYETYV--RMAGPFRTGQTIHMTDNREEMQRARHAFALAASGHNVAMVSSGDPGVFAMAAAVVEALHEHGVELSIQPGISAAMAAASRIGAPLGH----DFCIISLSDNLKPWDIIERLALAAEADLAMAFYNPISQLGRALELLRQYRSGETPVVLGRDIGRAGETTRVMTLGAL----TPGDVDMRTVVIIGSSHTRRDGGEWVYTPRWY..... 575
137 0.000e+00UniRef50_A0A256FF99 Precorrin-3B C17-methyltransferase n=20 Tax=Proteobacteria TaxID=1224 RepID=A0A256FF99_9RHIZ  ali  19  1MKAAILVLGEAAISTARKIQSALGNAEVLGSRVTSADERFTHFGDTIRTLYEEGRPIIALCAAGIVIRALASLLQNKRIEPPVLAVAEDGSAVVPLLGG-LSGVNDVARTIAHALEVAPAITTTGELRFGINLLHPPAELTL----ANPESVKTFMSDLLAGKTLCLNGQSRWLAASKLPFS----------------DNGQLTISVTPETRA-PQTNELLYHARTIAVAI-----EKPTEDLTSLIGQALDGAGLSRDSLALLLAHEKDCASPYIHLAARALKTPL--------------------RFVAGNADLVTASVENPVQCIRDKNLTLAVAPSPADVLFIGRKRGKLTVVGLGPGARDLMTPAVQRDLEQAEDVLGYETYV--RMAGPFRDDQIIHMTDNREEMQRARHAFELAASGRDVVMVSSGDPGVFAMATAVIEALHEHGVELVIQPGISAAMAAASRIGAPLGH----DFCIISLSDNLKPWEVIERLALAAEADLAMAFYNPISQLGRALEILRQYRDAETPIVLGRDIGRPAETTRVLSLSQL----TPDDVDMRTVVIVGSSHTVREGGEWVYTPRWY..... 555
138 0.000e+00UniRef50_A0A081GMF4 Precorrin-3 methylase n=1 Tax=Cyanobium sp. CACIAM 14 TaxID=1496688 RepID=A0A081GMF4_9CYAN  ali  22  7.RIVGLGFGPAAGPMLERLRRGGLLAEV--------KGPEEGSADWLAARWSGARAVVAVGACGLVTRLIAPLIADKDSDPAVVVVDPDGRFVVPLLGIHGAGGDRLGQEIAALIGGQAVLTGASASGSRLPLDAFGLAWGWRRGRGDWRTL------MVE--------EARSPGALHHQESGTRLWLELEAAAAAPGSVPEALV-IGPR-----SGAGCRWHPPSLWLGIGCERNT-SLGVLERLVDEGLASQELAGEAVAGLASIDRKGDEPALLALAERRGWPLYDSATLAAVSVPHPSEAVAREMGTPSVAEAAALQAAFQASSPQAATLTDTRDTALAERQWAPQRGHLHLVGSGPGPIGLLSGEARQALAAATVWVGYGLYL-DLLEPLRRPDQLRREGRLTEERARCAEALDLARQGIDVALISSGDSGIYGMAGLALELLDRPG--FTVHPGVSALQLAAARAGAPLMH----DFCTISLSDRLTPWEVIERLRGAASGDFVVALYNPRSQLGRALELLSEDRPSSIPVLLARQLGRADECLSLHTLHTLPQ----EQVDMLSLVLVGNSTTKVQD-GRMVTPRGYPG... 599
139 0.000e+00UniRef50_A0A1X7KCK9 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=1 Tax=Dethiosulfovibrio salsuginis TaxID=561720 RepID=A0A1X7  ali  21  2..ISVFSVSQRGAKTGERCASLVGGEH--------RRPPRDQLRSSVSQAWGQSKAIVMVGSIGVAVRVIAPLLQDKETDPAVIVVTEDGKTVIPLTGAHLGGGTDLSRSLGTGLEAEVVLTTSSDRTSSIAPDLLCSRWGWKIEGK--RGLVDTNGALLDGKDLLYWIEEDQSMPPFPERYL-------------RTPRRDLAQVIVSSKKRGLASDQVQLVPPSTVAGMGCRKGTAKTALLQE-LTEALEDHGLLIQSVGEIRTAWAKKDEPGLMALGEELGIPIMTDDEIKAVQGTFSPSAAEDHLGLPGVAEPCAASAGR----LLGPRRAQNGVTVALAHRPLNFVGKLSVVGTGPGDSGYITLQAREAIDRADWVVGYRLYVDQLPQEWL-EGKGVERYGMGQEEERVEAALSLARKGYRVALVSGGDPILFGMAGLARN--MAMGVPLEVIPGLSAVQAAGATLGAP-----YSNGLILSLSDYLQPWRAIEALEGAASTDLTVALYNPVRKLDKVARGYIDGW-------LIRDAGRPEESMRPIKLAEL----DHRDVDMRTMIL......................... 540
140 0.000e+00UniRef50_A0A0C1XKM0 Precorrin-3B C17-methyltransferase n=5 Tax=Nostocales TaxID=1161 RepID=A0A0C1XKM0_9CYAN  ali  21  4..CAIVVLGENSLPIAKQIKSALLNATIYAERTSNVDVSFTNFGETLRELFAKGTPIIGICAAGILIRTLAPIISDKRQEPPVLAVAEDGSAVVPLLGG-LQGVNDLARQIAAVLEVKAAITTTGDIRFHTALLSPPPGYHL----ANPDDAKKFISDLLAGATVKLEGTASWLINSKLPF----------------DPNGKLTIQVTEYQVPLTP-DCLVYHPATLAIGVSNASQVNSEEAV-SCILQMLADAKLSIFSVAGVFALDEEAAS-VIEEIADALNVPWFNCHEKNAVAIALTATGANGKLLLQQQSDINLAVAVSQEVIDINTIGKAR--------------GQLFIVGTGPGAANWMSPEVKQILSEATDLVGYSFYL--DLAGSLREGQRRHEFDNREELARAEMALDLAASGRIVAVVSSGDPGIYAMAAAVFEVLDWQSIKIHVCPGISAIQAAAARIGAPIGH----DFCVISLSDILKPWSIIERRIAAAEADLAIAFYNPASQLASARDILLRYRSPQTVVVLARNVGRVGESVVVRTLADLS----PQEVDMRTLVLVGSSKTRHPGGVWVYTPRKY..... 565
141 0.000e+00UniRef50_A0A1I7FDT4 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=1 Tax=Butyrivibrio sp. INlla21 TaxID=1520811 RepID=A0A1I7FDT  ali  22  8.KYKIISFTDAGRELAERLLILLGNAEDDLRGESHGDNAVESLDDFVKENFDTGNVLVFIGAAGIAVRAIAPYIKDKTKDPAVIVIDEKGRNVIPILSGHIGGGVKEARLMAMLLGAKPVLTTATDVENEFAVDVYAKANDLVI--SDMKAAKEFTARLLEEKKGYYFVDEGAEAFVGSGIGYENVVRVKDFIDDANPEKKAALFVISYRDDDALSGDYLKVIPKCIAVGMGCKKGTG-GDSLYSFCLDKLKEAGIDARAVDALASASIKKDEEGLKYVADKLDAYFFEADDLMAMPGDFSSEFALEVTGCDNICERAVVALGAEGVLVHKTKGTGMTFAAGVMR--PNKKGSLTVVGIGPGAYEDMTVRAQKALLESDVIAGYTVYC--DLVRPYYKDKEYISTPMMGEEKRVELALLTAAKGKAVSLISSGDAGVYGMAGLAF-LLGQKFPDVDI--------------------RXXHDFCLISMSDRLTPLELIERLRCAAMADMSVVIYNPESKLKHACEILLETLPADRVCGIANNIGRDGESCSVMTLAEL----KDADADMFSTVFIGNSTT-ANIGGKMVTQRGY..... 625
142 0.000e+00UniRef50_A2C4V2 Bifunctional cbiH protein and precorrin-3B C17-methyltransferase n=5 Tax=Prochlorococcus TaxID=1218 RepID=A2C4V2_PROM1  ali  22  1............MPLLERLQASKHVDQIFISEKKIDGLVESSPIDFLKDQWQGNNKLIFVGSIGAVVRLIAPFIRSKENDPAILVTDSKAKNVITLLGGHKQGGDRFASELAAALEAEVICTSDSFTESRIPLDCFGEGWGWKRG-GEVVGWRKLMISQSKEQKNIVFQSKGSKLWQQLKG--CSNFSFLEKNDPISFENIDLYI-------GQENRNKCSWHPPTIIIGIGCERNTDEK-VIQRAINNSLNQNGLSLLSISGLATIDRKNDEIGLLSLSKKHEWPFFSAFELSKVNVPTPSNVVLNEMGTPSVAEAAALLAGDHRGRLIQNKQIYTIALAEVENPFAPHKGELHLIGSGPGDLKMLTSDSRQALTRCAVWIGYGPYLNESIRGH---NQVRIDSKLTFEKDRCQHALDLAKQGVKVGLISSGDSGIYGMAGLALDLWLNERLDFEVHPGISSFQMAAAKLGAPFMH----DFCSISLSDLLTPWNQIERIKSAAIGDFVLAIFNPKSQLKKTVDLLLECRNPSTPVAIARQLGRPEESIEIHTLETLPFD----RVDMLTILVIGNSQSVIKN-NKFLTPRGY..... 590
143 0.000e+00UniRef50_D2Z8F1 Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase n=3 Tax=Dethiosulfovibrio peptidovorans TaxID=47055 RepID=D2Z8F1  ali  22  1MNIAVFAISARGKSVGKRCAEALNGKLITPRR--------DELKASLSEIWHRSDAVVMIGSTGVAARVTAPLLRDKEADPAVIVVTEDGELVLPLTGAHLGGGSDLARSLASDLGAHLVSTTSTDRMNVAAPDLLCSRWGWKLEG--RKALVQTNGALLDGRKLLFWVDENEETPPFPEGYLPC------------ETPDEADVLVSPRAL-SLGSHQVQLIPPSLVAGMGCRKGVD-RQILKETLLRHLSKQGYSIYSLGEIRTSTVKSREKGLLSLSEELGVPLLEDEEIRSIDGNFSASAATAHFDLPGVAEPCAASAGR----LIGPRSAERGTTVALGHRPARIEGKLYVVGTGPGDRKYMTFQAKEAIDDSDAVVGYRLYVDQLPEEWLKR-KKVERYGMGEEEARVASAMALAKKGFRVSLVSGGDPILFGMAGLARN--MAEELPVEVIPGLSAAQLAGASAGAP-----YSNGLILSLSDYLQPWESIERLSGAASTGLTVALYNPVRRDLDVK---LEGRDGQT-VWLMRDVGRPGESRKVMDLSEL----TSSDIDMRTLLLLGEDTVARKGC--LVDTRGYHFERK 565
144 0.000e+00UniRef50_A0A248UJE2 Precorrin-3B C17-methyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A248UJE2_9RHIZ  ali  19  1MKAAILVLGEAATSTARNIQSRLRNAEILGLRVTSADKHFTHFGDTIRALYEEGRPIIALCAAGIIIRALAPLLQNKRIEPPVLAVAEDGSAVVPLLGG-LSGVNDLARTIAQALEVPPAITTTGELRFGINLLHPPAELTL----ANPEAAKTFMSNLLAGENLRVNGSSRWLTASKLPLS----------------DNGQLTISITPETRA-PQTNELIYHPRTVAVAID-----KPGENLVSLIEQTLDSSELSKDSLALLLVHEKDCASPHIHQAAQILKAPLRGVDDLATVSVENP-----------------------QHLIKSDRLTLAIAATPADVLFIGRNRGKLTVVGLGPGARDLMTPAVQRDLERAEDVLGYETYV--RMAGPFRDDQIIHMTDNREEMQRARHAFELAASGRDVVMVSSGDPGVFAMAAAVIEALHEHSVELVIQPGISAAMAAASRIGAPLGH----DFCIISLSDNLKPWDVIERRALAAQADLAMAFYNPISQLGRALEILRQYRVAETPVVLGRDIGRPAETTRVTTLGELTPK----DVDMRTVVIVGSSHTERDGGEWVYTPRWY..... 555
145 0.000e+00UniRef50_Q7TU33 Bifunctional cbiH protien and PRECORRIN-3B C17-METHYLTRANSFERASE n=22 Tax=Prochlorococcus TaxID=1218 RepID=Q7TU33_PROMP  ali  20  1MKGIAIGFSDTSKEILKRLKEIFIGSSSYKDKNVKDSVKFMKPRQILREKWGNLELIIFVGSVGASIRLINSLLSSKDKDPGVIVIDKKGSKIIPIIGAHQSNIQNIAFQICNLFGGEIIETNNSIDQNYLNIDSFGNQWGWKR----SGDIKDWSKLVINKKEIFCSQ---LSGNNLWKTSEVGNTITQLSDKDYEQKKSIFHISIFDNHKNT-------WHPPTLWIGLGCERNT-SKELIEDSLQSFLATNNLSPLSIAGFATVDLKKDEKAILEISKEKNLPFFTSEELSSINTPNPSNVVLNEIGTPSVAEASCMIAAGQGSKLLKEKKIFKIAVSESKNQYSPLTGEIHVVGSGPGDISYLTNDARKALSKCSIWIGYKMYL-DLIKPLKRKDQVMIESNLTEEKERCEKAIKLAEEGIKVALISSGDAGFYGMAGLLLELIQKIRPSFEVHPGISSMQLAAAIGGAPLM----NDFCSISLSDKLTPWETIERIAGALLGDFVIAIFNPQSQLKRAIELCLGYRPGNTPVLVGRQVGRENQSKSFFSLDSIP----LQDIDMLSIIIIGNSTTLVDEI--FLTPRGY..... 603
146 0.000e+00UniRef50_C4WKT1 Precorrin-3B C17-methyltransferase n=682 Tax=Proteobacteria TaxID=1224 RepID=C4WKT1_9RHIZ  ali  20  5MTPAILVLGEAAVPTAQRIAMALERAEILQSRVASVDNTFVHFGDAIRSLYEEGRPIIALCAAGIVIRTLAPLLENKRIEPPVLAVAEDGSAVVPLLGG-LSGVNDMARQVAAALEVAPAITTSGELRFGINLLHPPAELTL----ANPDDAKSFMSNLLAGQKLRLEGQSRWLAQSKLPF----------------ADDGALTISITPHNCVPRP-DALIYHPRSVAIAVDMVR-----ENLQANVEHALNRAGIARQSLALLLADEKDCAASELHEAARMLGIPLRFAA----------DAAHARELVLRSVEQPIELIEDDGLAIAVA-------PTPADVLFVGRKRGKLVVIGLGPGSRSLMTPAVQHELEQAEDILGYETYVAEENLRPFRPDQTIHMTDNREEMQRARHAFELAASGRHVVMVSSGDPGVFAMAAAVVEALHEHGVELVIQPGISAAMAAASRIGAPLGH----DFCIISLSDNLKPWEVIERLALAAEADLAMAFYNPISRLGRALEILRQYRSPETPVVLGRDIGRPAETTRTTTLGAL----TPEDVDMRTVVIVGSSHTQRDGCEWVYTPRWY..... 566
147 0.000e+00UniRef50_L7FED6 Precorrin-3B C(17)-methyltransferase n=76 Tax=Actinobacteria TaxID=201174 RepID=L7FED6_9ACTN  ali  26  23................................PDRTRVYEGPVADAVRRAFGECTQLVCFLATGAVVRLVAPLLSDKASDPGVVCVDEGGRFAVSLVGGHGGGANELALAVGRLLGAEPVVTTATDAVGVPGLDTLGM--------PVEGDVAGVSRALLDGEPVALELELSWPLP-----ALPANVGSAVPGDGP-------TIRVTDRLIAGAGAGAVVLRPPSLVVGVGASKGA-PVDEVLGLVQGALADAGLSVASVAALATVDAKADEPGIVGAAERLGVPVYSADELAGVEVPNPSAAPLAAVGTPSVAEAAALVGGGELLVPKRKSERADGAPAMATCVRRPGRGRLAVVGLGPGARDLLTPRAEAELRRASVLVGLDQYV-DQIRDLLRPGTRILESGLGAEEERARTAVAEARKGQAVTLIGSGDAGVYAMASPALAE-ASDDIDXXXXXXXXXXXXXXXXXXXXXGH----DHVSISLSDLHTPWHVIERRVAAAEADIVVTFYNPRSRLPKALAILGAHREPTTPVGVVRNASRPDESSRVTTLAGL----DPATVDMMTVVTVGNTAT-RNIAGRMVTPRGY..... 566
148 0.000e+00UniRef50_A0A076K792 Precorrin-3B C(17)-methyltransferase CobJ n=115 Tax=Proteobacteria TaxID=1224 RepID=A0A076K792_9RHOB  ali  22  7....VLALNASGLAVAQSIAQALDAPLHGRRGRVGADAFFDNALDHARDLFAAGTPIVGVCASGILIRAVAPLLSDKTQEPPVVSVADDGSVVVPLLGGHR-GANRLARKIAEALDSTAAVTTAGDVSLGVSLDEPPE--GWALAN--PQDAKGAM----------------AALLSGGGAALLGAEAAQAAWLADMPAGDAVKLSCDMTPQSDLGPHHLQFAPKRVTIGVGCARDCPPQE-LADLVHTALNEAGVCDAAVHSINTISLKADEPAILELARQLNAPLFSAEALEAETPRTPSDVVFAEVGCHGVSEGAALQLGSEGKLWMQKRKTAHATVALGLADRPAARGRLSVVGIGPGQAAWRTPEVSRLIADAQELVGYGLYI--DLLGPLAAGKERSDFPLGGEEARCRYALEQAGLGKNVALVCSGDAGIYAMGALVFELLDARRVDVVCSPGVSALQGAAARAGAPLGH----DFCTISLSDLLTPRADILRLQAAAEGDFVIAFYNPVSKLSEARDILLQHRPADTPVMLASSLGRPEEHIRYRRLEDL----QVDEVDMLTVVLIGSSNSRLAQLGRMFTPRGY..... 596
149 0.000e+00UniRef50_A0A1Z8UI07 Precorrin-3B C(17)-methyltransferase n=2 Tax=SAR116 cluster TaxID=62654 RepID=A0A1Z8UI07_9PROT  ali  22  7....IISLTRHGADLARKLVAAHAKSDSFDTDPIMPHHVFENTVTHIQDSFAVKMPIIGICSAGILIRAVANQLNDKWVEPPVIAIADDGSSVIPLLGGHHGG-NALARLLAVTTGGMAAISTAGDIRLGVSLDQPPQPFIL----ANPKAAASVMARLNDGASFRVASDLPD----YLSGVVDMWHRWLEPMPATGAADAADAADISHPDPDPASPDHLVYHPRLASLGVGASRGC-PVAEMQMLVASLMADHDLSPHIIAGVYSVDLKADEPAVLKMADQLSVPFYSAKLLDQETPREPSQVVFDEIGTHSVAEASALAAAGTSAVMIAGKRKTAHATAALAITPDITPDMITLVGIGPGQSAWRTPEATQMIRMADELVGYHLYI--DLLGHIAADKPRADYALGQEEDRCRYALEEAAKGRNIAMICSGDAGIYAMGALVFELLDARRVEVCSAPGVSALQAAAARSGALLGH----DFCTISLSDLLTPWEHIERIHGAAEGDFVIAFYNPVSRLAKAKAILLRHRPASTPVVLASNLGRPDEQVHVRTLAELSVD----EVDMLTVVMVGSSASRRGTGQAVYTPRGY..... 629
150 0.000e+00UniRef50_A0A2D7FEM3 Precorrin-3B C(17)-methyltransferase n=4 Tax=Hyphomicrobiaceae TaxID=45401 RepID=A0A2D7FEM3_9RHIZ  ali  22  5..TAIIXLGPSGXETARSIAAXXPXSHGYAKRVQSADVLFEXPMHHIXSCFXNGXPIIGVCAXGILIRAVASALSDKREEPPVIAAAEDGSSVVPLLGGHH-GANELARELATAIEAHPAITTAGDVSLGIALDAPPSGWHL----ANPEDAKDVTARLLAGEPVSVDDKLDWLDATDLKTDNDAQLKLRATIKADSTNAGE-----------------LLYTPRKVVIGVGSDRHCPPGDLIE-LVEQQLEHENLCXSSVACIVSLDRKADEPAMHALAKHLSVPFLSADAINAVANPNPSEVVQREVGVPGVAEGAALAATNANTLVSEKAKSARCTCAIAVADHIVDPNHLSVIGIGPGQQEWRSGEAEKLLRNASDWVGYGLYL--DLVEDLRNEQQEHRFXLGAEELRVRHALELAGQGRDVALICSGDAGIYAMAALVFEVLAARRVXVTVAPGISAVQAAAARAGAPIGH----DFCLISLSDLLTPWHAIERVQAAAXGDFVVAFYNPRSQLDKAIAILKSERPSTTPVIIASNLGRPAEKHQVVPISEF----DAEQVDMLSIVVVGASTTQSDGKTHVFTPRGY..... 597
151 0.000e+00UniRef50_A0A2E7VDT7 Precorrin-3B C(17)-methyltransferase n=12 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E7VDT7_9PROT  ali  22  4..TVVVVVSWSGLKTAMLLADHL-KCEIHG-RFSECDLIVDDFKAHLNDLFKDKATIVFVGALGILIRLLASSIREKSAEGAVVVVAEDGTSVIPTLGGHD-GANELSLKLADLLGIRAAITTASDLHYNVALDAPPKQFHL----ANKRDYKSFMSKLLSGDEVSLQGYLPWLTSSDLPINH----------------SGKLKICSSHFAEEGSSSR-LIYNYECLALGVGCERGT-SVNEVITLVQNTIEANKISKESIAVVASIEQKMDETAINAVAEFFNIRFFDPDTLEKETPRNPSNIVFKEVGCHGVAEGSALAAAGADKSRRATCAIAKSKTIIDPTFIGQPRGTLIVVGLGPGKTEWLTPEAKNHIEAASDIVGYSLYL--DLLGELTNDKTTHAFNLGEEQQRAIXALNLASKGKIVALVSSGXPGIYAMASLVFDYIRWKRIEIIVSPGISALQACAALVGAPIGH----DFCAISLSDLLTPWXVIERLRKACEGDFVIALYNPTSNFQTALDLLKEYYEPATPVAIGKSIGRPAEKLITTNLINL----DKEEIDMLSIIIIGNSQTKIID-GKMFTPRGY..... 583
152 0.000e+00UniRef50_A0A1Y3JZZ8 Precorrin-3B C(17)-methyltransferase n=6 Tax=Prochloraceae TaxID=1213 RepID=A0A1Y3JZZ8_9PROC  ali  20  1MKRIAIGLSNNSKEILKRLKKANFVKDIYISGSSNDDEESNELREILIKKWPEIDLIIFIGSIAASIRIINSFLTSKDKDPGVIVIDNKCSKIVPLIGLHQSNSQNIAYQIANLLGGEIIETNNSNDQSFLNLDSFGNQWGWKR----SGNIKDWSKLVIKQAKNEEIFCKQLSGNSLWKNS--ESGEIINQINEKEIDKPDSTFHVSIFENRETT-----WHPPVLWIGIGCERNT-SKELIANSLNNILESRNLSKYSIAGLATVDIKKDEKGILELAEELPVKFFSKEDLSTIIVPNPSSVVKKEIGTPSVAEASCLFAAGEESILLEEKRIFKNQSAESKNQYNPTHGEIHIIGSGPGDISFLTNNAKKALSRCTIWIGYKMYL-DLIQSLKRSDQVLIESKLTEEKERCSKAIKLAEEGIKVALISSGESGFYGMAGLLLELLQEYRPYFEVHPGISSVQLAAAISGAPLM----NDFCSVSLSDKLTPWSLIERIQGALLGDFVIALFNPQSQLKSVIEVCLQSRHGDTPVLIARQVGRENQTKKFFTLNTIPFK----EIDMLSIIIIGNSTTLVDEI--FLTPRGY..... 597
153 0.000e+00UniRef50_A0A2N9BHA4 Cobalt-precorrin-3B C(17)-methyltransferase n=80 Tax=Actinobacteria TaxID=201174 RepID=A0A2N9BHA4_STRCX  ali  25  23................................PDRTRVYEGPVGDAVRAAFAQCEQLVCFLATGAVVRLVAPLLSGKTADPGVVCVDEGGRFAVSLVGGHAGGANELAREVGELLGAEPVVTTATDAVDLPGLDTL----GLPVE----GDVAGVSRALLDGEAVALRAEVAWPLPAL-----------------PVAAEGACTIRLTDRLVEVAERE-VVLRPPSLVVGVGASKGA-PAEEVLGLVEGTLREAGLSAASVAELATVDAKAEEPGIVEAARRLGVPLYPAGELAGVDVPNPSDAPLTAVGTPSVAEAAALVRGGELLVPKRK-SAASPAMATCAVVRRPGRGRLAVVGLGPGARDLLTPRAKAELRRASVLVGLDQYV-DQIRDLLRPGTRILESGLGAEEERARTAVEEAREGRAVALIGSGDAGVYAMASPALAE-ASDDIDXXXXXXXXXXXXXXXXXXXXXGH----DHVSISLSDLHTPWEVIERVRAAAEADIVVTFYNPRSRLPKALGILAEHRAPTTPVGVVRNASRPDESARLTTLAAL----DPATVDMMTVVTVGNTAT-REIAGRMVTPRGY..... 553
154 0.000e+00UniRef50_A0A2E4GFQ8 Precorrin-3B C(17)-methyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2E4GFQ8_9GAMM  ali  20  10..LTIIALTKPAVLIAREIQAAFKSAQVFCPHDVAGEVTFEKLGPILRTLYTQGRPIVGVCASGILIRTLAPVILNKVEEPPVIAVSLDKSYVIPLLGGHR-GANKISHFIASALKGVMVSTTSSETITGFALDDPPK--GWVLSPK--SNTKSVSKSLINGKPVRLKIEAGDGSWLNKSNLWNKTGMTQVTLSDLSNAKGDVII-----------------RPKTLVIGVGCERGAI-AENLILLAEDMIKTNNLAKESIACIASIDLKADEEAMRAISGHFGVRLFDSNKLKQETPRNPSDIVYREVGCYGVAEGASILVAEKRKGIGVTCAIARASDAIDIENVGQGLGKLTIVGIGPGHKDWLTPAVFKALIEAKHHVGYSLYL--DLISGLGKYAKSHTFPLGSETERAKAALDLASASEDTVLVCSGDSGVYGMASLVFELMDHQRVEVIVEPGISAMQAAAARSGAPLGH----DFCAISLSDLLTPWSAIQRLEAAAEADFVISLYNPAGKLEKALKIIENYRDTSCPVVVGRCVGRENEKMELCNLGSL----NLNDXDMFTVIIIGNSETRSSGRSFVYTPRGY..... 597
155 0.000e+00UniRef50_A0A2E5P9E9 Precorrin-3B C(17)-methyltransferase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E5P9E9_9PROT  ali  23  3.RPAIILLGSSGLETAKRAVEVFPGAELYAKRVDQADVHFDDIARHXXXXXXXXXXXXXXXXXXXXXRCLAPHLSDKRTEPPVVALAEDSSHVVPLLGGHR-GANRMARQLAEALGGVAAITTAGDVGLGFSLDDPPE--GLQLEPG--SAVKKVMAALLAGDAVAL-DDAHGLGDWLREAPV------------RFEADAPLRIAISECADQRGD---VTLRPSTLAVGIGCERGTEAAE-IAALLDQTLDAAGLSPLSIACLASIDVKMDEPGLYAEAQERGLPFFDAKRLEEETPRLPSDVVFRAVGCHGVAEAAALACTGDGKLIVAKSKSTRATCAVARACRHIHPKNITIVGLGPGAAEWRTPAASVALSRARDVVGYGAYF--DLAKPLLPDVVRHEFDLGEEELRVRAALDLAAQGREVALISSGDAGIYGMASLAFELVDEVGLPILVEPGISALQAAAARVGAPLGH----DFCAISLSDLLTPWAVIERLRAAAATDFVTALYNPASKLVRAVKIFAAERPADCPVVVARNLGRAEEHVKIINLDNF----EPNSIDMLTLVVIGGRKSRAGDGRRVYTPRGY..... 592
156 0.000e+00UniRef50_A5UQU1 Precorrin-3 methyltransferase / precorrin-2 dehydrogenase n=2 Tax=Roseiflexus TaxID=120961 RepID=A5UQU1_ROSS1  ali  23  5..TVIIAVTRAGTRLAARLAAELRAAAHFAAEAPYATPYTAALLDEVRTCWGDYRXXXXXXXXXXXXXXXXXXXXRKTIDPAVVVLDESGRFVIPLLGGHQAGANDLARRIAAITGGQAAITTASDTRGLPALDLLGRDRGWQI--ADDSALTHTMACLVNGDLVGCFVDPALPDARRLQGADCPNLEYVDDPASLTDPRFAAALLVTHRRIDDLWEKSVRYLPPVLIVGIGCRRGV-SVDELHDALRTTLADAGLDEQCVGALATADIKADEPGLVEIAGRLNVPLHSRSEITALDARFSPSAAVTHFDLPGVAEPCAMIAGGGDLLVPKRAFRRCTVAVALRNDTPYQPSNVTLVGIGPGDLGHLTYAAHAALRDADVVAGYRVYI-DLIRPLLQPWQEVIVTPMGDEIGRARQAIAVARSGRRVALISSGDIGIYAMAAPVFEILRDEGWAVDVVPGISAFQALAARLGAPIGH----DMCIISLSDLLTPWDVIERLRAAAQADFIVALYNPRSRLDAALNIMRTHRPPTTPVAFGRNVSRADERITLTTLA----AADPSCADMFTVVLIGNSQSYILG-NRMATPRGY..... 622
157 0.000e+00UniRef50_W4M919 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Entotheonella gemina TaxID=1429439 RepID=W4M919_9BACT  ali  37  1.....................................................................................................................TPVITTASDVIGSLSPDLLTETLGWIPEPD--TNLKAAAAALVNGEPVAIVQEIGTVGSWLNQWGLPDHVQVAYQAAQLPAQRFRQAWWITDRVDDALHEQTMWFRPQSLVLGVGCERGI-PLAALEDGLNLFLHEHGLAKASITALASLDLKTDEAAIVDLAQQHGWQFYSAEELAQVPGQRPSQVVEACVGTPGVSEPAALKAAKTEQLLVEKQVITSAQSDKRMTFRTQTTGQLTFIGAGPGDPDLLTVKARRVIEQADVVIYAGSLIPEAILQHAPPTATLHNSAPMTLEDVMSLMMEAVQAGKSVVRLQSGDLSLYSAMQEQMAQLDDANITYDIIPGVSAFQAAAAALRSELTIPEETQTIVLTRGEGQTPMPAGESLTALAAHRASLCIFLSARLSRKVQDQLLTAYAPETPVGILYRVSWPDELIVVTELQHLHRTIREHKLTRTTLILVSEAIGARQNRSRLYHTTHAHIFRR 498
158 0.000e+00UniRef50_A0A1Z4R0L6 Cobalamin biosynthesis precorrin-3 methylase n=2 Tax=Nostocales TaxID=1161 RepID=A0A1Z4R0L6_9CYAN  ali  19  8....VVVLGNNSIPVAKKIISVIPGAKLYGLAETDVDVNFTDFGTTLRELFADGTPIIGICATGILIRTLAPLLTNKRQEPPVLAVAEDGSAIVPLLGG-LNGVNNLARQIATVFNIKAAITTTGEIRFGIALEDPPPGYHL----SNPSDAKAFMSDLLAGNSVRLEGNPLWLNW-------------LKSSSLPIDSNAERVIQITEKNVASTPTH-LIYHPQAIAIGVSIHEQRDFSESPIPLIQQILADAELSPASIAGVFASQVDAAQPEIQVIADALNVRFLAPDELSKVM----SRHQTSDVAVAVALAASQGQIIMQRQVLNITCAIAISDLPIDIKTTGKTRGRLAIIGTGPGRSDWMSPEVKDILRNATDLVGYSTYLK--LIAAVTPGKHLHESDNREEIARASLALDLAAEGRFVAVVSSGDPGIYAMAAAVFEAWEKEGIDIHVAPGISAMQAAAAKIGAPLGH----DFCAISLSDILKPWSIIERITAAAQGDFVIALYNPISQLSETKKILLNYRSPHTTVVLARNIGRDGESIKVCTLAELSPEFA----DMRTVIIIGSVIEKPDGGIWVYTPRRY..... 586
159 0.000e+00UniRef50_A5GW04 Bifunctional protein CbiG/CobJ (cobalamin biosynthesis protein and precorrin-3B C17-methyltransferase) n=49 Tax=Cyanobacteria TaxID=1  ali  23  1MKRLGLCASQAGLKLAGELDAIAVPAGLLNAQRPELIRHTDGPKGLLQEHWGELELLVGALAAGALVRLVAPLLQHKLHDPAVLLVAAEGPTLLALLGGHSQQADTLAEQLAPLLQANVIQSGFSSSQGLPALDSLGEAWGWRRGSGNWDALMHRAA---RSEPLSLEVGAGQLSDWLLASELP----------LARASSSAADLCISSST-----GAGCRWHPPVLWLGVGCERG-SSLELLRQAVDGALQTAELAAEAVAGLASIDVKNDEPALQVLASERNWPFFSADELKAQSVPNPSAVVAAEVGCPSVAEAAALCAAGSGAELRLEKQISRGQPAAAPQPWAPQRGHLHLIGAGPGALNQLTPAAQQALASSSAWVGYGLYL-DLLEPLRRADQVRFDGQLTKEKERCQQALELARQGVVVALISSGESGMYGMAGEQWLALAQEQPNFSVHPGISAFQMAAARLGAPLMH----DLCTISLSDRLTPWELIERLKAAAQGDFVVALYNPRSRLGRAVELLLEHRPANTPAAICRQLSRSDEALQIHPLAELPLEA----VDMFSLVLIGNSTTRFEHGQ-MVTPRGYPG... 596
160 0.000e+00UniRef50_A0A2P9EYL0 Cobalt-precorrin-3B C(17)-methyltransferase n=8 Tax=Streptomyces TaxID=1883 RepID=A0A2P9EYL0_9ACTN  ali  26  16................QRLASAWPERT---------RVYEGPVRDAVGRAFGECEQVVCFLATGAVVRLIAPLLADKGTDPGVVCVDEGGRFAVSLVGGHAGGANALAVEVGEVLGAEPVVTTATDAVGVPGLDTLGM--------PVEGDVARVSRALLDGEDMELDLEIAWPLPALPPNVRRPGP-------DAPAERGGPAIVVTDRVLDAGGRPTVLLRPPSLVVGVGASRGA-PADEVLGLIENALRDAGLSPRSLAELATVDAKADEPGLVEAAARLGVPLHSAEELAAVEVPNPSDAPLAAVGTPSVAEAAALVAGGELLVPKRKSERADGRPAMATCVRRPARGRLAVVGLGPGARDLLTPRAKAELRRASVLVGLDQYV-DQIRDLLRPGTRILESGLGAEEERARTAVAEARRGQAVALIGSGDAGVYAMASPALAE-ASDDIDXXXXXXXXXXXXXXXXXXXXXGH----DHVSISLSDLHTPWEVIERVRAAAEADIVVTFYNPRSRLPKALAILAGHREPTTPVGVVRNASRPDGSHRLTTLAAL----DPATVDMMTVVTVGNTAT-REIAGRMVTPRGY..... 571
161 0.000e+00UniRef50_A0A2N5XW24 Precorrin-3B C(17)-methyltransferase n=18 Tax=Bacteria TaxID=2 RepID=A0A2N5XW24_9RHIZ  ali  23  5..IAIVCPSKAAIRLANQIKSVLVEVVHAKSDVTDADVPFTDTISHIRDLFTGGKDIVALCASGIVIRALAPVLDSKFNEPAVLAVSRDALSVVPLLGGHH-GANDLARLIAKGLDAHAAVTTAGDCRFRLALDNPPA--GWKLQNPRSAG--PVMAKIVDGTAVQVDDSLDWIKDGKLVISNEADIKLISSIEMASPEKSE---------------TALVYSPQRLAVGVGCERGVSP-DHLIAHIEATLASANLSREAIGMIASVDLKMDEAAIHHAAAHFGVRFFSVSELEAQKDKTPSDVVFAEVGCHGVAEGAALAAAAKVKSDKATCAIGLAAEPFSSALPGQKRGHLSVVGIGPGQSEWRTPEASNRIAEAEELVGYGLYI--DLLGSLADGKTRSDFPLGGEEDRCRYALEQAGKGHNVALICSGDAGIYAMGALVMELLDAKRIELTHVPGVSALQAASARFGALLGH----DFCTISLSDLLTPWETIVRLEAAAQGDFVVAFYNPVSQLARAKEILLAHRPPETPVLLASNLGRETENLRIRTLSEL----EVDEVDMLTVVLVGSSQSR.................. 586
162 0.000e+00UniRef50_A0A1D2IDK3 Cobalt-precorrin-3B C(17)-methyltransferase n=24 Tax=Actinobacteria TaxID=201174 RepID=A0A1D2IDK3_9ACTN  ali  26  23................................PDRTRVYEGPVGDAVRAAFAQCERIVCFLATGAVVRLVAPLLEDKASDPGVVCVDEAGRFAVSLVGGHGGGANELAREVGEVLGAEPVVTTATDAVGLAGLDTL----GLPVE----GDVAAVSRALLDGEAVALRADVTWPLPPL-----------------PLSGEGAYTVRLTDRVV-GPRAGEVVLRPPTLVVGVGASRGA-PAEEVLALVEGALRDAGLSAASLARLATVDTKAGEPGIVEAARRLAVPLYAAEELARVGVPNPSGAPLAAVGTPSVAEAAALAGGGELLVPKRKSERGDGRPAMATCVRRPGRGRLAVVGLGPGARDLLTPRAKAELRGASVLVGLDQYV-DQIRDLLRPGTLVLESGLGAEEERARTAVEQARRGRAVALVGSGDAGVYAMASPALAE-ASDDIDVVGVPGVTAALAAGAVLGAPLGH----DHVSISLSDLHTPWEVIERVRASAEADLVVTFYNPRSRLPKALAILAEHRRPTTPVGVVRNASRPDESSRLTTLAAL----DPVTVDMMTVVTVGNTAT-REVAGRMVTPRGY..... 556
163 0.000e+00UniRef50_A0A1G5AKM0 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=7 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1G5AKM0_9FIRM :_  ali  22  15....VISFTSRGKELADRLLSLIEESGIGKGERYKESSDRENLDGFVKENFYQGNVLIFIGAAGIAVRAIAPYIEDKTKDPAVIVMDEAGKNVIPLLSGHIGGGVREAEKIANLIGANCVITTASDVSGEFAVDVFASENGFVI--SDMKKVKEFTARLLEEKEAVYEVDAEIAGMPSSDAKDTDNAELDESAKETDIEKSKACFTISFRK-DKSESGVLNLIPKCIVIGVGCKKGT-PYEKLLAFVEDKLSEHNIDKRAVSVLASADIKKEEEGLIRVAKGLGAEFFSSDVLMAQEGEFTSEFVKSITGADNVCERAVAACGCKKILVTKESFDGMTFAAGVMENSKVMSQGTECVGIGPGNYENMTIKAVQTLKACDVIAGYTVYC--DLVRPFFPDKEYISTPMMGEEKRVKLAYEKAAEGKKVALVCSGDAGVYGMAGEEAVNFD--NVDTEXX----XXXXXXXXXXXXXXXXXXHDFCLISMSDRLTPMELIERLRAAASADMVVVIYNPESKLAHACEILMENLPPERVCGIAGNIGRDGEYCKVMTLGEL----KGAEVDMFSTIFIGNSST-RDIAEHMVTLRGY..... 669
164 0.000e+00UniRef50_A0A2E3S1Q4 Precorrin-3B C(17)-methyltransferase n=2 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E3S1Q4_9PROT  ali  22  10...AIVAISNSALPIARKLAGSLPMSEVHLGRVDEADILFENTSSHLQALFQRAQPIIGLCGSGILIRALAPLLVQKSLEPPVIAVAHDGSIAVPLLGSHRGG-NRIATEISNILNSTIAITTASETQFGIALDDPPSGYHLQ----NPQDLKHFTAQLLSGSQIR-----------------PANLPRWITTGSPPVSEYGTLQIVSGIEKKSGGPNQLIFTEEVLALGVGCERNCDP-EELQSLIETTFNKGNISLSAIAVIVSLDLKCNEPAILKLGTTLPVRFFDATRLESERGRNPSDTVFQAVGCHGVAEPAALTAAGKQKSDRATCAIARSIEPIDTTDLGRSRGRLAVVGLGPGSTXWRTLEAETLLAQSTDIVGYSGYLDQL--GPALKTKTLHGFPLGKEIERVNAALDLAAEGRIVSLVSSGDPGIYAMGALVFETVHKRWVDINISPGISALQAAAARIGAPLGH----DFCAISLSDLLTPSCQIKRLKAAASSDFVIALYNPASNLMSALKILSKYRTLDTPLIIARQLGRPQETIHISTL----EKIDPSKIDMFTVLLVGSNQTRGSGLERVYTPRGY..... 597
165 0.000e+00UniRef50_M6UY13 Cobalamin biosynthesis protein, N-terminal / cobalamin biosynthesis protein, C-terminal / precorrin-3B C(17)-methyltransferase multi-  ali  21  11..........................QVHSGSAAKLQPLSLPMDQTLREIFREYDCHIFIISVGAVVRMIVPLLENKKVDPAVLCVDDRANFSICVLSGHVGRGNFFTEKLAQTLSNIPVITTASDVSGTLTVDILGRGLGWTLEHPDR-NVTRGCAAVVNEARVLFVQETREPNWWPLDKNLPKGVEYSISLNQIRPKDYEILLISMDRNNPKHYNNYILYHTKSLILGLGCDQNI-PLETAENKIYKVLNENGLAIQSVKAIDSVDLKKDEPAFLSLFLKYDWELFSPEELDRVSIQSPSKVVKNFVGTKSVTKPQAFSRPVQPPFWSQNRNIRNHQTVKSHDCNFMQIGRLNIVGIRPGNDTHITPAVLQAIQEADLVIGYATYIG--LVKHHLVGKQVTQTEMTEEVGRAQTAIDAAKEEKIVTLISSGDAGVYGMAGLVFEVLQKTGWEIKMIPGITADSSCASLIGAPLVH----DTAKISLSDLLTPWSVIERLECAAKGDFVITLYNAASQIVEAMKIIKRHRPGTAPVASIKSAYRKQQNVQLSDLDNFLD----YEIGMNTTIIVGSSNTFVYE-DFMITPRGY..... 610
166 0.000e+00UniRef50_A0A2A4YWE6 Precorrin-3B C(17)-methyltransferase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A4YWE6_9PROT  ali  22  3.KIAYIALSPNGVEIAGKLQNHFGG-EIFTK-------TDGSVTAKIADLFAQKCVVIGICSAAILIRSIATKLDNKHNEPPVIAIDDLGQNIIPLIGGHLGSAVEIAKKCAEILGADAIITTAGDANFNIALDNPP--NGYVLTN--PQNYKAFMGQLLQQQKINF----------------PQNNAWLTTSKLPFDTDAELKISISNQTVSGSETQ-LIYCPQDIVVGVGCARGADAGELI-SLIEAELDARKINPNAIAYIASIDVKSDETGIHDVAKYFGVEFFSATTLEAQADRNPSEYVYEQVGCHGVSEGAALAAAGDDSKLICPKCAIAQSAQAITEFGGNLQGQLHIVGMGPGQDSWRVPEATAMLEAAQDWVGYGLYI--DLLGAMGAGKTHHEFALGEEEKRVRFALELAAQGKQVALICSGDAGIYAMAALVYELLDAKRVNVQMAPGISALQGAAARVGAPLGH----DFCTISLSDLLTPWEAIERIHAAXEADFVISFYNPVSQLAYAKQVLLQHRPDGCPVILATNIGRPTEYIRYVNLIDLNID----DVDMLTLVMVGSSNSRGNGQEYVYTPRGY..... 592
167 0.000e+00UniRef50_A0A177HQF5 Cobalt-precorrin-3B C(17)-methyltransferase n=180 Tax=Actinobacteria TaxID=201174 RepID=A0A177HQF5_9ACTN  ali  25  2..IGLISATAAGAAGCERLAAAWPGRT---------RVYDGAVGDAVRRAFGECEQLVCFLATGAVVRLVAPLLGDKASDPGVVCVDEAGRFAVSLLGGHGGGANELAREVGEVLGAEPVVTTATDSVGVPGLDTLGFPF--------EGDVAGVTRALLDGEAVALQAEVAWPLPALPEEYPPSWVVPTLPQALGSARAGGTPICVTDRLIEPADGQ-VILRPPSLVIGIGASKGA-PADEVLDLIHTALRDAGLSSLSIAELATVDAKAGEPGIVEAARRLGVPVYGAEELAAVDVPNPSGAPLAAVGTPSVAEAAALVRGGELLVPKRKSSRSDGRPAMATCVRRPARGRLAVVGLGPGARDLLTPRAKDELRRASVLVGLDQYV-DQIRDLLRPGTRILESGLGAEEERARTAVAEARRGQAVALIGSGDAGVYAMASPALAE-ASDDIDXXXXXXXXXXXXXXXXXXXXXGH----DHASISLSDLHTPWEVIERVRAAAEADIVVTFYNPRSRLPKALAILAEHREPTTPVGVVRNASRADESSRLTTLAEL----DPATVDMMTVVTVGNTAT-REIAGRMVTPRGY..... 589
168 0.000e+00UniRef50_A0A0C2L6M3 Precorrin-3B C17-methyltransferase n=3 Tax=Nostocales TaxID=1161 RepID=A0A0C2L6M3_9CYAN  ali  20  7...AVVMLGQNSISVAKKIISVLPGAQLYAGRTSDVDVTFTEFGTTLRELFANGTPIIGICATGILIRTLAPLLANKRQEPPVLAVAEDGSAVVPLLGG-LNGVNNLARQIASVLDVKPAITTTGDIRFGIALEDPPVGYRL----ANPEYAKSFMSDLLAGHSVRLEGDAPWLRNSSLPI----------------DQNAERVIQITEKPVVSTSTR-LVYHPATVAIGVGRGRGWGSEE--IALVQQMLADAELAPASIAGVFASTLDAANPALQAIADALNVPFFTTDEIAAAMSQNNTADGAVAIALAASSGRLVM----QRQLSDFNCAIALAPLPIDINTTGKPRGRLAIIGTGPGASDWMSPEVKEILRNATDLVGYSTYLG--LLGFLGNDKRRHESDNREELARARMALDLAAEGRFVAVVSSGDPGIYAMAAAVFEVFDREGIEIQVAPGISAMQAAAAKIGAPLGH----DFCAISLSDILKPWSIIERITAAAQADFVIAFYNPVSQLAETRNILLRYRHPETTVVLARNLGRDGESVEVYTLEDLAPELA----DMRTVILVGSSIQRCDGSVWVYTPRRY..... 593
169 0.000e+00UniRef50_UPI000690C1D7 precorrin-3B C(17)-methyltransferase n=1 Tax=Thermopetrobacter sp. TC1 TaxID=1495045 RepID=UPI000690C1D7  ali  22  17....VLALHAGASEVAERAADIVNGTLALSPPRPA---------ESLRQAFRAGRPIIAVCAAGIVMRALAPLLTDKHQEPPVLILSEDGRFVIPLLGGHK-GANRLAQRIAKALQGEAVITTASDLHFNVALDDPPP--GWRLAN--PQDVKAFTAALLNGAGVRLEGEAPWLVRANLPWS----------------EQGPLRISATARAVEG-NSRHLVYHPRTLMIGAGCARGANP-EALVALAHAVLAEQGLAEGAVAAIGTLALKADEPALHALSAAFDAPLFDAHELAQVAVPNPSQAVRDAVETPSVAEAAALLLAGNEGRLIVEKQIDADQQTPPASLAGRERGRLFVVGIGPGDPRQRTHAAEEALLCAEHWVGYALYL--DLARDLARGKTLHPYPIGAEKARVRHALTLAAEGKTVALLCSGDAAIYAMASLVYETLAESGIEIEVIPGITALQMASARAGALIGH----DFCAISLSDLLTPWPVIRRIEAAAKADFVVAFYNPRSRLKEALNILRQWRPEETPVIIASNLGRAEEQVRIVPL----KAVNCADVDMLSIVLVGNSESRHAGAQRAFTPRGY..... 592
170 0.000e+00UniRef50_L1KJS0 Precorrin-3B C(17)-methyltransferase n=18 Tax=Actinobacteria TaxID=201174 RepID=L1KJS0_9ACTN  ali  26  16................QRLASAWPERT---------RVYEGPVRDAVRRAFGECEQLVCFLATGATVRVLAPLLADKATDPGVVCVDEGGRFAVSLIGGHGGGANELAREVGELLGAEPVITTATDAVGVPGLDTL----GLPVE----GDVAGVSRAVLDGEAVELDLEIGWPLP-----ALPSNVGHSASQRSRAPRQAPV-IRVTDRVLEPAEGQ-VVLRPPSLVVGVGASKGA-PVDEVLALVEKALHDAGLSPKSLAEIATVDAKADEPGIVEAAERLGVPLHSAEELAAVEVPNPSDAPLAAVGTPSVAEAAALVRGGELLVAKRKSERADGRPAMATCVRRPARGRLAVVGLGPGARDLLTPRAKAELQGASVLVGLDQYV-DQIRDLLRPGTRVLESGLGAEEERARTAVAQARKGYAVALIGSGDAGVYAMASPALAE-ASDDIDXXXXXXXXXXXXXXXXXXXXXGH----DHVSISLSDLHTPWEVIERVRAAAEADIVVTFYNPRSRLPKALAILAEHREPTTPVGVVRQASRPDESARVTTLAAL----DPATVDMMTVVTVGNTAS-RTIAGRMVTPRGY..... 567
171 0.000e+00UniRef50_A0A291GET9 Precorrin-3B C(17)-methyltransferase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A291GET9_9RHOB  ali  22  7....VVALSASGETTAAKIAAALGAELHGREGRTSAKISFPNALDHVRDLFAAGIPVIGVCASGILIRAVAPLLNDKTTEPPVISVSDDGSVVVPLLGGHR-GANRLAQQIAQLLDAKAAITTAGDVALGIALDEPP--LGYRLSNPE--NAKSAMAALLAGEGVSLEGE---------------------NIFELTDQGGEVVLSVTETPDAPGPKR-LVYHPQRYALGVGCARNADP-EELWQNVSDMLSDQEVALGAIASVNTIDLKADEPAMNVLATRLGVPLFTAAELEMQADRNPSEVVFAEVGCHGVAEGAALAAGGTLFAEKRKTANTTCALTRSEVPKGRARGRLSVVGIGPGQASWRTPEVSKLISEAEELVGYGLYI--DLLGSLAAGKIRSDFPLGGEEDRCRYALEQAAQGKNVALVCSGDAGIYAMGALVFELLAEHGVSVEVIPGVSALQGAAARAGAPLGH----DFCAISLSDLLTPRDDILRLKAAAEGDFVIAFYNPVSKLAEAREILLKHRPADTPVMLASNLGRSTEHVRYRRLDAL----EVDEVDMLTVVLVGSSNTRLAHLGRMFTPRGY..... 586
172 0.000e+00UniRef50_A0A0P1FDI0 Precorrin-3B C(17)-methyltransferase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0P1FDI0_THAGE  ali  23  25..................IGAALHGRE---GRVAHADAFFANALDHARDLFAAGVPVVGVCASGILIRAVAPLLSDKRAEPPVVSVSDDGSVVVPLLGGHR-GANRLAREIAQGVGAVAAVTTAGDVALGVALDEPP--LGYRLDN--PQDAKAAMAALLSGAGVSVTGE---------------------NVFGIEDSGGAVELVVSEAPEDASETR-LVYRPQRYALGLGCARNADP-EEMWALVCETLDKAGIAPAAVGCVASIDLKADEPAMNTVARRLGVPLFSAAELESQPVPNPSEVVFAEVGCHGVCEGAALACGGALVAQKAKTANCTCALSRVEEPITRARGRLSVVGIGPGQAAWRTPEVSRLIAEAEELVGYGLYI--DLLGPLAAGKTRSDFPLGGEEARCRYALERAAEGRNVALVCSGDAGIYAMAALVFELLDAHRIEVICSPGISALQGAAARAGAPLGH----DFCTISLSDLLTPRDDILRLKAAAEGDFVIAFYNPVSKLAEARDILLQHRPADTPVMLASSLGRAEERVRYRRLDQL----DVDEVDMLTLVLVGSSNSRLAQLGRMFTPRGY..... 585
173 0.000e+00UniRef50_A0A0U5B3A9 Precorrin-3B C17-methyltransferase n=1 Tax=Caldimicrobium thiodismutans TaxID=1653476 RepID=A0A0U5B3A9_9BACT  ali  24  9....IFYLSEEGKALAERISVFLEKAEIYKFDR--------ETKRDIKRHFKPEKVLIFIMALGIVARVCAGFIKNKDHDPGIIVIDETGNNVIAYLGGHYADINRITLEIASFLEAHPVITTASDNRGLPPLDNWIKELGFFIKNKDQLYV--IMSKFNEKGNLKVYLEEG------LNYPLSSKLERVSTPEEAD-------IVVSYKKQELENK--LILIPRCLYAGIGFH-EILTEEDFEELLKRTFEELSLEFKALKGIATLDKKAEYLPLKNFVLREGLDLFRKDELSEVEVISPSQSAKKALGIESVSEACALLVS-KGVLLYPKRIYKDFTIALA-LKPFQKVGKLYVVGIGPGSRDYLTLKALRVLTNVSAVVGYKSYIKQIL--PLIKTKEVYDFSMTQEIDRVKKAIELALAGKDTALVSGGDPGIYGMSGLVLEILHKNKLEVEIIPGISALNMGNALLGAPLG----NDFAVISLSDRLTPWEVIERLKRLSEIEIPLVIYNPRSQFERALQILRENKSPNTAVAIVNSASREGEEIIFSTLEKLS----SEKIGMNSLIIVGS...................... 553
174 0.000e+00UniRef50_A0A0F7PJP8 Precorrin-3B C17-methyltransferase n=33 Tax=root TaxID=1 RepID=A0A0F7PJP8_9RHIZ  ali  23  6...AIIILSEAALPIARRIARATGGEVHGLARRITEDVTFTDVGSHLAIQFLDGRPMIAVMAAGAVIRLLAPHLSDKMSEPPVIAVAEDGSAVVPLLGGHH-GANDLAREIADLVEGFAAITTAGDVKFGIALDQPPE--GWVLANPE--NAKQVMADLVAGKSARLEGEAGWLAGSGLPLS----------------ADGEVVLLASDKAVT-SPVNGLLYHPKNLVLGIGCERGAGGDEALALAL-ESLEQTGLSPASVGLVTSIDVKADEAAVHHVASHFGCPFFDAATL-EVETPHPSDIVFAEVGCHGVSEGAALVAVGSGELIAEKRKSRRATCAIGRAPEPFTRANLMVVGIGPGSDGWRSPEVSQMVATSTDLVGYSLYL--DLLGPLTKGKARHDFDLGKEEARVRHAMELAGEGKSVALVCSGDAGIYAMATLVFELLDKRRIEIAVSPGISALQAAAARAGAPLGH----DFCTISLSDLLTPWDDIKRRVTAAEGDFVIAFYNPVSQLAWARDKLLEHRPASTPVILATNLGREGELIRIVPLGALNVD----DVDMLTVVVVGSSVATGDGKNWVYTPRGY..... 599
175 0.000e+00UniRef50_U2S4C5 Precorrin-6y C5,15-methyltransferase (Decarboxylating), CbiE subunit / cobalamin biosynthesis protein, N-terminal / cobalamin biosynt  ali  22  244.....VCTTGRARANADRIDEALS----VVSKRYVGGAAAGLAAAW-----GECDLIVSHLALGATARMIAPFLADKRTDPGVVVVDEAGRFAIPLVGGHIGGANELARRIADGIGATAVVSTATDSLGLPALD----QLGWAV----SGDVAAVTGALLEGRPVDWVRERLWRVPPLPPREAPAAADGLDASDGPEGADGRARVVVTDGLEVPASGPTVVLRPDSLVVGMGCNRGTD-VEELRGLLEETLADAGLAVESVAALCSADVKVGERGLIRLAAELGVPYFDAATLDAQDAPTVSEVVRAEVGTGSVSEASVLAAGARLVVPKRKSRN-----ATCALGRIPARGVLHVVGLGPGSRDLLTPRARDAVRNANLVVGYGPYVRQ-IRDLVSPNADVLATRMGTEEQRTAAAIDAARRGLDVAFVCGGDPAIYAMASPTLEMGTD-GIDVDIVPGVTAELAVSGILGAPLGH----DHATISLSDLHTDWELIKRVRAAAEGDFVITFYNPRSRLPDALAIIAQHRGPDTPVACVAQAERPQQKVTMSTLAEF----RPEWVDMNTMVIVGSFVTSGDGRRMIVTPRDYH.... 824
176 0.000e+00UniRef50_A0A2E5C163 Precorrin-3B C(17)-methyltransferase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E5C163_9DELT  ali  23  5..IAVFCLGVSAFPVAKKIAKFL-DAELHGKRVSQADVFFTDAMEHLSKLFQDGIPIVGVCASAVLIRGVARSINDKRNEPALVAVAEDGSVVVPLLGGHH-GANNIARKISKLLGVDPAITTSGDIRFGISLDEPPEGFVL----ANPEDVKEFSASLLAGESLMIYSDENVLGNKNLGSDHKQVFYNWLKVSSLTFSSIDLRITLTSKTVSGNKEN-LVYHPKTISVGVGCERGTNK-EELISLVGSTLKKNKISHESVAAVVSIDLKSDEPAIHALSENLPARFFDAVELEEQKLQNPSLIVFKEVGCHGVAEGAALAASGKGKLVIPKIKSKHATCAIDPQKIGNSQGTLYIVGTGPGSPKWRLPESEEILKNSSDWVGYGLYL-DLIADLNKNGKEKHRLHKFQEEKRVRHALNLAAQGKTVALISSGDPEIYGMATLVFEMLESADIRILSTPGISAMQAAGALAGAPLGH----DFCSISLSDLLTPWDTIKRIIAAAKSDFVIAFYNPVSQLSQALDILLKHRSPDTPVIIAKNLGRIGELVNVVTLACI----DPSELNMLTIVIVGSSQSLPNGVIRVYTPRGYH.... 633
177 0.000e+00UniRef50_A0A1B3NVH6 Precorrin-3B C17-methyltransferase n=75 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1B3NVH6_9RHIZ  ali  21  10.KPVVVILSASAASLGRRIAADIGGELHGAAAREEADLRFASAKDHVQTLFAAGRPIIAVMAAGALIRLLAPLLSDKHAEPPVIVVAEDGSSVVPLLGGHH-GANDLARQIATAIGAHAAITTAGDLKFGLALDQPPEGYVLV----NPESAKLVMAELVAGASARLEGE---TAAWLTQSRLP------------FQQEARVTLSVTDQQKTAGELE-LVYHPKTLVLGMGCERHAKPEEAIALAEEAL-AKGGFARESLAAVCSIDLKADETAIHAVAAHFGVPFFSAAALEAEAPRNPSEVVFAEVGCHGVAEGAALAAVGASGELVVEKIKSKGATAAIARAADIIDPKTFVVGIGPGSEGWRSPEVSRMVAASTDLIGYSLYL--DLLGPLADGKTRHDFDLGKEEARVVHAMELAGEGKTVALVCSGDAGIYAMATLVFELFDKGGIEVQVSPGISALQAAAARIGAPLGH----DFCTISLSDLLTPWEHIQRVKAAGEGDFVIAFYNPVSQLAYARDELLKYRPATTPVILATNLGREGENVRTVPLGELNVD----DVDMLTVVVVGSSVTTGDGKTWVYTPRGY..... 600
178 0.000e+00UniRef50_UPI0004C54331 precorrin-3B C(17)-methyltransferase n=2 Tax=Streptomyces TaxID=1883 RepID=UPI0004C54331  ali  25  2..IGLISATAAGTAARDRLAAAWPDRT---------RVYEGPVGEAVRAAFAECEQLVCFLATGAVVRLLAPLLGDKAADPGVVSVDEGGRFAVSLLGGHGGGANALAHEVGELLGAEPVVTTATDAVGLPGLDTLGLPY--------EGAVAAVSRALLDGEPVALEAEVAWPLPPL-----------------PVASEGAYTIRVTDRAVEPGEREVL-LRPPTLVVGVGASRGAPEAEVL-GLVERTLAEAGLSVASVAELATVDAKAEEPGIVGAAARLGVPVYSAGELAGVAVPNPSDAPLAAVGTPSVAEAAALSRGGELLVPKRKSERADGRPAMATCVRRPGRGRLAVVGLGPGARDLLTPRAAAELRRASVLVGLDQYV-DQVRDLLRPGTRVLESGLGAEEERARTAVAQAREGRAVALIGSGDAGVYAMASPALAE-ASDDIDVVGVPGVTAALAAGAVLGAPLGH----DHVSISLSDLHTPWEVIERVRAAAEADLVVTFYNPRSRLPKALAVLAGHRDPATPVGVVRNASRPDESSRVTTLAGL----DPATVDMMTVVTVGNTAT-REIAGRMVTPRGY..... 556
179 0.000e+00UniRef50_UPI0009DCDA20 precorrin-3B C(17)-methyltransferase n=1 Tax=Lachnospiraceae bacterium AD3010 TaxID=1410621 RepID=UPI0009DCDA20  ali  25  10.KITVFSFSEKGNRVNLEIAELLSDAEVESSLQGEDK---GTLEERTEKAF-KGDAIIFIGAMGIAVRAIAPFIRKKTIDPAVIVIDELKQHVIPVLSGHIGGANDLAESLAGLLSAEAVITTATDINKVFAVDSFAKGKGIGIENPER--IKDVSSALLRNEEIG--------------------------------------VSISPY-LTDIFPKTLKLIPKCLCLGVGCRKGTE-YDKLKSFILAFLRDRNISLSAVSDIATIDIKRNEAAIKRFADEYNLRFFTAEELNQLEGFYESEFVLEKTGVSNVCERSALCPSGRVSLIERKEKAEGMTLADLCKTEAGRKGCIFVAGLGPGRADMLTPEGKRAICASDIIIGYRVYT--ELIKDLTEGKTVISSEMRKERERCEKAREYALKGNRVAVVCSGDAGIYGMAGLIFEVCNDPDIDITVIPGITAALAGGALLGSPLT----NDFSVISLSDHLTDKETIKRLRAAGASDIVTVLYNPKSRLREAVEILLEKLPPDRVCGYVKNIGREGETVKICTLKELPD----EDIDMFTTVFIGNS..................... 565
180 0.000e+00UniRef50_K9Z2W3 Precorrin-3 methyltransferase n=2 Tax=Cyanobacterium aponinum TaxID=379064 RepID=K9Z2W3_CYAAP  ali  22  46.................................LSANFYDSSLREHLVNIWSNSKCIVFCLTLGAVTRLIAPLLTNKKTDPAIIVIDPAFEYIICLTGEHQHQGDKLTEILAELLSAKAIITSASSNLNLPAIDSFGYTFGWK---KGEGDWTKVSANITQNKPTLIKQESGLNWWQNLPINHPEGIKDNSKEGEKREEDFQAMVYIGVNKTPRVDIPIVSWHPRGVWVGIGCERDTSPI-LIENAVNSVLAQYNLEKNAIASLATIDLKADEVGILELAQKWQLPLFTSEELNLIDVPNPSSIVEHEVGTKSVAEASALKAGSWSNLPENNFSPTLIAPALSNLEYNPRQGKLYLIGTGPGAIEYLTTAAKTALRDAEIIIGYGLYI-DLIKPLLHPSQIIETSNITQEKQRAERAIALAQWGLKVAVISSGDCGIYGMAGLVLEILANQNWPIQVFSGITAMQSVAAKIGSPLMH----DFCAISLSDLLTPWDVIERLHAAATGDFITAIYNPRSQTRQAQNIFLQYRSGNTPVAIARSVTREDESIILTTLEEMLN----HPIDMVTTVLIGNSSTKRYH-DLLITPRGY..... 647
181 0.000e+00UniRef50_UPI000694053C precorrin-3B C(17)-methyltransferase n=1 Tax=Tessaracoccus massiliensis TaxID=1522311 RepID=UPI000694053C  ali  25  224...............ARRHADAIDRALGIRSRRYDGVASEG-----LPRAWGECDLIVSHLATGATIRLIAGLLQDKAHDPGVVVVDEAGRFAVPIVGGHAGGANDLARRIGDALGATPVLTTATDALNLPALDTLGWPYH--------GDVAAVTQAIIDEAPVALIKERPWPLP-----ALPGNVT-------AEAENPVARIVVSQRAIAESSVPTVVLNPPSLVVGMGCNSGT-SREHLEALLHETLDGAGLAHDSVTAVVTHDVKAGELGLVQLVAKLGVPLYPPEELASFEVPTPSRTVESHVGTPSVSEAAVMARGAQLIVPKQRS-----TDATCAVGELPARGKLSVVGIGPGARDLLTPRAVRAVREATFLIGYGPYVRQ-VRDLARPGCDIAAKKMGTEEARTAEAIERARGGENVVLVCSGDPSIYAMASPTLEQ-GTMGIDVEMVPGITASLAASSILGAALGH----DHATISLSDLHTQWEAIERLQAAAEGDFVVALYNPRSHLPRALEILGAHRPPSTPVAVVRQAERPQQKATLSTLAEFS----PEMVDMNSIVIVGSSVASGGGELRFITPRDY..... 777
182 0.000e+00UniRef50_A0A023X237 Precorrin-3B C17-methyltransferase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A023X237_9ACTN  ali  26  3.RLALVAATENGRRSAAHLARVLPGAEVYG----------GPAKEALARAWREADGIVAFLAVGATARLVAPLLGDKRTDPGVVCVDDARRFAVALVGGHEGGANELARRVAETLGAEAVITTASDVTDHPALDAFGRDLGFKLERG--SDVASVASALVSGETVRLISEWRYPLGPLPENVVPG------------APQPGVPSVVVSDRTGPFPTPSVVYRPPTLVVGVGCSRWASEGE-ILDLVSRSLQDAGLAPGSVASLASVDAKRDEAGLLGAAERLGVPFFPARELADRPVPNPSEAALRAVGTPSVAEAAVLASGAELVAEKRKSPM-----ATCAVGRLPVRGRLYLVGLGPGDEALIPPLAREALARSEIVVGLAQYL-ERVRHLLRPGTRTVEPPLGREVERAGVAVEEARLGGSAALVSSGDIGVYAMASPALEI-AGTDVDVVVVPGVTASQAAASLLGSPLGH----DHASVSLSDLLTPWEVILRLTAAAEGDFVVSLYNPRSQLEKAKGVLLEHRPPDTPVGIVRDAYRPAQSVRLTTLADL----DPESVDMLTVVLVGSSRTVV-RAGRMVTPRGYEL... 564
183 0.000e+00UniRef50_A0A1H3PIH0 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=2 Tax=Tindallia TaxID=69894 RepID=A0A1H3PIH0_9CLOT  ali  24  1MKTAMITFTHHGLTQAQTIRKHRPDSPVYAPETLLETGSEAELHQWMPELMKKEEGLIFIGATGIALRFIKDHIHHKASDPAVLVMDEQGHHVISLLSGHLGKANELTLEIAEITGAQPVITTATDNRGITAIDQLAATYQAPLE--DWETAKKWTAAMLIGESLPVYS------SEPLPLPLPAGYRQIETQEGFLEEGRGIWIGEVPSSLPST-VNLLQLIPRRWSLGIGCRKDQNP-EELKTIVQAFLKEQGLSIKAIKNINTIKAKGEEPALLSLAKEWELPLFSVDKIGQVQHLFPSAWVEENMKVTSVSAPCAYLASGGGQVLPELRFAHNGVTLSLAP----EAGKITVAGIGPGKGEHISGAVKKALGESQRIIGYKPYV-DRLSPWLKKGQIQDRSFMRKEKDRCRHALACAARGEKVVLVSSGDAGVYGMAGL-MLELREAEIPFEILPGITAANAAASRLGAPLMQ-DYA---TISLSDHLIPWEAIERIQKATESGFMLALYNPKSQWNRAVEIISALRDPKTPVGIVTKALNEGESIQLIPLEKLAE----AQVDMNTTVIIGNEYTKITQDHLMVTARGYSL... 619
184 0.000e+00UniRef50_A0A1Y0RTC5 Precorrin-3B C(17)-methyltransferase n=2 Tax=Nostocales TaxID=1161 RepID=A0A1Y0RTC5_9CYAN  ali  20  7...AVVILGNNSIPVARKIISVLPGAQLYAGRTSNVDISFTEFGTTLRELFASGTPIIGICATGIIIRTLAPLLANKRQEPPVLAVAEDGSAVVPLLGG-LNGVNSLARQIANVLGVKPAITTTGDIRFGIALEDPPAGYRL----ANPEHAKSFMSDLLAGNSVRLEGHAPWLRNSSLPI----------------AEDAERVIQITEKQVVSTPTR-LVYHPATIAIGVRCKRGGVPSEEI-ALVQQMLADAELTPASVAGIFASTLDAANPALQAIADALNVPFFTTDEIAAISQNQTTDVA-----VTAALAASSGELVIQRELSHLSCAIAIAPQPIDVSTRGKPRGRLAIIGTGPGASDWMSPEVKEILRNATDLVGYSTYLG--LLGSLTKGKQQHESDNREEIARARMALDLAAEGHFVAVVSSGDPGIYAMAAAVFEVLDQQGIEIQVAPGISAMQAAAARIGAPLGH----DFCAISLSDILKPWSIIERITAAAKADFVLAFYNPVSQLAEAKNILLNYRDPDTPVVLARNLGRDGESIQVCTLEHLAPELA----DMRTVILVGSSIQRCDGSFWVYTPRRY..... 591
185 0.000e+00UniRef50_A0A2A4U0Z6 Precorrin-3B methylase n=4 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A2A4U0Z6_9PROT  ali  24  241..VAIVCLNPAALDAAKLLKSTLPNAVLWGFSKNDVDKVFSNVTQTLQDLFSKGTSIAAFAASGIVVRALAPVLADKTGEPAVVAIAPDGSFAVPLLGGH-GGANRLATAISKLTKGFAAITTAGDSALGLALDEPP--IGWSVQN--PSAAKSIVAKMLSGESAGLSVDSGTTDWLSGFSKGDD-------------------VLVTHKQTND---DGLILHPPTLSLGVGCERDCDPAE-LEDLVTKTLDAAGLSADSIACVTSIDVKSDEPAVLELAEKLGVPFFTAEQLDAESGRNPSDIVKAEVGCPGVSEGAALATVGKDKSKRATCAIGLSPTDIIPETVGKGRGRLYILGIGPGTDSWRTPEVTRILSAVTDVVGYGFYL--DLVPDLIKGKKHHTSNLAQEEERVRHAMDLAAEGKDVALISSGDVGIYAMAALAFELLQREDRAIQVEPGISAFQAAAARIGAPVGH----DFCLISLSDLLTPWEVIQRLKAAAEGGFVVSFYNPVSQLAEARDILLQHRDPKTPVILARQLGRADENIRVITLEELTPDMA----DMLTLVMVGGEDTRRGQNTWVYTPRGY..... 825
186 0.000e+00UniRef50_A0A1Z8P0E2 Precorrin-3B C(17)-methyltransferase n=1 Tax=Rhodospirillaceae bacterium TMED23 TaxID=1986864 RepID=A0A1Z8P0E2_9PROT  ali  22  7....ILTINETSAGLARKVRSHLPGTEIHVGRVLDADVHFQETVKHLKTLFSNGRPIIAILSTGILIRALAPLLNDKFSEPPVLILSEDGKSIIPLLGGHR-GANEIGHRLNSILGGNLSVTTAGDLRFGVSLDAPPK--GWKIIGGE--NIKVVMADLLNGGSVNLCDET--------SNDLDKNWLLGAGIKFSKKARHEL--IISYKAQSEGLKKT-IFCPSILSLGIGCERGVDSSE-LYTFINDILSEYNLNKESIACISTIEIKEDEVAISDLSAALEVPLFTAKELNTSQVSDPSKYVFSVVGSHSVSEASALSAAGDGELIVPKQVRSGMTCAVAIAKKIIDPSCLYVIGIGPGSAIWRSPEATNEIAKASDIVGYSLYL--DLLGSLADDKSQHRFPLGQENDRVVKALDLASEGKNVALISSGDAGIYAMASLVFENLDRQRLEVRVVPGISAFQAIAARIGAPFGH----DFCTISLSNLLTPWDAIERLVAAAEGDFVIALYNPVSQLGIAKDIILKYRDPETPVALGKNLGRNNEKISFLTLSELDVKL----IDMLTIVVIGSSQSCNNQSKHMYTPRGY..... 603
187 0.000e+00UniRef50_A0A165YVE4 Precorrin-3B C(17)-methyltransferase n=33 Tax=Proteobacteria TaxID=1224 RepID=A0A165YVE4_9RHOB  ali  23  6...AILVISPVALKTAQKLSSVLDESLIHGFARQGSEPTFADSAEHLRTLFQSGTPIIGICAAGILIRALAPVLTDKRQEPPVIAVSEDGSSVVPLLGGHH-GANALAQQISEVLQGHAAITTAGDTVFKVALDEPPQ--GWTLAN--PSDAKSVMAQMLAGETVKLSGQAEWLESAALPL----------------ADDAELEIVATEEPVEGHSTK-LVFHPQTHVVGLGCSRGC-SVEELDELLQKGMEQANITIGMVSAFTSIDLKADEVAMNQLAARYEKPFFTAGELNEHKDRTPSDVVFAEVGCYGVSEGSALAGTGKQKTANATVAIAKAPAPVNTNLIGRARGRLHVIGIGPGQEAWRTPEASHWLAEADEVVGYGLYL--DLVSSLIKGKQRHAFQLGAEEERVRFALERAGQGHNVALVCSGDSGVYAMGALVFELLDRARVEVASAPGISAMIALSNRIGAPLGH----DFCAISLSDLLTPWETIQRLEGAAIGDFVIGFYNPVSQLAWAREKLLEHRPAETPVILGANIGRDNETITTTTLKDL----KVDDVDMLTTVIVGCSQTRGHSLHFVYTPRGY..... 602
188 0.000e+00UniRef50_A0A2G3E3B0 Precorrin-3B C(17)-methyltransferase n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A2G3E3B0_9FIRM  ali  20  1MFIDVLTFTEHGEKLAYQMMTSISKCADEEVKWHLYYKDAEDIYTKSREAFENGHALVFICAIGIAMRAIASCVKDKLTDVPVVGMDDAGKFVVPLLSGHMGGANELALTIAQAMSATPVITTSTDCNDAFSADLFAKEQNLSIMN--REGIRSVSAKAIEGKPIRLMVEH--------------------------FKAASADVVVT-RDSAKYRHGTLALCPRDYAVGIGCKKG-KSFEEIESAVQSVLKEHQIDESRIGAIASIDLKAEEPGLIRFSQVHKLPFFDAEILNGIQGHFSSDFVKNTTGTDNVCERAAIAAAGDGASLLVQKTACDIASPAGVKKKAPVRNLVYVVGMGPGAEIQMTQQALSALEQADTIVGYSVYLELLGARFAK--KETISTPMRQEMRRCEICFEEAQKGKCVAMVCSGDAGVYGMATLLLDLQSKYDVGVEVVPGITAATSGAAILGAPLNH----DFCVISLSDLLTPRSVIERLRAAAQGDFAIAIYNPSSHLQWACEILLEYRKESNACGYVENIGRDGTKASVCTLVEL----RSRKVNMFTTVFIGNSQTKIMG-NHLVTPRGYH.... 569
189 0.000e+00UniRef50_Q30WH1 Precorrin-3B C17-methyltransferase n=3 Tax=Desulfovibrio alaskensis TaxID=58180 RepID=Q30WH1_DESAG  ali  22  43.RLCVFALTPQGIQLAARLCPHL-QADLFLPHRLAGTERFLRLADAVRHAFSIYDGLIFIAACGIAVRSIAPLLQGKDRDPAVVVLDQQGLHAVSLLSGHLGGANALACRIAAMTGGTPVITTATDTEGLPSLDLLAAENNMAIARL--TAVRHVNAALLEGRQVAVADRHDLLKLKNHPCGLFIH-TDEHSLDNRYAALPSVLVTIHASAARRAPADRLVLHPRILHAGLGCRKNV-PAPRAAEHLLRLLEAHDITPLALASLASVEAKRAEPAMHEASRRLGVPFFSSAALAAIAVPNPSSRPLKAVGTPSVANECRCTQHAAAHLIIPKAADGDVTAAVAQEQYTMHPAPLYIVGLGPGDPQLLTPQAADALRASEVIAGYTRYV-ELVPDDILAGREIIATGMMGEMERCAKAIETALSGRATAVVCSGDPGIYAMAGLIYELIEEMD----------------AYL--PV-HXXXHDFACISLSDLLTPWEVIERLQNALEADFVVVLYNPRSQLEHALETARRYRQPETPVGLVRQANRPEQAVSVAPLS----VFEPAQVDMLSIVIIGNSTTRIIRGN-MVTPRGY..... 650
190 0.000e+00UniRef50_A0A1C0UZM1 Precorrin-3B C(17)-methyltransferase n=3 Tax=Limnothrix TaxID=132605 RepID=A0A1C0UZM1_9CYAN  ali  27  1........................................................MIFVLAVGATVRAIAPHLQDKRTDPAVVVVDETGHHVISLCGGHLGGADALTRQVAGLLAVEPVITSAAEGQQLPAIDLLGDRYGWRRGQGDWLG---VASAIARFETVGVVQTCGWNLWI---EELPEFHPFVLLSEDELPPNLRAIVWISDRPLPPLPLPAVAWHPRTLWVGIGCERHTPEGQ-MAAALSQVLEQADLAPEAIAGIGSIDLKQDEVGLLALVDRLDLRWFTAAALAPIAVPNPSEVVRSEVGTPSVAEAAARLAADGAELIREKQVFCTIALARADREYTPHLGKLWLIGTGPGSLDQLTPAARAALSQCDVIIGY-QLYLDLLRPLLHPGQIIEGSPITREKQRAERAIDLAERGLRVAVVSSGDCGIYAMAGLVLECLAARHWDVEVLPGITALQAAAARVGAPLMH----DFCAISLSDLLTPWPVIVRLQAAAAGDFVVALYNPRSQIETAFEILRAKRSPETPVVLARSLHRPDEQITIATLAT----VDLQAIDMLTVVLIGNASTFTHS-GKVITPRGY..... 549
191 0.000e+00UniRef50_U5DMM2 Precorrin-3B C17-methyltransferase n=8 Tax=Cyanobacteria TaxID=1117 RepID=U5DMM2_9CHRO  ali  23  38..LSAIALTPSAARTLQPLVAA--GATLWVPPAPDARPYEEPFGAWLAAQWLQQRAFVFAMATGAVVRAIAPLLSNKSSDPPVVVVDRAGQFALGLCGSHAGGGNRLTRLVANYLGAVPVLTDAAADADLPSVDVLGVPFGWHRGNGNW---TAVSAAGARSEPIRVWQSAGSHLWRQLPDDHPDAATAPLAPEAAGKPIAELWIDAVEREFP-PETAAVQWHPRVLWIGIGCERGT-PQALLESALARVLAERGLTAEAIAGVATLDLKADEPGLRSFCRDRDLPLFAPEVLQAVPVPNPSEVVAEAVGTPSVAEAAALQAAGDGAELLVPKQIERIAIAQAVYEFTGRSGRLYLVGIGPGATAQVTPAARAALQQADVLVGYARYL-DCVAPLRRPGQIVEPYPIGAELERARRAIALAEWGLTVAVVSSGDAGIYGIGGVVMEELRQLGWDVEIFPGITALQSAAARVGTPLMH----DFCAISLSDLLTPWSIAARLEAAASADFVTALYNPQSRFAAACEIFMRYRDPETPVAIVRNALRKDERVYRTQLDRL----EDAPVDMVCTVIIGNRSTQFYG-DWMLTPRGYLGFG. 646
192 0.000e+00UniRef50_K9YNF9 Precorrin-3 methyltransferase n=7 Tax=Cyanobacteria TaxID=1117 RepID=K9YNF9_CYASC  ali  22  13....LIAVTDDTAKLAKEIGGNLWLPKKLINNDLTNNYYDGSLKEHLENIWQDSKAIIFSLTMGAVVRLVSSLLGNKKDDPAIIVIDPDGNYVISLLGGHQAFADKLTELVALQLDAQPIVTSASQSLGIIPIDTFGHIFGWV---KGEGDWTRVSASLARKNPVKVVQN---SGSFLWQKSLQDNHSFVF---DNDNKHCEELIYIGNFRKDAETKGVVRWFPRVLWVGIGCERNT-PRELIEYAIREVFERFNLDIKAIALICTIDIKGDEVGILELTQDWQLELFEAQELDGVRVPNPSAVVKEEVGTSSVAEAAALKGASLPTLGEEETPRVTVAVAQSALEYNPHHGKLYLVGTGTGSLSQMTTAAKTAVKDADVVIGYGLYL-DLIKPLFRPEQIIESFPITQERQRAIRAIALSRWGLKVAVVSSGDCGIFGMGGLVLEILAQTGWSVEVFAGITAMQGGAAKVGSPLMH----DFCAISLSDLLTPWEVIERLNAAAQADFVTSLYNPRSQIVIAQQIFLKYRSGDTPVAIARSITRDDEHITITTLREMLN----YDIDMLTTVIIGNSTTKAYQ-GFLITPRGY..... 625
193 0.000e+00UniRef50_A0A1J5Q7L6 Cobalt-precorrin-3B C(17)-methyltransferase n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5Q7L6_9ZZZZ  ali  25  2..IGLIAVTSAGRGAAHELANAWPGETVL---------YEETAAQSLPAAFAECSQVVAFLAAGAVIRLVSPLLKDKHTDPAVVCVDEGRHFAISLLGGHSGGANALAERVAEVLGVEPIVTTASDAVGICALD----QLGWPVE----GDVAGVGRAMLDGESIGFSSEGIWPIP-----ALPENVAINEEPTSGRNQ-----ILVTDRLVESGPGLAV-LRPPSLVVGVGASRGV-SADEVLELIDSLLADAQLSAHSVRHLATIDVKADEVGLIEAAKRRGWTLYPATALVEVAVPNPSERVMAEVGTASVAEASALFGGGTLLVGKNKSHRDAPM-ATVAIARHDPRGRLAIIGLGPGARDLLTLRAKKELRRASVVVGLDQYV-EQIDDLLRPGTRLLATGLGNEEERARSAIAEAKKGYAVALIGSGDAGVYGMASPALEDFDGT-FDVVGVPGITAATAASSLLGAPMGH----DHCSISLSDLHTRWPISERIKAAAEGDFVFSFYNPRSQLDSALTLLAEHRPETTPVGLVRAASRSGESVTVTTLGELVTTGTAA-VDMFTLVLVGNSYSRLAAGQ-MVTPRGY..... 563
194 0.000e+00UniRef50_A0A0V8A0P4 Uncharacterized protein n=7 Tax=Cyanobacteria TaxID=1117 RepID=A0A0V8A0P4_9CYAN  ali  23  8..LALIAIAPTGVNKLQSLCSGIPKANIWVPESCAEQVYNTSLKKHVASLWQNQRAFIFCLATGAVVRLIAPLLENKSSDPAVIVIDEMGQFVISLCGGHQGGGDRLAQLIATQLGAMPILTGGSASLELPAVDMLGVPFGWCRGEGDW---TAVSASVVRGEPVQVIQEAGSTIWRTARGVEKSSLCFEETVDATAE------IWITCRSFTDSQKSIITWYPKVLWVGIGCERGT-PRKVIEAAIENTLQEYQLAKDAIAGIATIDIKSDEVGLVELCANNNLPLFRREILKHISVPNPSQIVAKEVGTPSVAEAAALLATFKGEMLIPKQIFRTVAVAQSEREYTGRKGKILLVGTGPGELQQITPAAQTAIASVDVVIGYGLYL-DLISPLLRTGQIIEALPITKERQRAQRAIELANWGLIVAVVSSGDCGIYGMAGLVLEELKVCGWDIEIFPGITALQAAASRVGTPLMH----DFCAISLSDLLTPWEIIERLQAAAAADFVTALYNPKSQLTIATNIFLQHRNPNTTVAVVRSAYREDEQITLTTLDKLLDV----SVDMLTIVLIGN-QNTRNYCEWMITPRGY..... 659
195 0.000e+00UniRef50_F8ACB5 Precorrin-3B C17-methyltransferase n=4 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=F8ACB5_THEID  ali  27  4.KVVVFYISSKGKALAEKIADFFPEADIFPFSYQK-----------LKSCFYESRAIIFIGASGIAVRKISPLLEDKKKDPAVLVLDEAGRFVISLVSGHLGGANSLAREIAACLNSTPVITTASDISELPALDLWAKKHELIFEPEE--LIPKTTSRYIEEKGLKVYTETKVPLLETFE---------------LTNELEEAHLVVGYHYFENFSG--LYARPKRLIVGMGFHEGV-SEEKLFTALKKVFEKHRLSLLSIKKLATLERKAKSPGFKALAQRLNAEAVTPKKINVIQAGLKDSMAKKHTEVRAVAEPAALSGSQGDRLLIPKQKQDGVTIAV--AEIPPPPGKLWVVGLGPGSLEELTPRARKALRQAEKVVGYKTYVT--LVEKLLQDKEVFTSGMTQEVDRVTLALNLALEGFEVALVSGGDPGIYGMAGLVFELMKEKRIPVEIIPGITSASAGAARLGAPLMH----DFACISLSDRLTPWEIIERLRAAAQADFVIVLYNPRSHLARAKDIILEFRPEDTPVGIAKAIGRKDESLKITTLTAL----NPEDVDMQTTVFIGSSSSFILE-NLMVTPRGYKGKR. 570
196 0.000e+00UniRef50_A0A212K8S1 Precorrin-3B methylase n=1 Tax=uncultured Alphaproteobacteria bacterium TaxID=91750 RepID=A0A212K8S1_9PROT  ali  22  8..LAIVVFSESGLEVARKLRDALPQASIFDRRVSACDETFADAGAHLRRLFGDGIGIVGVCAAGILVRALAPCVADKWSEPPVLAVAQDGSVAVPLLGGHH-GANRLARTISELLNGAAGVTTAGDVRFDIALDEPPR--GWRVAN--PAAAKDVVGRMLAGEPVALAVEAGDARW-------------LAGCGASFAEAAPATIRVTDKAVAGDDA-TLVMHPPVLAVGIGCNRDTG-AEEVIGLVETTLANAGLAPGAVACLASIDAKMDEPALHAAAQHFGVPFFSADALNVFADRLSSEHAFAAVGCYGVAEGAALAVAGEGAALAVTKTKSVNATCAVARAAANVDPARTVVGVGPGSAAWRSPDATQAIRRADAVVGYKRYLN--LVADLIEGKPQHVSGMTREEVRVTKALDLAAEGRNVALVCSGDPGIYALASLTLEMLDKADIEVRIVPGITAAQGAASLAGAPMGH----DFCLISLSDLLTPWETIERLKAAALGDFIVALYNPVSRIERAREILLTGRPGTTPVVIARNVGREDQSVQVITLDELTPDHA----DMLSMVTIGNSTTRAFDLAWVYSPRGY..... 599
197 0.000e+00UniRef50_A0A1J0AHC6 Precorrin-3B C17-methyltransferase n=1 Tax=Gloeomargarita lithophora Alchichica-D10 TaxID=1188229 RepID=A0A1J0AHC6_9CYAN  ali  22  11..IAWIATTPTSLPLAQSSQGVLWCSPHLKSHPHC-QIYAPSLREHLSIIWPHQRAIVFGLTLGAVVRLIAPLLTDKQQDPTILCIPESGEYVITVCGGHQQQGDKLSQSIAHLLGIKSVITDAATAHDIPGVDTWGMPWNWQ---KGAGNWTGIASAIIRDEPIHIMQESGTTLWR--QMIMQKSNLIFLQEPDLQTK----TIWITHREITSPDQQIVTWHPRVLWVGIGCERGT-SQEQIDSAVKTVFATHQLSLKSIAGIASLDIKKDEIGLVNLTQAQGWPFFSAATLSQISVPNPSKIVAQTVGTASVAEASALQASQGTLLVPKTISPVTIAVALAPQEWLNRPGQLYLVGIGPGDLAQLTPAARQAITQADVVIGYHLYL--QLLDTIKRPAQIWEPYPIGQEQRAQRAIELAHWGLNVAVVSSGDCGIYGMAGVVIELLQKQDLDIKIFPGISALQSAASRVGVPLMQ----DFCAISLSDLHVPWDVIQRVTHAAQGDFVTIFYNPCSQLPTAQAIFLQYRDPQTPVAIVRQAYRQDEQIWRDTLANFTQ----NSLDMFCTIIIGNSRTYWSEYG-LITPRNYP.... 600
198 0.000e+00UniRef50_UPI0004906D03 precorrin-3B C(17)-methyltransferase n=1 Tax=Thermodesulfovibrio thiophilus TaxID=340095 RepID=UPI0004906D03  ali  23  10...AIVYLTQRGKTVAEKIIQYFPDSKLYKFNRTD-----------ISQIWNSHRFIIFIMATGIAVRSIAPFIKDKKNDTAVLSIDEEGKYIIPIIGGHLKGANELAKTLAKFLNSTPFITTASDLNNLPALDLWIKRCSLKVKNPEI--LSKIMSKLIDNKNLMLFMENSVQIPLLNCFQLTENIS-------------EADIVITNKISK---GDKLILVPTNLFIGIGLHEWITE-EKIERGIKEALNRNGFEFKAVQAIATIDKKSTYPALLSFCKKYGLKLYSSEELNSITTVSHSDIVYKSVGVSSVSEQACLLAS-QGKLIIAKQILKDMTVAVA-EGIFSVRGKLYIVGTGPGNLNSITPQAVKALRNSELIMGYKTYIG--HIKSLIEDKQVLAYSMTDEVKRAKKAINEALNGKIVSLISGGDPGVYGMAGIILEIVAKNNVEIEIIPGISALNACSAISGAPIM----NDFAVLSLSDRLTPWNVIERIDKSAEADFVIVLYNPKSHLTRAKEIILKYRTNTTPVAIVRGATRDEQSIVLTTL----EKMDEHSVDMQTTVIIGNSKSFIYK-NWLITPRGY..... 567
199 0.000e+00UniRef50_A0A1G6GFI3 Precorrin-3B C17-methyltransferase n=1 Tax=Raineyella antarctica TaxID=1577474 RepID=A0A1G6GFI3_9ACTN  ali  25  8........SAAGRRHAAAIDVALGEPT---------RHYEGPVADSLATAWAECDLLVSHLALGATTRLVAPLLQSKDTDPGVVVVDEAGRFAVPLVGGHGGGANDLARRIADGIGAVAVVTTATDAVGLPALDTL----GWAWA----GDVAAVTRSILEGHPVDLVKERPWPLPAFPENVCLFDATPTLGADATD-RTAVGRVVITERVLAGADRPTVVLHPRSVVAGMGCHAGTD-VAPLRELLIGCLADQHLAPESLAALVSTDVKADEPGLVALAAEFGVPFYPADVLAAQPVPNPSPVVESHVGSPGVAEAAVLARGADLVREKQRS-----TVATCALGVLPARGHLSVVGLGPGARDLTTPRAVEAIRDAAVIVGYRPYV-DQVRDLVRPGTRVVASGMGTEEERTGRAIEEARRGHAVALVCSGDPAIYAMASPTLEQGTD-GIDVEIIPGVTAELAISAILGAPLGH----DHVTISLSDLHTDWETIERLQAAAEGDFVVTLYNPRSRLPRALEILGAHRPGSTPVAAVHDATRPDEQVVTGTLADF----DVERVDMNSLVVVGSSVTTGSGEQRIVTPRDYH.... 576
200 0.000e+00UniRef50_UPI000933676F precorrin-3B C(17)-methyltransferase n=1 Tax=Spirulina major TaxID=270636 RepID=UPI000933676F  ali  24  37........................GWPLFVPPHLATEFPLQSLRDRLPGLWQDYDGLIFALATGAVVRLIAPCLTDKATDPAVLVVDPQGKTVISLCGGHQGGGDRLAQTLAHYWGATPIITGASHGQQMPAVDLWGKPWGWRRGAGDW---TGVSAAIARQAVVHVTQTSGATGWRD---SLPPDHPLTFAPDPI----AAAQVWIDYRPHPQPEPPTVQWYPRVLWVGMGCERGT-SLAVITAALTQVCQDFNLAPAAIAGIASIDLKGDEAALLDLCAARDYPFFAAATLAAIAVPNPSDYVAQTVGTPSVAEAAALQASGAAELLVPKQVIKTIAIARSATEYTGRTGAIALVGMGPGSLSQITPAAQMAITAADVLIGYSLYL-DLIAPLRRPGQQVEALPITQETQRAERAVELANLGLSVAVVSSGDCGIYGMAGLVMEVLAAQGWDVQVFPGITALQAAAARVGTPLMH----DFCAVSLSDLLTPWDVIVRLEAAAHGDFVTALYNPRSRIVTARDIFLAHRRPDTPVALVKSAYRPDEAITLTTLDEMLT----HPIDMLTTVLIGNSNTRRYT-DWLITPRGY..... 610
201 0.000e+00UniRef50_Q10WL6 Precorrin-3 methyltransferase n=6 Tax=Oscillatoriales TaxID=1150 RepID=Q10WL6_TRIEI  ali  24  11..IAAIATTPTGAKLLQPICQKLEG-TLWIPESLNTQVYTDSLKNHLANIWLDYNAIIFSLASGAVIRLISPLLQNKYHDPAVVIVDQTGKFVISLCSGHQGGADQLTNILAPLLNATPVITGASHNLELPGIDILGKPFGWQRGEGDW---NTVSGIIAREETVQVLQEVGSMLWQKLPHQHPFYFGFPKMGETSPTPKARIWIFYQHQFSPDSDLPKVQWHPRVLWVGVGCERGT-SKKLIATGIEKILSTYNLAVKAIAGIATINIKADEIGLIEFCQEKNLPLFSAELLNCVEVPNPSDIVAAEVGTTSVSEAAAILAAKQQQDTDFKQKYNVFEQALSEKEYTGRTGKLLLIGTGPGQLDQITSAAKTAISYADVVIGYSLYI-DLIQPLFNPGQIVEKMPITQERQRAERAIELANFGLTVAVVSSGDSGIYGMAGLVLEQLRASYWDVEIFPGISALQSAASRVGVPLMH----DFCAISLSDLLTPWEVIERLIAAAMADFVVAIYNPKSQLVKAVNIFLKYRQPKNPVAVVRSAYRENEEATLTTLDKLLEV----SVDMLTVILIGN-QSTGIYNNWMITPRGY..... 661
202 0.000e+00UniRef50_Q2JU70 CbiG protein/precorrin-3B C17-methyltransferase n=7 Tax=Cyanobacteria TaxID=1117 RepID=Q2JU70_SYNJA  ali  26  1MKLALFAPTPRGRRLAQALLSLLPEEWICWSKANPQGEPLPSLAAAVAQTWPQVQGCLFILPVGSVVRLIAPLLQDKYRDPAVVVVDESGRWAISLCGGHVGGADALARQVAAALGAEPILTSASEGLGIPPVDVLGHPYGWRRGSGDWNG---VAAALTRGEPVAVEQTC---GTQLWQRAWPADHLLLTTAPD----QAVAQIRIGEYTTPCPHIPTVHWHPRVLWVGVGCERGT-SRAWLEGSLRRLLQNQGLALEAVAGLATLELKRDEAGLLELAQAHGWPFFSAAALAGIPVPHPSEAVRQAVGTPSVAQGRATLVCPKQIFTSESEGACTLAIARAAREYSPRAGHLWLIGIGPGDPAQLTLAARLALAQAEVVIGYQLYL-DLVAPLLHPGQICEAFPITQEVQRAQRAIALAQQGLQVAVISSGDAGIYGMAGLVLEYLARSGWDLEVLPGISALQAAAARLGAPLMQ----DFCAISLSDRLTPWPAIERLQAAAQADFVVALYNPRSRQRKALQIFRRARPTHTPVAVARNLYRPGEAIHLTTLGEL----DPEQVDMFTLVLIGSSQTFRYG-SRLITPRGYRL... 622
203 0.000e+00UniRef50_UPI0009FE8BFB precorrin-3B C(17)-methyltransferase n=1 Tax=Thermodesulfobacterium hydrogeniphilum TaxID=161156 RepID=UPI0009FE8BFB  ali  25  19...AIIYLSEKGREIAEKIRSIFPEAKLYKFKK-----------ELLHEIWNKYNAFIFVSAIGVAIRCIASFIKNKKEDPAIIVIDEEGKNVIPLLGGHSAEANSLSLTIASFIKANPVITTASDLKNLPALDLWIKKTGLKIKN--PFLLPKIMAKFNSSKELKIF------LNTQVKLPFPKHFSLVSTISEAD-------IIVTNKFIKDVDENQLVLIPKNLFVGIGFH-DWIKEEDLEKTLKEVFKEAGFYWEALSGIATIQKKGSHPALKKLSERYKIKLFTSKELNQVNSSSPPGASMKTLGVASVSEQAALFSAFQKAFLCVPKQVFKDLTIAIAEGVYKIKGKLYIVGTGPGDLENLTPKAISILRSSDFIVGYKTYIN--LIKPLIEDKEILAYGMMEEVERAKIAIKKALEGNVVSLISGGDPGIYGMAGLVLEILSKNDLEIEIIPGISALNACASLAGAPLM----NDFVAISLSDRLTPWDVIERLHLAGKGDFVIVLYNPKSHLSKAKNVLLSYRKSETPVAIIKGAFRKNQEIILTTL----KKIDLYPIDMQTTIIIGNSNSFIFK-NWLITPRGY..... 585
204 0.000e+00UniRef50_A0A2W7BF53 Precorrin-3B C(17)-methyltransferase n=1 Tax=Snowella sp. TaxID=2164131 RepID=A0A2W7BF53_9CYAN  ali  23  43..LAAIATTPQAALTLAPLCQSM-GATLYVPETLSGIEYSGNLKDYLSQIWGQHKALIFGLATGAVVRLIAPLLQDKATDPAILVIDPQGKFVISLCGGHQGGADQLTRLIATQFDATPILTGAANDLNLPAIDLLGTPLGWK---KGAGDWTGVSAVLARKEKIQVIQDAGSLFW---QKQLPADHPFSFDPSELQPQ-ARIWISATQRNFAQSDFPKVQWHPRVLWVGIGCIRGT-SQQFISNAITQVFQQQHLSQDAIAGLATIDIKADEIGLLAYCQIHHLSLFTSEILNQEVVPTPSEVVYEEVGTASVAEASALCAAKKKQIIKSQEEAVTIAIAQSAVEYLDKTGALWLIGTGPGALEQMTSAAKTAISQADVIIGYSLYL-DLIEPLKRPGQIIESFPITQERQRAKRAIELAKWGLKVAVISSGDCGIYGMAGLVLEELQKNQPTVEVFPGISALQAAAARVGAPLMH----DFCAISLSDLLTPKALIERLLAVAQADFVTAIYNPKSQIETAQRIFLENRDPQTPVVLVRSVYRPDEKITITTL----EKMLDFSIDMLTVILIGNSTTY-YQGGFVITPRGY..... 642
205 0.000e+00UniRef50_A9WIP4 Precorrin-3B C17-methyltransferase n=5 Tax=Chloroflexus TaxID=1107 RepID=A9WIP4_CHLAA  ali  24  4..TAIFALTRNGVELATRLAATLP-ATIWLPERFAAFAPYTNLSAAVQTAWQQSKAIILIAATGIAVRLIAPLLQAKTSDPAVICLDEQGHVVVPLIGGHRAGANALARQIAALTGGQAAITTASDGQGLPALDLIGQAQGWRIATD--SATTHVMACLVNGDPIGVWVDPDLPAARALELAPVATVEWVADSEELTNPRFAAAIVVSHRRLDPLWDKGLRYMPPVLVIGIGCRRDV-PVHELATAVSATLATADLAPECVATIATADLKADEAGISDLARQLGVPLVTTAQLQTLDPTAFSPSAASRFDIPGVAEPCATLVAQGPKQRFARCTVAVALQQATFGSDTTPTGQLTLVSIGPGDLAHLTEAARLALIKAEVITGYARYI-DLIRPLLRPDQEVIATPMGDEMGRARHAIELARSGRRVALISSGDIGIYAMAAPVFENLQAGGWDVEVIPGVSAFQALAARIGAPINH----DLCLISLSDLLTPWPLIERLRAAAHADFVVALYNPRSQLATALSILRDHRPATTPVVFGRQVSREDEQITITTLAD----ADPQQADMLTLVLIGNSQSFH-LAGHVVTPRGY..... 610
206 0.000e+00UniRef50_A0A2T2RND9 Precorrin-3B C(17)-methyltransferase n=1 Tax=Cyanobacteria bacterium QH_9_48_43 TaxID=1919126 RepID=A0A2T2RND9_9CYAN  ali  22  10..LAAIATTPN---VAEKLQPLCSGATLWVPPALGEQPYEGSLKEHVASLWHQHHAFVFGLASGAVVRLIAPLLGDKSRDPAVVVVDEKGQFTISLCGGHQGGADQLAQLIAQQIGATPVLTGASTGWGLPGVDRLGVPFGWCRGEGDW---TAVSAAVARGEPVEVIQEAGSTLWAHLPEGHPLRIQNRRAGRSPSIAEFEARIWISPAKREFSPESSVQWHPRVLWIGIGCERGT-SQQLMEAAIGEICQRYHLAEEAIAGMATVDCKADEVGIMELCCRRNLPLFPAEVLRLVDVPTPSTVVNQEMGTPSVAESAALCAADWVRDDAGTRGQGHIAIAQSQQEYTGRTGQLFLVGTGPGELDQMTPAARTAVTEADAVIGYSRYL-DLIISLRRPGQIVEAFPITQERQRAQRAIDLAQWGLYVAVVSSGDSGIYGMAGLVFEELQAQGWDVQVFAGITAMQAAAARVGAPLMH----DFCAISLSDLLTPWEIIERLEAAAQADFITAIYNPRSRIVTAQKLFLKHRHPNTPVTIVRSVYREDEQLTLTTLENMLQV----PIDMLATVIIGNSST-RNYANWMLTPRGYLGF.. 664
207 0.000e+00UniRef50_U7QJ70 Precorrin-3B C17-methyltransferase n=45 Tax=Cyanobacteria TaxID=1117 RepID=U7QJ70_9CYAN  ali  24  7..IAAIATTPHACQRLQPLCQT-AEVTLYVPQSLGNQVYPDSLRQLLPQLWSSHRAIVFCLALGAVVRLIAPLLQHKSTDPAIIVVDETGQFVISVCSGHIGGGDRLAQLVARILGATPILTGSANALNLPGIDILGVPFGWKRGSGDW---TGVSAAIAQQQTVQVRQEAGSTLWQ-------HHLPATHSFDFTSTQTPQAQIWISPRQLSTEDLPQVQWHPRVLWVGVGCERNT-PKAVIETAILDVLRAHQLAEEAVAGIASLDLKADETGLVELCQARHWPLFSAEILRQVTVPTPSEIVQSEVGTPSVAEAAALQAAQVQALLVSKQIYRSPQPAIAQQEYTGRDGQLLLVGTGPGQLNQMTPAAQTAVTQADVVIGYSLYL-DLITPLLRPGQIVESYPITQERQRAERAIELAEWGLTVAVVSSGDCGIYGMAGLVFEQLRAQGWRVQVFPGISALQAAASRVGAPLMH----DFCAISLSDLLTPWEMIERLKAAAMADFVCALYNPRSRLSQAQMIFLQFRSPQTPVALVRSAYRDDEQITLTT----LEELTEVSVDMLTTVLIGNSTTFHQ--NWMITPRGYLGF.. 614
208 0.000e+00UniRef50_A0A2N1UKQ9 Precorrin-3B C(17)-methyltransferase n=2 Tax=Nitrospirae TaxID=40117 RepID=A0A2N1UKQ9_9BACT  ali  26  12.KSTIFYITDNGFNLAKKLQRLYPDAQIQKFN-----------SRSVSKLWNKAQNLIFIMAAGIVVRTIALLIKDKKTDPAVVVLDEKGKFAVSLLSGHLGGGNELAKEIANFLKGEAVITTASDINSLPSIDLWAKKNGLVIEN--WNAVPAISTRLINNGRLNVYDDIGIPPPEFIKVSVLESADIIITNKSTLSFPLVGNLSVSPRNKNLKTTDRLLLRPQNLIIGIGCNRGT-SEEEIEDAAKTVLKKNNLSFLSVFSIATIDIKAREAGLKAFAEKYGVNAFSPDELNSI-FRNPSEAAFKATGAYAVAEPAALLASGAETLLVPKQKSGNVTVAVVLKGSNKRHSSLYIVGTGPGSIEHITPYAQNAIKKSDAIVGYGTYL--ELIKELIKDKEIVSTAMTQEIDRCKKAVELAMSGKTVSVISSGDPGIYAMAGLVFEILKDRNITVEVIPGISALNACAARLGAPLMH----DFAVISLSDRLTAWDTIQRLEAAAMADFVTVLYNPKSHINKARAIFLRHRSAETPVGIVKGAMRKHERIVITDLKNMLE----HGIDMQTTVIIGNSQTFVWG-NRMITPRGY..... 646
209 0.000e+00UniRef50_Q4C0Y1 Precorrin-3B C17-methyltransferase n=17 Tax=Cyanobacteria TaxID=1117 RepID=Q4C0Y1_CROWT  ali  23  10..IAAIATTPQSTQLLHPLCQSLT-ATLYVPETLSTCHYQGSLKNHLATIWAENRAFIFCLATGAVIRLIAPLLEDKASDPAIIVVEPTGQYVISLCSGHQGGADRLAQLIAQQLNATPIITGASHSLNLPAIDILGLPFGWR---KGPGDWTGVSHAIACQKRVQVIQEA---GSKLWQDNLPQNHPFYFGFPEIGENNIEARVWISATKRKFAEGSTLQWYPRVLWVGIGCIRGT-SQGLIESAIEKIFQKYHLATEAIAGIATIDIKADEVGIVEYCQEKQYPLYSSDVLNTIKVPNPSEVVKEEVGTPSVAEAAAIYGANYKQVVKSDNEAVTVAIAQSQLEYTGKEGKIYLVGMGPGSLEQMTPAAKTAINQADAIIGYSLYL-ELIQSLQSPGQIVESLPITKEKKRAQRAIYLAKWGLSVAVISSGDCGIYGMAGLVLEELKNINWDIEVFPGITALQAAAARVGTPLMH----DFCAISLSDLLTPWDVIKRLEAAAIGDFVTALYNPRSQIIEAQTIFLQHRNHQTPVALVRCAYRQDENIILTNLQEMLE----HKIDMLTTVLIGNSSTFLHQ-NWMITPRGYNQFRR 630
210 0.000e+00UniRef50_Q2JP97 CbiG protein/precorrin-3B C17-methyltransferase n=7 Tax=Synechococcus TaxID=1129 RepID=Q2JP97_SYNJB  ali  26  1MKLALFAPSPRARRLANSLIPLLGKEVICWSKAPKDPTAPGSLAEAVAQTWPQVQGCLFILAAGSVVRLIAPLLQDKQRDPAVVVVDEAGRWAISLCGGHVGGADALARQVAATLGAQPVLTSASEGLGIPPLDLLGDPYGWRRGAGDWNG---VAAALTRGEPVAVHQTC---GTRLWRQAWPADHPLV----ASSPPHPVAQIWIGEYLSPPTEIPTVHWHPRVLWVGVGCERGTT-RAWLEGSLRRLLQAQGLAFEAIAGLATLELKQDEPGLLELAQAYGWPFFSAEALAGIPVPHPSEAVRQAVGTPSVAEGKATLLCPKQVFTSETEGACTLAIARAAQEYSPRSGHLWLIGTGPGDLGQLTLAARMALTQADVVVGYQLYL-DLVDPLLHPGQIREASPITQELQRAERAIAWAQQGLKVAVISSGDAGIYGMAGLVLECLVRSGWDLEVLPGISAFQAAAARLGAPLMH----DFCAISLSDLLTPWPVIKRLQAAAAADFVVALYNPRSRQRKALQIFLQARPAHTPVALARNLYRPGETLRLTTLGEL----DPEEVDMLTLVLIGNSQTFRHG-ERLITPRGYRL... 627
211 0.000e+00UniRef50_A0A0V8M5E7 Uncharacterized protein n=4 Tax=Dehalococcoides mccartyi TaxID=61435 RepID=A0A0V8M5E7_9CHLR  ali  25  5.KTAIIALSRNGITLGHKIKTGLGGAVLYAPQKHADVAFSQPVSQIIRQAFSQYRQIVLIMASGIGIRALAPVIQDKRHDPAVVLLDEQGNFAVSLLSGHLGGANKLARRLALICRGQAVITTASDVQHTLSPDLLGKEYGWKIQNPE--NLTALSGLVVNGQPVGIYQSA---GENLLKGELAPNLNRFSSLEELYKAHRPGNIFITEQELSRLSPLSLIYRPPCLVVGIGCNRGTAASE-IEQAVFDTLSRFRLSCLCLSDIASVDLKSDEAGLREFARSLNISFFSGSELAGVDVPSPSQAAMRCAGTPSVAEAAALLCSKGEIIVPKQVYRPNITVAVALKPAVMPAEWLYIVGTGPGNPDHLTPAALEAITDSQVIVGYKTYTDQ--IAGLINGKELISTGMTQEIQRAEKAIMLALEGKKVALVSGGDSGIFGMSGLVYDILRERQITGKVISGMPALVSCSSLLGAPLM----TNFSVISLSNYLTAWAEIEQLRACAATDLVMVIQNPTSKFALACRILLEYRRPETVVGIVKNADRPEQEYWISSLGNLAE----EDIDMNTTIIIGNSYSYRWGES-MVTPRGY..... 602
212 0.000e+00UniRef50_A0A1F8LWQ4 Precorrin-3B C(17)-methyltransferase n=1 Tax=Chloroflexi bacterium RBG_13_48_17 TaxID=1797621 RepID=A0A1F8LWQ4_9CHLR  ali  23  11..IAIVAITRKGAALGRRLNLLLPHSRLYLPKKFAAKPKPDEAKEVVREAFSRYRYLVLIMAVGIAVRLVAPELSNKRKDPGVVVVDDSGSFSVSLLSGHVGGANQLAGKIASLIGAQPVITTASEVSQTIAVDLLGKEFGW--ELNDNRSVTTVSAALVNGEPVGIYQDAGEKNWWSKTKPLPDNVRIFTTIEAFIRANFQAGLIITDRILDNKHRALLQYRPRSLVVGIGCNRGTPCSE-IKEAVIRVFSEHDLSIKSIKNLATISLKRNETGLLKFARKYSLPIFDKEALCKVNFPSPSAAALRNVGTPAVCESAALLSSGGDSLIVPKVSHKRAVTVAVFNDKRDKGGKLFLVGIGPGSLEHITFKAKEAIDCSEVVIGYKTYI-KLIEPYLRQ-KEVIATGMGAEIERVKKAISLARKGKIVSLVSSGDTGIYGMAGLVGEILSQQ----------------------PLDDFDIGDFVTISLSDYLVSWKEIRRLRLAAQGNFVIVIYNPKSQLTKAREIILQHRPPSTPVGIVTNAYRRKQEVVITDLEHMFD----YEIGMNTTIIIGNSATF--TLAWMVTPRGY..... 615
213 0.000e+00UniRef50_UPI000B5228DE precorrin-4 C(11)-methyltransferase n=1 Tax=Geofilum rhodophaeum TaxID=1965019 RepID=UPI000B5228DE  ali  45  11..WALLYASAAGQALAVDLLKNGLKADVFPIKEAD-----------LAAITRNYSAILFIGALGICVRNIVPHLRDKKSDPALLNTDVQGRFVQTVLGGHQADANRLTQKLAARLGALPVLSTASESLNLWPLDLLARRFGWKTE--VRGNLNQLMARFVNGAPTALLLEARDSGTLYLENSLPDHVTCFYQQEDLHPETFELLIVVSPFNRFD-NQEGIFFRPPILYLGVGCQKNI-SGPLLYETIRDSLSQQQLSPLALAGIGSISLKKEEKALKVLSQKFEVPLFEADTLRKHTVPHPSIRAEKETGSPSVAEAAACEMAQNTGKQKLKAGPQSATIALALSSQYERKGFVHFVGAGPGHPDFITVMGQKLIRTADLLLYAGSLVPEILTHEVKPGCLVKNSAEMDLPGQVALMKEFCDRKLQVVRLHTGDPCIYGAIQEQMAVLDQFAIPYAIVPGVSSFQAAAAMLKSQFTIPNGTQTIILSRVAGKTPTPAAESLTNLAKSQSTLCLFLSAAMAAQIQKDLLQSYPAHTPVAICHKLTWPEQKIIRCKLNQLTEKMQDSELHLTTLLVVGQAIDNRKGKSQLYHPDFKHLFR. 596
214 0.000e+00UniRef50_A0A1G1FLA7 Precorrin-3B C(17)-methyltransferase n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1FLA7_9BACT  ali  25  6.NTAIFYITANSFALAKKLNSLYPDAKAFKFKP-----------DTLSKFWGKHKSFIFIMATGIVVRTIAPLIKDKTTDPAVIVLDEKEKHAISLLSGHLGGANKLAKEIAEFLGGQAVITTASDVNNMTSIDLWAKENGLIIDNCN--LVPQVATRFINKGKLKVYSEV--------EIKMPEGFLRTDKPSSAD-------VLITNKKDLFTHSPILYLRPKNLIIGIGCNRGT-SANEIEDAVKKALAEKKLSFLSIHSVATIDIKAGEKGLNEFVRAYGFPIFTANELNSLRGIQKSALVFKATGAYAVAEPAALLASGADKLLLKKQKMGNVTVAVSEIKSRYGIGKLYIVGTGPGSVEHITPYAQKAIRNSDVIVGYGTYI--ELIKELIKDKEIVSTGMTHEIDRCKKAVELAISGRTVSVISGGDPGIYAMAGLVFEVLKSHQLSVEVIPGVSALNACAARLGAPLMH----DFASISLSDRLTPWRLIERLDAAAKADFVIILYNPKSHIDRAREIILKCRKPETPVGIVKGAMRENERVIITDLKNMLE----HDIDMQTTVIIGNSQTFVWD-NRMITPRGY..... 601
215 0.000e+00UniRef50_A0A0H3U9T9 Putative cobalamin biosynthesis protein CbiG (Fragment) n=8 Tax=Bacteria TaxID=2 RepID=A0A0H3U9T9_9BACT  ali  58  1MNISIILVSESSLSLANTLKSELGEINIYHKGEIEGCTNISSVADATKDLFTSSDSLIFIGAMGICVRSIAPCINDKHEDPAVVCVDSTGKFVVSVLSGHIGGANKLATTIATITGGEAVVTTQSDNTGLWALDTIAQEYGWTVALAGRLAAQRMNNAIVNKHKTALVLETEDEGTKYMESSKPDHVKVFRSFNDSKEKPFELLIIVSPKKYPNVDIPCIQYYPKCLHLGVGCQL-MAPVQIAEQLLGEI-RAAGYATEAISTIGSIELKKDEPLLAEICKLLELKIYTADELNKVKIPNPSDKVFEVTGCYGVAEASAKCPNKHSVLVIEKQKISHYTFALACDEGIQRQGHIEIVGAGPGDPDLVSVRGRKFLEQADLILYAGSLVPRELTLCAKPGATVRSSASMDLEEQFELMKKFYDKGGLVVRLHTGDPCIYGAIQEQMNFFDHYGMEYHITPGISSFLAAAAELRSQFTIPEKVQSIILTRGEGRTPMPEKEKLHLLAQSQSTMCIFLSAGIAQQVQDELLAGYSPETPVACCYKLTWKDQKIFRGQL............................................ 589
216 0.000e+00UniRef50_UPI0009FF2E7F precorrin-3B C(17)-methyltransferase n=1 Tax=Geitlerinema sp. PCC 9228 TaxID=111611 RepID=UPI0009FF2E7F  ali  25  5..IAIIAPTPNSVRLASRLQTVLPAAQIWTKITDRSYEEFGSLSSLLPQLWQTCDRLIFILAVGAVVRAIAPFLNHKEEDPGVVAVDESGQFAVSVSGGHIGGADALARQIAAALEGTPVITSASEGYQLPAVDLLGNAYGWQRGSGDWLG---VSSAIARRNPVLVVQQAGWDFWR---GSLPPNHPFATEMDNMDDAEATAAIWIGDRLPPPTNMPLVCWHPRTLWVGVGCERGTE-VDLLEASLRQLLAENGLAVEAVAGLASIDIKADEPGLLELANRLNVPFYPRETLAKVDVPHPSAAVEQAVGTPSVSEAAALMAAGGKRVYRDARGACTLSIARSTVEYNPNIGQLYLIGSGPGSLDQITPAAKSAIAQADVVIGYKLYL-DLIEPLLHPLQCREDSQITQEVERAERAIFLAKRGLTVAVISSGDCGIYGMAGLVMEALASQDWDVQVFPGITALQGVAAKVGAPLMH----DFCAISLSNLLTPTDVIERVEAAAMADFVVALYNPRSKLTKALQIFRRYRSPKTPVAIARSIYRQDECIYLTTLDDI----EEGQVDMLTVILIGNESTFRYR-DRFITPRGYTG... 619
217 0.000e+00UniRef50_A0A1P8F9F5 Cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase n=2 Tax=Dehalogenimonas formicexedens TaxID=1839801 RepID=A0A1  ali  27  5.KLTIVAVTKNGTALGRRLRSVLPHSELYAQARFLDDPYEEPVGELIGRLFKECESMALIMANGIAVRAVAPYLKDKKSDPAVVVLDEGGENIISLLSGHLGGANALTQKIAALLGAHPVVTTASDVSHNLSPDNLAARYGWLVEPG--SDLTGLAAALVNGDPVGVFQDSGETDW---QATVNGYVTVYPSIDTIKNGKVAARLAITNRMVEDHAIPSVVFHPRNLVVGIGCNRGTT-ATEIDKAINTICQRYGLSPMSISSLASVDLKKDEQGLLEYSVERNVPFFPAARLAEIPVPSPSEHALTHAGTPSVAEAAALLASGATALLVEKQDGQVTVAVAESVTEAKSNGKLSVVGIGPGDFADMSFRARQAIDEAEVIVGYKMYL--DLIRPLLAGKTLLSSGMTKEVDRTQEAVKSAGAGKNVALISSGDAGIYGMAGLAFEVAAEMKIPVEVVPGISAVSAAASLLGAPLM----TDFCTISLSDYLTDWPRIERLEYASKADFVIALYNPKSRLEKAVNILLNHRGGGTPVGIVSDAYRPEQMVVITDLENLP----KQDVGMTSIVIIGNSQT................... 587
218 0.000e+00UniRef50_K9XYL4 Cobalt-precorrin 5A acetaldehyde-lyase n=34 Tax=Terrabacteria group TaxID=1783272 RepID=K9XYL4_STAC7  ali  24  12..LAAIATTPQSASILQHLHSNL-ELELWLPQSLEGTEYQTNLSEHLTNIWHEYRAFVFCLATGAVVRLIAPLIESKATDPAVVVIDAQGRFVISLCSGHQGGADLLAQLIAQQIGAQSIITGASDSLRLPKIDLLGLPYGWRKGDGDW---TGVMAAIAKNQTVQIIQE---VGSTLWQQNLPDGHPFYFGFPEANQQQPQGRIWISARFASNSDFPKVQWHPRVLWIGIGCERGT-SAQLIETAITDTLQKYHLSSKAIAGIATIDLKADEVGILELCQSWNLPLFSAQQLSPIDIPNPSEIVQQEVGTPSVAEAAAILASNTDNSLIVAKQIIKLPHAQPEQEYIGRQGKLYLVGIGPGSLEQITPAAKTAIIQADVVIGYSLYL-DLIKPLLRPEQIIESFPITQEKQRAQRSRELAQWGLTVAVISSGDCGIYGMAGLVLEELQAEDWDVEVFPGISALQAAAARVGAPLMH----DFCAISLSDLLTPWQVIQRLEAAAQGDFVTAIYNPRSQIVTAQEIFLKYRRNDTPVALVSSAYRLNETINITTLKEML----KHPIDMLTIIIIGNSSTRRHT-DWVITPRGYLGF.. 618
219 0.000e+00UniRef50_A0A2W7NIZ3 Precorrin-4 C11-methyltransferase n=2 Tax=Cytophaga xylanolytica TaxID=990 RepID=A0A2W7NIZ3_9BACT  ali  51  43....LIPFSEAGRQLADRLVALGFDAD----RLAGGDAIDTAL------LFERYRALVYIGALGICVRHIAPHLQNKKHDPAVINIDVNGRFVQPVAGGHVGGANELAQQLAHLLGATPVITTVSDTTQLWPLDLLPARYGWTME--CSGRMTELMARFVNGEPTALLLEARDAGTLFLESDCPPHVTIYHDALRIPVDEVAVVLAVTPRVY-DFGRKAVYYRPRMVHLGVGCQRDTPEVELI-QVVTDALVAKGFSPLSVASVGTAMLKHDEPALHALAQQLGVPLVPIDELAGYDTPSPSDRVQQVTGSPSVAEAAAMHLSGNVPAVTKRAGEKHATLALAIDRDRERRGFVEIVGAGPGDPLLVTVRGKMLLQSADLILYAGSLVPVELTRYGKAGCTVRNSAAMDLHEQIATMKAFTDRGLLVVRLHTGDPCIYGAIQEQMAEMDRLGIPYRITPGVSSFQAAAAALQSQFTIPEEVQTIILTRGEGRTPVPEREQLRHLARSQSTMCIFLSATLAGEVQAQLLEHYPAHTPVAICHKLTWKEQQIWRCTLDALAHTIAQHQLTATTLIVVGKAIDNRSGLSKLYDANFKHLFR. 627
220 0.000e+00UniRef50_A0A1F8PP84 Precorrin-3B C(17)-methyltransferase n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8PP84_9CHLR  ali  24  12..TAIVAITRRGVALGRRLQRTLPGSRLYLPDKFADEVYFTSAKDLMADIFRRYRYLVLIMAAGIAVRLAANELRDKHHDPGVVVVDDAGSFCISLLSGHIGGANELARRIASQLGAQPVITTASDVNGTLSLDLLGREFGWEIE--DDTYLKDTSAALVNGEPVGVYQDAGEPDWWPAASLLPDSITVYPSLEALQQSGASAALIITDRIYRSLPKHIIIYRPKSLVLGIGCNRGTGSTA-IETAVSQALSSQRLSAKCVRKIATIDLKRDEAGLFKFARDHALPYHDRETLRQASFPSPSAAAVKYVGTPSVCEAAALLSSHTSHLLVPKVRSGRSVTVAVARFSFDSRPPSFLVGIGPGDLKYLTFAARDALDRSEVVIGYETYI-DLIKPLLGR-KRIIATGMGAEMARVKTAIDLVKQGKTVSLISSGDCGIYGMAGPVGEFLREQDVEVRVIPGVPALAACAALLRSPIS----GDFVSISLSDYLVPWEEIRRLEMAAQGDFVIVLYNPRRQLARAREIIMRHRLPVTPVGIVTNAYRPGQAVTITDLEHLLD----YDIGMSTTVIIGNSVTFAGD-GWMGTPRGY..... 616
221 0.000e+00UniRef50_A0A1Y1CPC4 Precorrin-4 C(11)-methyltransferase n=3 Tax=Marinifilaceae TaxID=1573805 RepID=A0A1Y1CPC4_9BACT  ali  51  23.....................KMEGSTIVSVTGYPGSKKISSLPDFLKKSFPQVDLLIFIGAMGICVRSIAPFIQNKAIDPAVINMDLHGKYVQSVLSGHKGGANEYAQQIAKITNGTVIITTASDTLELWPLDIFGRKYNWTNEYQNASE-NELIAAFVNQKKTALLLDVKNEGTQSLQESCPDFVEVFYQFNQIKQEDFDLLIAVTPALYETI-IPSLFFRPKCIVVGTGAQKGIG-VAAFETEVRSRFEANHLSFASLKSIHSIIVKAKEEAYRQFSETTKLPFYSAEELNEKEGEVSSEAAYREVGAVNVSEASALIASGAKTLLQTKSKHKHFTLALAMDAEQERKGEIVIVGAGPGAPDLVSVRGKSLLKRADLILYAGSLVPRELTDYGKASCVIRNSADLTLEEQFDVMRKHYDRGGLVVRLHTGDPCIYGAIQEQMNFFDQHEMDYDIVPGISSFQAAAARLKSQFTIPNKVQSIILTRGEGRTPMPSREQLSEFAKFQATICLFLSVTLVDKLQADLLEGYPENTPVAICHKLTWKEEKIWRGELKDLAKIVKENKLALTVMIVVGEAIGNRKNRSLLYDPKFTHGCRK 605
222 0.000e+00UniRef50_A0A255TVX9 Precorrin-4 C(11)-methyltransferase n=1 Tax=Prevotella sp. P2-180 TaxID=2024224 RepID=A0A255TVX9_9BACT  ali  56  1MRKAIVTISDDGQALA----------TIVSRELHADIIPLGQ----VAAQWYDYDAFVFISAMGICVRTIAPLLKDKHSDPAVVCMDTAGKNVIAVVSGHVGGANQLAADVARAVGAMPVITTRSDIDGLWQLDLLGKRFGWELE---REDINAEIAMFVNRRPTALLLQVNDEGTRWLEANLPEHVTVFYREDCIDSNLFDLLVVVGYKSVVKGIKATLHYIPKCLYVGIGLAHDAD-MECIDE-IRHCLNDKGINMKAIKSIATIDVKKGEKVVGELMRCYEVKFYSSGELSEIIVPNPSVTVEKHVGTSSVSEAAAMLSADNNQLLLEKHKGTQWTLAVADSAFDRSKGHVEIVGAGPGDPELVSIRGRKYLERADLILYAGSLVPRQLTECAKQGATVRNSASMALEEQCNLMKTFTDRGLLVVRLHTGDPCIYGAIQEQIDFFESHDISYHITPGISSFLAAAAELRSQFTIPGRCQTIILTRGEGRTPMPEREKLHMLARSRSTMCIFLSASIVDDVQDQLLQEYPEDTPVAVCYHLTWKDQKIWRGKLSSLANIVRENHLTLTTMIVVGEAVRMRNGVSKLYDRHFTHLFRK 593
223 0.000e+00UniRef50_A0A238WYT2 Precorrin-4 C11-methyltransferase n=2 Tax=Lutibacter TaxID=358023 RepID=A0A238WYT2_9FLAO  ali  46  3.KISIIAITDKGIEQALVLQKQFPKSLIITTRTSDNKHVVSSISDYLADNFSKIDGICFISALGICVRTIAPFLNDKYKDAAVICADELGLNVQSVISGHTGGANDFANKVAQLLGGKAIISTSSDVQEIWGVDTLGKQFNWKTEST--STLNEVMALFVNNKPTALLLDVKDHGTDFLEKSLPNFVTVFYNESEIDFTQFELLIAVTYKEITTT-IPVLYYVPKVLSVGSGCSKSLDER-LFDETFKVKFEEKGLLFSAIENFGSIDIKAKQSAYLDWSKNNKTPFFTSEEIDTVNVPNPSLMVQEKIGVDGVSESTAMLMANTKTLLVEKQNNEKFTFAVALNSKVERKAQIAIIGAGPGDEELITVKGKQYLENADCVLYAGSLIPEEMTNWCKKGAVVRNSASMTLEEQVALMQKHYIKGNSIVRLQCGDPSIYGAIQEQMTIFDELGMEYFIVPGISSFSAAAAALKSEFTIPEVVQSIILTRGEGKTPLPATEKLVEMAKHKATMCLFLSVGIAKKVQNQLLEHYDASTPVAVMYRLTWKDEEIYQGKLEDLAQIVKDSKKSRTVLIIVGEAIGARKNRSHLYSPEWKHIFR. 604
224 0.000e+00UniRef50_G8UMV0 Precorrin-4 C(11)-methyltransferase n=151 Tax=Bacteroidia TaxID=200643 RepID=G8UMV0_TANFA  ali  64  1MKIAIILVSEAGLPLAQTIRRELGASSIYTTHTLEGCENISSYNRFMSDHFHDFGAFVFIGALGICVRSIATCLKNKYTDPAVICTDSAGRFVVSVLSGHIGGANDWTRRIAAITGGEAVITTQSDRADLWALDTLGRTYGWR-TAASPAEMNRMIALFVGGRRTALLLEIKDRGTEYLERTLPEHVDVFYTYHDIRPQEYELIIAVSPFIY-NAETPVLYFRPRVLHVGVGCRRNSRP-DGVAAYMEKVMEEHGLSPLAIRSVSTITLKKDEPLFAALAEAWKAEIYDAVDLQDIEVPNPSQKVFETTGVYGVSEAASQKAAKGTTLVLEKQKESDFTFAVAMDADSLRGGFIEIVGAGPGDPELISVRGKRMLERADLILYAGSLVPRELTLYAKPGTTVRSSADMTLEEQFALMKEFYDRGLFVVRLHTGDPCIYGAIQEQMAFFDRYGMRYHITPGISSFQAAAAALQSQFTIPEKVQTIILTRGQGRTPMPEKEKLHLLARSQSTMCIYLSAAIVDEVQAELLRAYPPETPVAACYKLTWKDERIYRGQLKDLARIVKENHLTLTTLLVVGEAIDNRSGLSHLYSSDFKHIFR. 605
225 0.000e+00UniRef50_W4LL55 Uncharacterized protein n=4 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4LL55_9BACT  ali  38  10.RTAIIAVTHHGLDQAKRLRQKLGAGRLYRPAHHGESPYEGPLSAQIEALFGHYDHLVFFLATGAVTRLIAPYITDKTTDPGVVTVDEASRFVIALLSGHQGGANALARTVAGHLGATPVITTASDVIGSLSPDLLTETLGWVPEPG--GHLKAAAAALVNGEPVAIVQEIGTTGSWLNQWGLPDHVQVAYRADSSPAQEFRQAWWITDRVDDALHEQTLWFRPQSLVLGVGCERGI-PLAALEDGLDLFLHEHGLAKASITALASLDLKADEAAIVDLAQQHGWQFYSAEELAHVPGKRPSEVVEACVGTPGVSEPAALKAAATDQLLVEKQMTFAIARLGTFEDRSQAAGKLTFIGAGPGDPDLLTVKARRVIEQADLVIYAGSLIPEAILQHAPPTATLHNSAPMTLEDVMTLMMEAIRAGQSVVRLQSGDLSLYSAMQEQMTQLDDANITYDIIPGVSAFQAAAAALRSELTIPEETQTIILTRGEGQTPMPEGESLTALAAHRASLCIFLSARLSRKVQDQLLTAYAPETPVGILYRVSWPDELIVVTELQHLHRTIREHKLTRTTLILVGEAIGARQNRSRLYHTTHAHIFRR 633
226 0.000e+00UniRef50_A0A1H3ZS24 Precorrin-4 C11-methyltransferase n=5 Tax=Bacteroidales TaxID=171549 RepID=A0A1H3ZS24_9BACT  ali  61  28.KIAIIQISKEGRHVAYFIQQELGAQLIE--------------RTAVGAHWQDFDAFVFIGAMGICVRTIAPYVEDKHTDPAVVCVDSFGNHVISVLSGHVGGANELTKQIAGALGVDPVITTQSDNAGLWALDTIYENYDWHMSYV--GNLNNAVGKFVNREPVALLLDIRDEGTDYLERTCPQHVTIVHSVDEIMEGNYTLAIIVSPFIYSNLPSDLLVYTPQVLDLGIGLAHQA-PVDTYED-IQLLLGEHHICLECIRKICTIDIKAEEPVIQKFAERYGLELYTADELAKVDVPTPSETVEKHVGTPSVCEAAALLASNYGKLLLPKVKGKNFTIAVAIDHKYLREGHIEIVGAGPGDPDLVSVRGRKMLERADLILYAGSLVPKALTECHKPGAVVRSSADMNLEEQCALMKQFYDRGKYIVRLHTGDPCIFGAIQEQMAFFDREGMSYHITPGISSFLAAAAELHSQFTIPERCQTIILTRGEGRTPMPEKEQLHKLARSQSTMCIFLSASIVDDVQRELLQEYPEDTPVAACYHLTWPDQRIYRGVLRDLAKIVHENHLTLTTMLVVGEAIDNRRGLSALYDKHFTHLFRQ 614
227 0.000e+00UniRef50_A0A1B1Q2G4 Cobalt-precorrin-4 C(11)-methyltransferase n=54 Tax=Bacteria TaxID=2 RepID=A0A1B1Q2G4_9CHLB  ali  50  5.RLAIIAASQQGITIGLRLKQELADVGLFSPRSGAESTRISSITAWTAEEFHNWDALVYFGALGICVRAVAPVLQSKNSDPAVINCDEQGRFVQSVLSGHHGGANDLARRVARMLGAQPVITTSSDVQGLWPLDILGRDEGWYRAGLGGRSLTDAQAAFVNHEPTVLLLDVRDELTERLERTCPDFVTVAYRYEDVDVESCSLLLAVTPFLYE-PPVQAVFYRPRVLCVGVGSEKGIDP-ERFVGSFLHRLREKRLSYRSVTALATVDFKLQEPAFQAIAIQLGIPLFEAQALEAVGGPNPSETVFRKVGIHSVSEAASALLAGHEEWIVEKQQPRHFTFAVSLRQNALRRGHISIVGAGPGDPGLVTVRGRELIEAADLVLYAGSLVPEKLTEYAHAGALVRSSASMSLEEQFELMKRFCLQGKLVVRLHTGDPCIYGAIQEQIAWFEAHGMPYDIVPGVSSFQAAAAALNSQFTVPEKVQTIILTRGNGRTPVPEKERLRDLARARATMCIFLSAEWADQVQRELEEEYPPTTPVAVCYRLSWDDQQVWRGELGSLAAMVRESGKTRTVLLVVGEAIGARQNRSKLYDPHFTHGFR. 620
228 0.000e+00UniRef50_A0A238UBL9 Cobalamin biosynthesis protein CbiG Precorrin-4 C11-methyltransferase n=3 Tax=Tenacibaculum TaxID=104267 RepID=A0A238UBL9_9FLAO :  ali  46  7.KVAIISFTDNGLEIAKTLQNEFYRSKVFTTREVEDIKQIDSVKELMEASFQKYDAWLFIGALGICVRSIASVIEDKKTDPAVVNIDDQGKFAQSVLSGHIGKANELTAQISRILQATSVVSTSSDLQDLWSLDMLAEQYGWA--QKCNTELNVIISLFVNRKPIALVLKVKDKGTEFLEKTCPDFVTIYYSLDAVVTEKHEALLYVGYELI-QLDLPTLAFHPKCIALGSGCSKDIEP-ELFEKILCEELQKQQVAIESVMAIGSADIKAEEQAYLDIVAKLDIPLYNGDELNSIDVANPSEVVKKKVGVYGVSEASSALIANESEWLVEKTKVNKFTYAISLVSDFARKPSIAIVGAGSGDPDLLTLKGRAILEVADCILYAGSLVPEELTHMAKEGALVRNSASMTLEEQIDIIDDYYAQGKKIVRLHSGDPSIYGAVQEQMTIFDAKGYDYYIVPGISSFQAAAAYLKSEFTIPEVAQTIILTRGEGNTPTPEHENIADMAKLRATMCIFLSVGIAKKVQGELLEHYPPETPLAVLYRVSWKDEQVWTGKLTELTQIIKENKLTRTVLIVVGEAVGARKNRSWLYDDKWHHIFRK 610
229 0.000e+00UniRef50_A0A222SKX3 Precorrin-4 C(11)-methyltransferase n=1 Tax=Prosthecochloris sp. GSB1 TaxID=281093 RepID=A0A222SKX3_9CHLB  ali  49  5.RIAIVAVSSQGIEPGAVLKKELSGVELFSPRNDPRSVCIESVVRWVGEEFHRWDALVFIGALGICVRAMAPVLESKYEDPAVVNCDEQGRFAQSVLSGHRGGANDLARRVARALGAQPVITTSSDVQGLWSLDILGREQGWSIERPGRGGVNEAAAAFVNREPTVLLLDVRTEHTDHLERSRPGFVTVAYRYEDIDVERCSLLLAVTPFDYAPA-VQTVFYRPKVLHAGMGSEKGIESSSFVESF-HAELERRSLSVKSVVSLGTVDFKVREPAFQELAGVLGVPLFEPSLLESVEGPNPSETVFRKVGVHSVAEASSALLAGCPEWVVEKQKPRHYTFAISMDRLSMRKGRIAIVGAGPGDAGLITLKGQACLEEADLVLYAGSLVPETMTHSARPGALVRSSASMPLEDQFRLMRKFYEEGKKIVRLHTGDPSIYGAIQEQMTWFDEHGMEYEIVPGVSSFQAAAAVLKSQFTIPEKVQTIILARGNGRTPVPEKERLRELARARATMCIFLSAEWASDVQQELGSHYPPDTPVAVCYRLTWPDQQVWRGKLDNLADIVRECGKTRTVLLIVGEAIGARGKRSKLYDPAFSHGFRE 621
230 0.000e+00UniRef50_Q8KFE2 Precorrin-4 C11-methyltransferase/cobalamin biosynthesis protein n=27 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=Q8KFE2_CHLTE  ali  51  4.RIAIIAITETGIALARSLKSLLAGCGLFSSRVAEGVEPIESVPAFVRHSFGSFDAFLFIGSLGICVRSIAPVLQGKLRDPAVINCDESGRFVQSVLSGHAGGANALAGRVARLLGAQAVLSTSSDVQGLWPLDILGREEGWGVEFASPVAMTTAMAAFVNHEPTTLLLDVRDSLTDELERTAPPFVTIAYRYEEVDFSTCSLLLAVTPRIIE-ASVQTVFYRPKVLCVGVGSERGIDP-ERFVSSISEQFASNGFSMRSIRSVGSVDFKLNEEAFIAFAEACGTTLFTPEQLESVPVPNPSDVVFRKTGVHSVSEASAALLSGENRWLIEKQKPRHYTFAVSLLRGAERRGRIAIVGAGPGDPELVTVKGKRYLEQADLILYAGSLVPEKLTHYAKPGALVRSSASLSLEEQFALMERFYRQGKFVVRLHTGDPSIYGAIQEQMAFFDAEGFEYEIVPGVSSFQAAAAVLQSQFTVPEKVQTIILTRGSGRTPVPDKERLSELARARATMCIYLSAEWSDQVQSELLEHYAPDTPVAVCYRLTWDDQQVWRGRLDGLASLVRESGKTRTVLLVVGEAIGARGGRSKLYDPSFTHGFRE 620
231 0.000e+00UniRef50_A0A2N3TF76 Precorrin-4 C11-methyltransferase n=23 Tax=Bacteroidetes TaxID=976 RepID=A0A2N3TF76_9FLAO  ali  46  7.KVAILCFTDQGVSIAKTLQKEFYRSKLFTTRTVEDIKQINSVSELIENSFHNYDAWIFVGALGICVRSIAAHIKDKTSDPAVINVDDQGKFVQAVLSGHIGKANTLTTQISRILNAQAVLSTSSDLQNLWALDTLAETYGWKMMSSISTN--EIISLFVNRKSTALVLKVKNKGVQHLEKTCPDFVDIYYDQKDFEHSDYELILYVGYELIA-TETPILSFYPPCVALGSGCAKDIEP-QLLMKGLESALREQHIAIESIYAIGSATIKNEEQAYLDFAAYYNIPFYTGEELNTITVANPSEVVKRKVGVYGVSEAAAALIAGQSTWLVEKTKAKKFTYALSLSARYERKASIAIVGAGSGDPELLTLKGQYILENADCILYAGSLVPEALTHMAKEGALVRNSASMTLEEQIMIIDQYYKQGKSVVRLHSGDPSIYGAIQEQMTIFDEKGYDYYIVPGISSFQAAAAYLKSEFTIPEVAQTIILTRGEGNTPMPEHEKIADMAKLRATMCIFLSVGIAKKIQAQLLEHYPENTPLAILYRVSWEDEEVWTGTLSELTTIIKKNKLTRTVLIVVGEAVGARKNRSWLYDDKWYHIFRK 610
232 0.000e+00UniRef50_A0A246GDN2 Precorrin-4 C(11)-methyltransferase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A246GDN2_9FLAO  ali  49  3.KTAIIASTDKGVELGLIIQKEFQKSIVVSTRSHSKVTQIESIHSFLENNFSKFDSFVFIGALGICVRSIAPYIENKTKDPAVINIDDAGTFVQAVLSGHLGGANALTQNLSKVIGAQAVITTSSDTQNIWALDTLPATYNWK--SKSSIEMNKIISLFVNNKPTALLLDIKDKGCTFLERNKPDFVTIHYRYNDIDFSKYELLIAVTYKVYE-APIPALYYYAPVITMGMGCSRGIE-YDLLENSFRNQLQEQHIAVEAIKSLGSLDVKHDEEAFITLATTLKIPFFTAEELNSKNTINPSEVVMSKLGVYSVSEAAAMLLAQNNEVILEKKKIHKHTIALSLDAKAQRKAEIIIVGAGPGAADLISVKGKELLEDADLILYAGSLIPIELTHYAKPSAIVRNSASMTLEEQIEIMCEHYEKGNLIVRLQSGDPSIYGAIQEQMTIFDEKGMEYSIVPGISSFQAAAAYLKSEFTIPEVVQSIILTRGEGKTPLPENEKLNEMAKHRATMCIFLSATIAKSVQEQLLEHYPEDTPVAVLYRVTWQDERVFVGKLTELAQIIRDNKLTLTTLVIVGAAIGARKNRSYLYSPEWKHIFR. 602
233 0.000e+00UniRef50_A0A1T5GMZ3 Precorrin-4 C11-methyltransferase n=1 Tax=Alkalitalea saponilacus TaxID=889453 RepID=A0A1T5GMZ3_9BACT  ali  50  4.KIAIISFSNAGSDLALRLCSYGLKADCFSSKEVN-----------VGELFNSRNAIVFIGALGICVRQIAPFLKNKITDPAIINVDVNGHYVQPVTGGHRGGANQLANEIAALLGAIPVITTVSDTTSLWSLDMFSQRYGWKMES--RSSLTKLMAAFVNEQSTALLLEARDNGTLFLEESLPEHVTCFFDYKDVDVNKFEVIIAVTPYLRPLGD-KVIYYRPKMLHLGMGCQKDINS-EVLKNSVDSFLKESGFSPLSVASVGTVELKKDEMALNYLADSFGTKLFSAEELACYDSNSPSDFVNDVTGTPSVSEAAAFKLGNNITKHTLKVNDKFATISLSICNDRERKGFIEIVGAGPGDPLFITVRGKMILQTADLILYAGSLVPIELTHYAKPGCTVRSSAAMDLPHQIELMKSFTDRGLLVARLHTGDPCIYGAIQEQMAELDKHKIPYRITPGVSSFQAAAAALKSQFTIPDETQTIILTRGEGRTPVPEREQLNKLAQSQSTLCIFLSATLAEKVQQQLLEHYPANTPVAICHKLTWKDEKIWHCELINLAATVAQNKLTLTTLIVVGKAINNREGLSRLYAPEFKHLYR. 590
234 0.000e+00UniRef50_A0A078RCQ3 Precorrin-4 C11-methyltransferase n=22 Tax=Bacteroides TaxID=816 RepID=A0A078RCQ3_BACVU  ali  62  1MK-AIILISEASLPLAKTLQRELPDTLIYTKNECEGCISITSCHRFIEEHFNDFDSIIFIGAMGICVRSIAGCIKNKYKDPAVVCVDSTGRFVISVLSGHVGGANELTRHIAAITGGEAVITTQSDNAGLWALDTLAGKYGWKITVP-HAEMNRLVTLFVNREPTALLLDIKDKGTEYLERTLPAHVKVFYHFEDMPQSEFKLIIAVTPYIY-SAEIPMLCFHPAVLHLGIGCRKQCDPS-GIAEYIEAVMHRHGLCPFSLASLNTIELKKDEPLLEILHRRWETHIYPAEELKDITVPHPSEKAFEVTGVYGVAESTALKSSGEGTLVLEKQKGMHFTFAIAVSATAIRGGHIEIVGAGPGDPELISVRGKRMLEKADLVLYAGSLVPRELTFYAKEGATVRSSAGMDLEEQFALMKEFYDKGLFIVRLHTGDPCIYGAIQEQMAFFDRYKMSYHITPGISSFQAAAAALRSQFTIPEKVQSIILTRGEGRTPMPEKEQLHKLAQSQSTMCIYLSAGIVEQVQEELMQAYPPETPVAACYKLTWKEEKIYRGELKDLAKIVRDNNLTLTTLLVVGEAIDNRKGLSRLYAHEFKHLFRK 603
235 0.000e+00UniRef50_A0A1C0WHU7 Cobalamin biosynthesis protein CbiG n=148 Tax=Bacteria TaxID=2 RepID=A0A1C0WHU7_BACFG  ali  99  1MKTAIIVISEAGIALAKTLEQELPESEIFSTGTDTDCHSISNLQEAVPEIFHKFDAIIFIGAMGICIRAIAPHIEDKHKDPAVVCVDSTGRYAVSVLSGHIGGANGLTRYVASILGAEPVITTRSDRTGLWALDTLGKKYGWQTVPAESSDMNHLITLFVDCKPTALLLDIRDEGTTQLEHTLPPHVDVFYKFEDMDLRKYDLLLLVTPFIYNTSDTPALYYVPPVLHMGVGLARDAHPVDTVITHLMDVVVQANMIPLAIRTVSSIEEKKDEPVLKLLAEAYQTRLYTASQLSKIEVPTPSEVVNKHMGTPSVSEASALLSSGGGPLLLPKQKGANFTVAIAMDAASVRQGHIEIVGAGPGDPELISVRGRRFLEEADLILYAGSLVPRELTECAKAGATIRSSASMTLEEQFALMKEFYDRGQLVVRLHTGDPCIYGAIQEQMNFFDQYGMHYHITPGISSFQAAAAALQSQFTIPERVQTIILTRGEGRTPMPEKEKLSLLARSQSTMCIFLSAGVVDQVQRELLEHYPPTTPVAACYHLTWKDERIFRGQLQDLAKIVNENHLTLTTMIVVGDAIDNREGLSRLYSHQFKHLFRK 599
236 0.000e+00UniRef50_A0A2L2WJE3 Precorrin-4 C(11)-methyltransferase (Fragment) n=1 Tax=Prevotella sp. MGM1 TaxID=2033405 RepID=A0A2L2WJE3_9BACT  ali  72  1................................................................................................................................................................................................................................................................................................................................LASAGGRLIMPKTKGGDWTVAAAIAGDYIREGHIEIVGAGPGDPDLVSVRGRRMLERADLILYAGSLVPRSVTDCAKPGATVRSSASLALEEQIAIMKEYYDRGKFVVRLHTGDPCLYGAIQEQMNHFDRHGMRYHITPGISAFQAAAAELRSQFTIPRKTQTIILTRGEGRTPMPDTEKLHLLARSRSTMCIYLSADIVENVQEELLREYPADTPV.............................................................. 217
237 2.000e-98UniRef50_A0A0V8JR36 Uroporphyrin-III methyltransferase n=43 Tax=Bacteria TaxID=2 RepID=A0A0V8JR36_9BACI  ali  28  1............................................................................................................................................................................................................................................................................................................................................................MTAGKVFLVGAGPGDPKLITVYGVECIQQSDVILY-DRLANEKLLEYAKADAELIFCGKLPQDKIHSLLVEHALAGKTVTRLKGGDPFVFGRGAEEAQFLVQHGIPFEVVPGITSGIAAPAYAGIPVTHRDHATSFAIVTGHGREEKGQDLNWPALATGIDTIAFYMGVGNLPYICEQLIKHRNPHTQVALIEWGTTEKQRTVTGTLEDIVTIAETAKVAHPAIVLIGDVVGVREAIRWFE.......... 248
238 2.000e-98UniRef50_UPI00051BA389 hypothetical protein n=1 Tax=Clostridium sp. KNHs205 TaxID=1449050 RepID=UPI00051BA389  ali  28  1MKITVISFTKGGNKLNQRLCRALRNNGHYSTTPVDELGSFENISVLTGTLFESREGIIYIGACGIAVRSIAPYLQGKEVDPFVLVLDEKGNYVISLLSGHLGRGNELCRKVAELIEAKPVITTATDLNGVFAVDLFAGQHELVI--KEIYRIKSVSAALLAGEAVGIYSEYPLLG--KPPAGLEPGVK-------------KVGIYIGSDINAAPFETTLHLVPKNLVLGIGCRKGVTGMA-LHKRVTDVCSQAGIDIARISAICSVDLKSKEPGILELADRLKAKFYSAEELSAVTGEFHSPFVEETAGVGNVCERSGALASNSGKQLLPKTTGAGIAMAVY................................................................................................................................................................................................................................................................ 335
239 2.000e-98UniRef50_A0A2H6EVV6 Uroporphyrinogen-III C-methyltransferase n=1 Tax=bacterium BMS3Abin05 TaxID=2005713 RepID=A0A2H6EVV6_9BACT  ali  26  12.................................................................................................................................................................................................................................................................................................................................................................VYLIGSGPGDPGLLTLKGQALLKKADVVIY-DNLVNSELLNWVPEHTERIYVHTLRQEKINQLLIEKAQTRAVVVRLKGGDPYIFGRGGEEALALWEAGIPFEVVPGITAGAAALNYAGIPATLRGMDASLTFVTGHEDPAKESDINWKALAAEKSTLVFYMGVGQLPKITAQLIHGKSPQTPAAVIRNGTLPDQNVLVGTLETISDRAKAVRLAPPALIVVGEVVNLREKLSWF---EKKPLFGK 261
240 3.000e-98UniRef50_A0A1Y6C2M1 Cobalt-precorrin 5A acetaldehyde-lyase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Y6C2M1_9PROT  ali  29  8...AIYGITKHGLKTAARIKAAFPEADLYVSKKLMGQAPADSLSPLLRETFPAYDCHIFVVSVGAVVRMIAPLLQNKKTDPSVLCIDDANRFTICLLSGHVGRGNEFTSRVAEALGNQAVITTASDSIGTLTVDILGRKLGWVLED-DHHNVTRGCAAVVNEERVLIVQETGEPDFWPLDKKLPPGVDYCHSLDHVPAQTFDMHLIVSDRDIPNLYPNAVVYRPKSLILGIGCDRGT-PFELLERGIHGILKEFKLSWKSIKGLATISIKADEPGLVELGKRYNWPLYEPKALDDMEGENPSELVKKYTGSRTVAEGAALKRSGATSLLVSKQKYTEPNIAKNM............................................................................................................................................................................................................................................................... 359
241 3.000e-98UniRef50_A0A2N6G8S2 Uroporphyrinogen-III C-methyltransferase (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A2N6G8S2_9DELT  ali  24  1..........................................................................................................................................................................................................................................................................................................................................................MAQKPGKVYLIGAGPGDPGLMTLKGLECLRQADVVVY-DYLANPAFLEEAPA-AEKVYVHHHPQEKINELLIEHARQGKVVARLKGGDPFVFGRGGEEALELVEAGIDFEVVPGVTSAVAAAAYAGIPMTHRDHTTTLGFITGHEDPAKKSRLDWEKLSTSMGTLVFYMGMANLENICEQLVAHRDPQTPVAVVRWATTPRQETLVGDLSNIVRKVRGEGFKPPALIFIGEVVGLRKSLRWFDN---RPLFGK 256
242 3.000e-98UniRef50_I5B077 Cobalamin biosynthesis protein CbiG n=8 Tax=Desulfobacterales TaxID=213118 RepID=I5B077_9DELT  ali  31  8.KLAVWVLTPHGMVLAGRVKQALPHTELFASLKLAPGESFSTLAKTLAQVWDRYDAHYFIMATGIVVRTIAPLLQDKTKDPAVVCGDEAGHFVISLVSGHIGGANDLAVKLSQILGAMPVITTATDINQVPAIDVIARDQGLYIENK--AAIKHVSMAFIKGEPLPVHDPFQLVSPHLPSELM---------KDPSLFSSEKSGIWV-DYAVRDLPEKVLVLRPKMLVAGMGCRKGVTRRE-LEDHLQQVFHAQGVSVNSLSKIVSVDLKADEPGLLALARTLNVPFYTRDELDQVKVPNPSSLVNKHIGVKSVCEAAAMLATGTTCLLIPKTASRKVTLA.................................................................................................................................................................................................................................................................. 340
243 3.000e-98UniRef50_A0A0J5FR56 Siroheme synthase n=25 Tax=root TaxID=1 RepID=A0A0J5FR56_9GAMM  ali  25  157...............................................................................................................................................................................................................................................................................................IAGRWRERVKQRLASMRQRRHFWEKAFSGRFATLVANGQLQQAEEQLEQQLT-----QDNSRIQGELALVGAGPGDPGLLTLKGLQVLQQADVVLY-DHLVSAEILELVRRDADKIGNHSVVQEETNAFIVKLANQGKKVVRLKGGDPFIFGRGGEELQIAAEAGIPFQVVPGITAAVGASAYAGIPLTHREHSQSVTFITGHCRENGNE-LDWPALARGNQTLAIYMGIMKSALISQKLISHRDANTPVAVIGCGTRPEQQVLTGTLSELERLAQEAP--SPALLVVGEVAQLHHQIAWF........... 455
244 4.000e-98UniRef50_A0A1G1E6B5 Methylated-DNA--protein-cysteine methyltransferase n=4 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1E6B5_9BACT  ali  23  12..............................................................................................................................................................................................................................................................................................................................................WFIMQNEDGGSXXXKKRGKVYIVGAGPGNIGLITLKSKECIEDADVIIY-DYLANKEILSYARPDAEQIFMGKHTQDKINRIMAAMAKKGKTVVRLKGGDPFIFGRGGEEAEFLADRGIPFEIVPGVTAGISIPAYAGIPLTHRNYSSTIAFITGHEDPLKESSIAWNKIATGVDTIVIFMGITTLPSIVTNLIKGRTPDTPAAVIQWGSTNIQKTVTGTLKNIAATVKAEGIRPPGIIVIGEVVKLRKKLMWFE.......... 273
245 5.000e-98UniRef50_A0A0D8IA77 Cobalamin (Vitamin B12) biosynthesis CbiG protein CbiG n=6 Tax=Clostridiales TaxID=186802 RepID=A0A0D8IA77_9CLOT  ali  30  1MKVAILTVTKGGRALGLQLKSHLPQSQLYVLPKFYEGPIDPDLKTLVGEIFHTVDQLIFIMATGIVVRHIAPHLRDKRQDPGVLVIDEKGTNVISLLSGHIGGANSFTLKIADLLGANPVITTASDVRETMAVDTLAQSLGCRIT--DWQLTKKITAHIVNGGKVGIYWDKSF------SIKLPESYENLEKFDDLYHQTY--GIYVGNRCITLQGSNLLQLYTQNIVIGIGCRRGID-AATILEEIKSSLKEVGKRIESLKKLVTVDVKKDEEGLLEAARILNIPLIERQKIAEVEGLFASSFVKETIGVGSVSEPCAYLGSGGGNLILKKRKNQGVT.................................................................................................................................................................................................................................................................... 336
246 5.000e-98UniRef50_A0A075MRK8 Cobalt-precorrin 5A acetaldehyde-lyase n=45 Tax=root TaxID=1 RepID=A0A075MRK8_9ARCH  ali  31  4.KTAVVAITKHGIEIARKIKGKMPEVEVYVPAKHSDGGADEQSTQLVASLFKSHDALICVFSLGAVIRMVAPYLVDKKSDPAVIVIDDRANYVISALSGHLGGANALARLVASFLGAKPVITTAADVNETIAVDLVGREFGWTIENFD--NVTKTSALMVNEERIAIYQDAGERNWWQ-GQQLPKNVTVVDNIEKVKSPDFKAALVITDKMVDDVVAKSVVYRPKTLVVGIGLHWDTNK-ETIESGVTAVFKEKGLALKSVRNIASVDRGARVKGLDEFAGQYGMPIYKKEDLAKVEVPNPSPAVQKFEGTASVSEASAILDSKGELIVQKQKFPPNLTVAVC................................................................................................................................................................................................................................................................ 349
247 6.000e-98UniRef50_UPI0004883F05 hypothetical protein n=1 Tax=Desulfosarcina sp. BuS5 TaxID=933262 RepID=UPI0004883F05  ali  31  12.KFAVWSLTIQSARLASRITAEIADTDLYISSKLKPQISFTVLSRTLAEVFHQYKGHIFIMSTGIVIRIIAPLIRHKTKDPAVVVVDEKGLHAISLLSGHIGGANELTLKIAGITGADPVITTATDINKIPAIDLLACKKGLVIENPE--AIKNVSMALLSGKKIILHDPYQYLTGTLSASNMIMNSVDYNLDDDTIGKNRTAGVFI-DDIKADIPAHFLILRPVTLSIGMGCNRNT-SRQELKTFLTEVLDLFDLSPRSVLNLASIDIKSDEKGLLELAADLNLPFYSKKKLEQVKEKNPSLMVKKHIGVTSVCEAAAILSAENGKLIVPKQIKGNVTIA.................................................................................................................................................................................................................................................................. 362
248 7.000e-98UniRef50_A0A1M6SDX1 Cobalt-precorrin 5A acetaldehyde-lyase n=8 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1M6SDX1_9FIRM  ali  25  8.RIAILALTTGGARLAKMVAKGLQHTQLYLPQRPADTTYFTDWRQTAQEAFQRHRRLVFIMACGIVVRTLAPWLTSKNTDPAVVVLDEKGEFAISLLSGHVGGANQLARQVAQVSGGTPVITTATDVNQAPAVDLLAQEANCT--PYPMARVKLFNRWLAEGEKVSLYSRWPLPVDWQQGFQMIE--------EAGQLPKLGPVVYITNQLVPATEQPRLILRPCNLVVGLGCRKGVT-LQQVLQAIKTACKLGSYSLLSLAKLATVDLKMQEPALQQAAAYFQVPLVAREEIAKLDGQFSSDFVRQKIGVGGVCEPAAMIASDGGQIRVSKQKLGPVTVAIAEAKLWWW......................................................................................................................................................................................................................................................... 354
249 9.000e-98UniRef50_A0A1D9FJ78 Uncharacterized protein n=1 Tax=Clostridium formicaceticum TaxID=1497 RepID=A0A1D9FJ78_9CLOT  ali  31  1MKVAILTVTKGGRALGLRLKQLLPQSQLYVLPKFDVHLIDPDLKTLVEKLFPIVDQLIFIMATGIVVRHIAPHLKDKRQDPGVVVIDEKGTNVISLLSGHIGGANRFTLKIAGLLGANPVITTASDVKETMAVDTLAQNLDCRIT--DWQLTKKITAYIVNGGKVGIYWDKPYL------INLPSNYEILQKLDDFHHQTY--GIYVGNRCIEPQGNNILQLYTQNLVMGVGCRRGID-ATTILETIKVSLKETNKRIESVRKLVTVDVKKDEEGLLEAASTLKIPLIERQKIAEIERFFESPFVKKTIGVGSVSEPCAYLGSSGGKLILRKRKNQGVT.................................................................................................................................................................................................................................................................... 336
250 1.000e-97UniRef50_K9UB35 Precorrin-3B C17-methyltransferase n=1 Tax=Chamaesiphon minutus (strain ATCC 27169 / PCC 6605) TaxID=1173020 RepID=K9UB35_CHAP6  ali  20  32...AVVVLNQISVPTARKLMTALPGAQLYVGRTTDVDVSFANFGDTLRQFYSQGVPIIGLCAAGILIRTLAPVLTDSKTEPPVVSVAADGSAVVPLLGG-MTGVNDLAERIAAVLDVQPAITTTGKLQFNTVLPDPPAGYRL----ANPQHVKAFIADLIAGVSVSLDGDAEWL----------------TASEIPFCAQGERQITITTQAISGSPTQ-LVYHPTSLVLAV-----VQPSQSIAGWIEVILDRANLALAAVACIVLPKTPAG-AAIAGIGTSLNLPI----RLVESAIEHPDLTVVS---------------------SDRNLTIFSATQPIEPHAIGQDRGKITVIGTGPGSPQWMSPQVRQTILAATDIVGYHTYL--ALVKDLTVGKQCHGSDNRVELDRSKLALDLAASGKNVVVVSSGDPGIFAMAAAVLEVLDKEAIDLQVAPGISAMQAAAAAVGAPLGH----DFCAISLSDILKPWEVVARIASAAESDFAIAFYNPISQLTAAKEILLKTRSGTTPVILARNLGRPGQEVKVITLGELA----PESADMRTVILIGSSQTRADGNNWVYTPRSY..... 581
251 1.000e-97UniRef50_A0A1Z5HPT7 Cobalamin (Vitamin B12) biosynthesis protein CbiG n=1 Tax=Calderihabitans maritimus TaxID=1246530 RepID=A0A1Z5HPT7_9THEO  ali  31  1MKVAIIAVTEEGARLGEKLRSGLPGERLYLSSKIAAEVFNLPLSHLVGKLIKNFDGIVFIMALGIAVRVIAPYIQSKIQDPAIVVVDEKGRYAISTLGGHWAGANELTRQVADILGAKPVITTATDIQGLPAIDVIARRLHSIPEPF--HAVKDVNMALLRQEKVEIFSEIPRE-EIKAQWTDPKGQLIWKDIGDYTGASKHIAVVLSSRLFPQEMKPTLFLRPRNLVVGLGCRRGVT-VDEIKTAVEETFRQERLSTLSIAAFSTIDRKKDESALLQLAKAWEIRFWSPAELARVIEEFPSPRVKEKVGVGGICEPAAILGSGRGSLVVRKRKYQRVTLA.................................................................................................................................................................................................................................................................. 349
252 1.000e-97UniRef50_A0A1G5B8Y3 Cobalt-precorrin 5A acetaldehyde-lyase n=30 Tax=Clostridiales TaxID=186802 RepID=A0A1G5B8Y3_9FIRM  ali  26  1MNISIICFSMTGLETGERLQRALEKVTLAKKSRYLPDPISVSTSQWAGEQFRTGEGVIFVGACGIAVRSIAPYIAGKKTDPAVLVIDECGKFVIALLSGHLGGANELALRCAGYLKAVPVVTTATDLHSRFAVDVFAKKNGCAI--FHMKAAKEASAALLAGKSVGFYSEFPWDGELPEGLVLCGKDGRPSAAADPEGEASETGIAVTIHRGCLPFKNTVHVVPPAAVLGMGCRRGKD-AASIRKAAEECLRESDVYREALSAIASIDLKKEEVGLLSLAEAWQLPFFTEEELKAVQGEFPSQFVKKITGVENVCERSAVLGCGQGTLIRKKTGRDGVTTA.................................................................................................................................................................................................................................................................. 351
253 1.000e-97UniRef50_A0A0L6JQE4 Cobalamin synthesis G domain-containing protein n=1 Tax=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 TaxID=398512 RepID  ali  25  1MKIAIMAITKNGSELAMKTAESICKASLYIKDSFNVNPLKVPIYELVKDIFEIFDALVFVMASGIAVRTIAPLIKSKTTDPAVLVMDEQGRFVISLLSGHIGGGNSLTSEIAGLIGAVPVITTATDINGVISFDVFAGSNNLVIENMD--NLKYISSELVNGNKVGLFSECTLRG------NIPSEVVYLKDLSSKKVDNIKAMVVLSNRDLFTKECKVLYLRPKNLVIGLGCKRGITK-ERVIEAVENALATKRKSIESVKCIATIDLKADEKGLLEYCSEAEIELIPRDMVGKIEQQFKSGFVKSKVGVSCVAEPCAYIAASKGSFIMEKTSFKGITIAIF................................................................................................................................................................................................................................................................ 352
254 2.000e-97UniRef50_A0A2N2B235 Uroporphyrinogen-III C-methyltransferase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2N2B235_9FIRM  ali  24  1.............................................................................................................................................................................................................................................................................................................................................................MVGKVFLVGAGPGDEKLITVKGMEKIKQADVIVY-DELANDRLLSYSKEACEEIYVHALPQEKINELLVELAKQGKNVVRLKGGDPYVFGRGGEECQVLKAAGISFEVIPGVTSAIGGLAYAGIPITHRGCASSFHVITGHLQS-TDLELDFESLTKIKGTLVFLMGVENLENICTKLMHGKAPDTPAAIIYRATTPYQKVVEARLDLLVATAKEEKIQPPSLIVIGEVVNFRSQLSFF---EEQPLFGK 252
255 2.000e-97UniRef50_A0A1E4ZJ00 Uroporphyrinogen-III C-methyltransferase n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E4ZJ00_9GAMM  ali  23  138.................................................................................................................................................................................................................................................................................................................................................................VSLVGAGPGDPDLLTIKALRLIQSADAVVY-DRLVSQSILALCNPNAEFVYAHALPQDSINQLLVDLAQSHQRVVRLKGGDPFIFGRGGEEIETLSEQGISFQVVPGITAASGCAAFSGIPLTHRDHAQSCVFITGHLKDGK-INLNWKDLRDPNQTIVVYMGLTGLRGICDTLVAGRAPDTPAALVEQGTTADQRVLASTLCDLPDLVDQNNVGAPTLLIIGGVVTLRQKLQWF........... 377
256 2.000e-97UniRef50_A0A212LSX8 Cobalt-precorrin 5A acetaldehyde-lyase CbiG n=3 Tax=Sporomusa TaxID=2375 RepID=A0A212LSX8_9FIRM  ali  30  1MKLAVISVTRKGAELAERIAPLLPGVDVYAKKGSGSHRTYDSLSELVAEIFSLYDGLVFIMATGIVVRVIAAQVQDKRCDPAVVVMDDGGNYAISLLSGHIGGANELTRLVSRAAQAVPVITTATDVAGLPAADVLAVKLDLTIEPF--SSLKTINAAIVNGDRVLFFIDKELADERYIALATRQAVALVDSSELIYSDKYDAAVVITDKEFT-IHKPHLYLRPHSLALGIGCRRNTTGAE-ILSAINQACRTIGRSSNSVAVIGSTVVKADEQGLLAVAERLCVPFFTNEQLEQCINQYESDFVNEKIGVGNVCEPAAILAGRNNKLILPKTKYPKVTVAVTTVKYRWW......................................................................................................................................................................................................................................................... 356
257 2.000e-97UniRef50_A0A2H6F4P9 Uroporphyrinogen-III C-methyltransferase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H6F4P9_9BACT  ali  28  1.............................................................................................................................................................................................................................................................................................................................................................MKGKVYIVGAGPGDIGLLTVKGLRCLQKADVVVYDFHL-NAQVLNYVNHDAEFIYAHHMTQDRINRTLVEKAGEGKIVCRLKGGDPFVFGRGGEEAEVLAGEGIEFEVVPGISSAIAAPAYAGIPLTHRSYSSSLAIVPGYEDTKKESSIDWPRLATGVGTIVFLMAVRNISVVCRRLIEGRSPDTPVAVVRWGTRADQTTLVGNLKNIPGLVKENDIKPPAVMVVGDVVKLRERLKW---YEKKSLFGQ 254
258 2.000e-97UniRef50_UPI000408C9C6 uroporphyrinogen-III C-methyltransferase n=2 Tax=Alicyclobacillus TaxID=29330 RepID=UPI000408C9C6  ali  26  1............................................................................................................................................................................................................................................................................................................................................................MVSGRVYLIGAGPGDPGLLTVKGKQCLERADAVVF-DRLLSPRLLGYTKPGAELYDHHTMAQESINQLLAELAKAGKTVVRLKGGDPFVFGRGGEEAAYLQAEGIPWEVVPGVTSAVAVPAYAGIPVTHRAVSPSFTVVTGHRCKGQEDSLDWQALANVEGTLLILMGVRQLPDIVGHLMAHKAPDTPIALIRWGTRAAQETLVGTLADIVAKVEAARFQAPACIVIGPVVAARETLQW---SELRPLFGK 254
259 2.000e-97UniRef50_A0A1H3QJX8 Cobalt-precorrin 5A acetaldehyde-lyase n=1 Tax=Proteiniborus ethanoligenes TaxID=415015 RepID=A0A1H3QJX8_9FIRM  ali  27  1MNWAIVALTKDGTQQGKKIKKILNNIEIYTLKKWSDEETDKKLEEFVGSIFHKYDIIIFIMATGIVVRSIAKHIVNKTTDPGVLVMDEKGQFVISLLSGHLGGANEAAKLLADKMGGQPVITTASDVKGLIAVDTLAQKLNCQISSMD--KAKNLTGLIVNNESVLIKS------NINIDMKLPDNI--------LTEGEAKGTIFITNRVINKFSEYEVQLIPKNIVIGIGCRSGI-SGEAIVNAIKEALDLFNIDYRSIKHFATVDIKQNEAGIFDAAKHFKVKIVNRKEIKNIEHEFHSEFVRKSIGVGAVCEPCALLTASKGHFLMRKKSYNGITLSIW................................................................................................................................................................................................................................................................ 334
260 2.000e-97UniRef50_A0A1S2LLR0 Uroporphyrinogen-III C-methyltransferase n=2 Tax=Anaerobacillus TaxID=704093 RepID=A0A1S2LLR0_9BACI  ali  25  1...........................................................................................................................................................................................................................................................................................................................................................MTNNGIVYLVGAGPGDQKLITVKGLEVLKKAEVVLY-DRLVNPLLLQEVDPNAELIYCGKLPQEAINQLLVDKAKQGKVVVRLKGGDPGVFGRVGEEAEALKKENLSYEIVPGITSGIAAASYAGIPVTHRDYGTSFTVITGHDKKDGKPSINWGALANGIDTIAFYMGIKNLPFICEQFISGRAASTRVAIIQWGTTGRQRVVEGTLSTIVDEVEKNYISNPAITLVGDIVDLRKQLMWFEN---KLLLGK 256
261 3.000e-97UniRef50_H6CMQ9 Uroporphyrin-III C-methyltransferase n=42 Tax=Paenibacillaceae TaxID=186822 RepID=H6CMQ9_9BACL  ali  27  1.............................................................................................................................................................................................................................................................................................................................................................MAGKVYLVGAGPGDARLITVKGWECIQLGDVIVY-DRLASPRLLGLMKPGAQKIYVHTMKQEEINQLLVDLALEGKTVVRLKGGDPTIFGRVGEEAGLLRKHGISYEIIPGITSAISVPAYAGIPVTHRDMASSLSIITGHESPDKDKSIHWDKVTNATGTLIFMMGVAKIGYISEQLMKHKPSSTPVALIRWGTRAEQDTLVGTLADIEAKVKAANFKPPAVIVVGEVVKQREQLKW---AEEMPLFGK 254
262 3.000e-97UniRef50_A0A1H8A6F0 Cobalt-precorrin 5A acetaldehyde-lyase n=3 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1H8A6F0_9FIRM  ali  29  1MHLSLISFTAKGAQLCAHIAKGLSSCSAYTMPRFVCDPLENNISEWAKNAFANSDGLIFVSAVGIAVRAIAPYIKDKTTDPAVVVIDEQGDFVVSLLSGHIGGANNLALQVASIVGAQPVISTATDCRQIFAVDSWAVQNQLYI--ADLKAAKHISAALLDGKSIGFASDFAFEGD------LPKGLT--------QKPCSEIGIMVSLDENKKPFGCTLNLVPRIITAGIGCRRGTE-QKTIESHLLSELQRHHLSLYALRQVCSIDLKANEQGLTGFCLAHKLPFYTAQQLERVQGEFSSQFVTSVTGVDNVCERAAVLGSG-GKLIVKKYGANGVTSAFACEDWRIRF........................................................................................................................................................................................................................................................ 344
263 3.000e-97UniRef50_UPI0009B0E557 uroporphyrinogen-III C-methyltransferase n=1 Tax=Gordonibacter massiliensis TaxID=1841863 RepID=UPI0009B0E557  ali  28  8...............................................................................................................................................................................................................................................................................................................................................................PQVYLVGAGPGDPGLLTLKGRAAIERADVLVY-DRLVSPRLLGYARPDCELVYVHTLPQREINALLVEKALAGNVVVRLKGGDPFVFGRGGEEAEELRAHGISYDVVPGVTSAVAAPAYAGIPVTHRDAASSFTVITGHEHADKSASIPWEQVARLKGTLVFLMGMDNLGRIVGSLVEHMDPATPAAVVRYGTWPMQRTVLGTLASIEELVREEGIENPAVIVVGQVAALRERLAWV---ERKPLFGK 259
264 3.000e-97UniRef50_B7VKN8 Cobalamin biosynthesis protein n=18 Tax=Vibrionaceae TaxID=641 RepID=B7VKN8_VIBTL  ali  31  1MKIAIYAITLHGARQAKRLAKTFPFADVFIAPVGQEEYPEAPLSGFLPPQFKQYDHHICFFAAGIVSRMIGPLLEDKRTDPGVICIDDHGQFVIPMLSGHRGGANGIALQVSQALNATPVITTASDAAGSLSVDMLGSPFGWTLDPQCEPAITATSAAVVNEKRILIVQHAGEQNWWQNKRSMPRHIITHPALSDTDTDDWDGLVLISDEAQPKSYADTVLWRPKSLVLGIGCDRNT-PLHVLKAGIDVFLTEYNLAKASVSAFASIALKADEKGILELSSESQIPFYSAEQLDGVEGENPSEYVKKITGVSSVSEAAALKHAKRDQLLVPKWKFKQ...................................................................................................................................................................................................................................................................... 353
265 3.000e-97UniRef50_A0A2T4TCI1 Cobalt-precorrin 5A hydrolase n=1 Tax=Lachnospiraceae bacterium oral taxon 096 TaxID=712982 RepID=A0A2T4TCI1_9FIRM  ali  30  1MKITIISFTEQGMRLGQRVNELLNTMGHHVEMVDRMKNHRVPLKEFAGEYFYSNDALVFIGATGIAVRAIAPFLKDKFEDPAVLCMDELGNYVISLLSGHMGGANELSRILAEHLGANAVITTATDVEGVWAVDEWAKKNKLKL--SDRKLAREVSSRLLDGESVEMVSGYKIIGKVPTY---------------LRNSQSPISIYVTNRTFKKPEKSILRLIPKNICVGVGCKKDTE-IEKMDEAFSAWLTKNQIDGAAIASFATIDLKANEPAILALAKKYRLKIYTAKDLEKAKGDFNSEFVEEITGVGNVCERAS........................................................................................................................................................................................................................................................................................ 306
266 3.000e-97UniRef50_A0A1F7SII0 Uroporphyrinogen-III C-methyltransferase n=1 Tax=Candidatus Schekmanbacteria bacterium RIFCSPLOWO2_12_FULL_38_15 TaxID=1817883 Re  ali  24  1............................................................................................................................................................................................................................................................................................................................................................MNKGKVYLVGAGPGDPSLITLKGVNCIKNADVVVY-DRLINQDILSYAREDAELIYSHSIKQDEINRLIIKKAREGKTIVRLKGGDPFIFGRGGEEALALAEKRIPFEIVPGVSSAIAVPTYAGIPLTHRDYASAVTFITGHKKDGSSLPVITKEIASLQGTLVILMGAGNLGSILDDFIRGKSPSAQIAIISSGTTPRQEILTGTIKELKNKTNTKRVKPPAVIVIGDVVNLSKKLRW---YEKKPLFNK 254
267 3.000e-97UniRef50_J4J2L3 Uroporphyrinogen-III C-methyltransferase n=85 Tax=root TaxID=1 RepID=J4J2L3_9FIRM  ali  23  1.............................................................................................................................................................................................................................................................................................................................................................MSGKVFLVGAGPGDPRLLTVGAMNCLREADVVVY-DHLADESILAHVPHGAERIYVHTMRQEDINVLLADKAQEGKTVVRLKGGDPFVFGRGGEEALVLLERNIPFEVLPGVTSAISVPAYAGIPVTHRGVAVSFAVITGHEDTKAESHIRWKHLATGVDTLVFLMGVANLPVITKNLIEGRPADTPAAIIRWGTRANQETYVTTVGEAAEMVQRDGIRPPAIFIVGEVVRLREQLRWFDRADIRPLLGK 257
268 4.000e-97UniRef50_A0A1I2CBM5 Cobalt-precorrin 5A acetaldehyde-lyase n=10 Tax=Negativicutes TaxID=909932 RepID=A0A1I2CBM5_9FIRM  ali  29  1MNAIVFSFTRNGAKISLKLQKYLDSCGIYTTRRYRDLNPAPSLQLMCKEAFSLCRLMVFIGATGIAIRSIAPYIRSKTKDPAVISIDEQGKFVIPLLSGHIGGANGLATGIAAFLNAVPVITTATDVNDLFAVDEWAARHNMSI--FNMQSAKTFASYLVDCKKVGVKSEFPVRGPLPKGLIM--------------AEEGPVGLAISLRKTVQPFVETVVLRPRILHLGIGCRRGT-PMYLIEELVVQELKKLKVTMSVVKGIASIDVKKDEEGLLAFAREFPIRFYSAEELNAVEGIFPSAFVAKTVGVDNVCERAAVLDSNGGKLLLRKTGRNGVTLA.................................................................................................................................................................................................................................................................. 336
269 4.000e-97UniRef50_A0A0A2W0K2 Siroheme synthase n=1 Tax=Beauveria bassiana D1-5 TaxID=1245745 RepID=A0A0A2W0K2_BEABA  ali  19  268......................................................................................................GGDVAERKARLLLEAGARITVNA-LEFSPQFKVWAEQNMLTLAEG------AFSETLLDESWLAIAATDDDEVNQQVSDAAESRRIFCNVVDAPKQASF-----IMPSIIDRSP----------LMVAV-SSGGTSPV--LARLLREKLEAS--LPLHLGKIAA---------------------FAGTLRGRVKQTFATMGERRRFWEKFFTNDLAQYLANEDQLAVEKETESLFSTPLD------HRGEVVLVGAGPGDAGLLTLKGLQQIQQADVVVY-DRLVSDDIMNLVRRDADRVGYHCVPQEEINQILLREAQKGKRVVRLKGGDPFIFGRGGEELETLCNGGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLVTGHLKTGGE--LDWANLAAEKQTLVFYMGLNQASAIQQQLIAHMEESMPVALVENGTAVNQRVVDGTLNQLGELAT--QVGSPALIIVGRVVGLRDKLNWFSNH........ 705
270 4.000e-97UniRef50_A0A1G9TLS2 Uroporphyrinogen III methyltransferase / synthase n=1 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1G9TLS2_9FIRM  ali  26  1.............................................................................................................................................................................................................................................................................................................................................................MQGMVYLVGAGPGDYKLISVKAMEYIKQADTIVY-DRLADDRLLAYARPEAELIYVHTMGQQEINQLLVDQARAGKTVVRLKGGDPFVFGRGGEEALALVENGLPFEIVPGITSAVSVPAYAGIPVTHRGIAVSFAVVTGHEDPAKESGIQWDKLATAVDTLVFLMGVENLPHITDRLIAHRPATTPAAVIRWGTKPEQRVLVTTVGQAAQAVAEQGFKPPAIFVVGEVVRLRSQLAWFD---QKPLFGK 254
271 4.000e-97UniRef50_A0A1M7G4H1 Cobalt-precorrin 5A hydrolase n=1 Tax=Anaerosporobacter mobilis DSM 15930 TaxID=1120996 RepID=A0A1M7G4H1_9FIRM  ali  26  1MRYVMFSFTSKAATLSSHLHSHIINCTSYTTVKSELPPHLIPLKEQVKEVFHNVDAIIFISACAIAVRSIAPYLESKTTDPAVIVIDELGQYAISLLSGHIGGGNELTKYVAGFIGATPIISTATDLNNLFAVDVFATKNNMYMDN--MTLAKQVSSELLNHKEVGVNTDFPINSQLPKQLVLVSDIQSQNRLSMRTPNEYPLGISITLDEHSSPFDRTLHLIPRIITLGIGCKKDT-PMEVIESRVQHTLAEHHISIHAVKQVASIDLKVNEIGLLDFCQKYDLPFHSAKELSSLTGDFPSSFVKSVTGIDNVCERAALYLEPTGTILIRKTAANGVTIAAVICPY............................................................................................................................................................................................................................................................ 366
272 4.000e-97UniRef50_A0A2H0MXF7 Uroporphyrinogen-III C-methyltransferase n=1 Tax=Nitrospinae bacterium CG11_big_fil_rev_8_21_14_0_20_45_15 TaxID=1974048 RepID=A0  ali  24  10................................................................................................................................................................................................................................................................................................................................................................FVYLIGAGPGDAGLLTLKGRDTLIKSDVIVY-DHLVNKALLRYAPDSCELIYAGKIQQEEINELLIEKAGEGKIVSRLKGGDPFIFGRGGEEAQALNRAGIPFVVIPGVSSFTGVSAYAGIPLTHRHLSSSFSVITGSEKSQEDETIDWENIAKRSGTLVFLMGARRLPHIVAKLIEGKDPETPVAVIRKGTTGEQKTCIGTLATISEIARQENISPPALTVIGEVVNLKKEIDW---YEKLPLFGK 260
273 4.000e-97UniRef50_A0A023X3V4 Uroporphyrinogen-III C-methyltransferase n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A023X3V4_9ACTN  ali  29  6..............................................................................................................................................................................................................................................................................................................................................................YGTVYLVGSGPGDPGLVTVKGLRLIEAADAVVY-DRLAPESLLAHAREDAEFVYVHSMSQEEINATLVRLGQEGKNVVRLKGGDPYIFGRGSEEALELLRAGVPFEVVPGVTSGVAAPAYAGIPVTHRGVSTSVAFVTGHEDTKGRTDVDWKTVAKGADTLVLYMGVGRLKEISRQIVAGRPPETPVAVVRWGTLPEQRTVTGTLADIARKVEEAKLGPPAITVVGGVAALREGLGWF---ERRPLFGR 259
274 5.000e-97UniRef50_E3HDD8 Uroporphyrinogen-III C-methyltransferase uroporphyrinogen-III synthase n=119 Tax=Fusobacteriales TaxID=203491 RepID=E3HDD8_ILYPC  ali  23  1............................................................................................................................................................................................................................................................................................................................................................MNKGKVYIVGAGPGDLELLSLKAKRCVEEADCIVY-DRLINKRILKFAKPDAELIYLGKLNQDEINKTLVREALKGKVVTRLKGGDPFVFGRGGEEIQEILKDEIPFEVVPGITSSISVPAYSGIPVTHRGISRSFHVFTGHTMEDGGWH-NFDAIAKLKGTLVFLMGVKNLDLITGDLIKGKDPETPVGIIEKGSTSKQRVIRGTLSTIVEIAKKEDVKPPAIIIIGGVVNLRDEFNWFEKKE---LFGK 253
275 5.000e-97UniRef50_C0ZHX1 Uroporphyrin-III C-methyltransferase n=27 Tax=Bacillales TaxID=1385 RepID=C0ZHX1_BREBN  ali  28  1............................................................................................................................................................................................................................................................................................................................................................MNTGRVVFVGAGPGDPKLLTIRGMESLRLADVIVY-DRLANQQLLSYAKKGATLIYHHTLPQEEINLLLIQEAQKGKYVVRLKGGDPSMFGRVGEEAQMCRDYSIPFEIVPGITSGMAAPLYAGIPLTHRDYNSSVAFVTGHLCEKNAGKEDWAALASME-TLVIYMGVKNLPRIRERLLAHKDAHTPVALVRWGSVREQETLIGKLGTIDKEVEQARFAAPAIIIIGEVVRLRESLNW---YESRPLFGQ 254
276 5.000e-97UniRef50_A0A252F388 Uncharacterized protein n=1 Tax=Butyricicoccus porcorum TaxID=1945634 RepID=A0A252F388_9CLOT  ali  29  1MNISIISFTGRGHALSARIAACMPEDCVTQYAKAEGFAAYDSVRAFAARAMAEDSAVIFVGAAGIAVRAVAPFVRGKDVDPAVLVVDENGRFVIPVLSGHIGGANQLAEQLAEQLHAIPVITTATDGRGRFAADSWAVQHGCVV--ADIRCIKYISGALLRGDSVGLRSEFPISG------ALPEGIT--------AEGQPENGILISYERAERPFAHTLWLVPRIVHVGVGCRRDLPP-DQLNARVEELLGQLGIARQAVASVASIDLKADEPAVCELARAWNVPFYTAAELDEVPGEFPSAFVRETTGTDNVCQRAAARASKNGRCLLGKTAGGGTTVSVYCEDW............................................................................................................................................................................................................................................................ 334
277 5.000e-97UniRef50_R9T4X7 Cobalamin (Vitamin B12) biosynthesis protein CbiG n=1 Tax=Methanomassiliicoccus intestinalis (strain Issoire-Mx1) TaxID=1295009 RepID  ali  26  1MKIKLIGFSSAGCSLVNKISEGLSECEAYGKCTFVSEPVTQTLHAWTEVAFQDSDAIIFVGAVGIAVRAIAPFVKTKVADPAIVVLDERGSYSIPLLSGHIGGANTLAKIIAEMIGAEAVITTATDINGKFSVDSFAEERGMYISS--MACAKDISAYILEKGNVGFKSDFPVYGQLMNGL--------------VSADDGDIGIHITSNDAKGPFCKTLNLIPKTTIIGLGCRKDT-PAENIEKLVIKVLKSNELSIHSVKSAASIDLKMNEPGILNFCKKYGLEFFSKEELECVEGDFSSPFVKSITGVGNVCERAALKASADGKLIQKKVAENGVTVA.................................................................................................................................................................................................................................................................. 335
278 6.000e-97UniRef50_F0JIY0 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=7 Tax=Desulfovibrionaceae TaxID=194924 RepID=F0JIY0_DESDE  ali  33  5.KIAIYALTSQGLAVAKRLAARLPG-TLYASKNLEAEISFESLKHLVSASFNAFDGHIFVAAAGIVVRCIAPHLQSKETDPAVVCMDQTGLFAISLLSGHLGGANELADRCARIMGGQSVITTATDSAGVLSIDSLAMAKGLAIGTIN--KVKDVNMALLEDRTVQLYDPEDWLG-----LAWNASFEGKVGYEDWNDTMPGIWVSW----HNDAPEGSLALHPRVLHLGIGCRRDITTYE-ILDHVYAVFKKYGFSMESIASVGSVEAKRNEPGLLEAAEEFGVDFYSTAQLAAVDTPTPSDRVQAHMGVPSVAEASAMLASHGGELIVTKEKTSTVTLA.................................................................................................................................................................................................................................................................. 335
279 6.000e-97UniRef50_A0A284VR72 Uroporphyrinogen-III C-methyltransferase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A284VR72_9EURY  ali  27  1.............................................................................................................................................................................................................................................................................................................................................................MIGKVYLVGSGPGDPELLTIKAKRLIESAEVILY-DQLPGKAILDMLPASAERIDVHKLSQWQINELLVKRAKEGKLVVRLKGGDPYLFGRGGEEAQVLVREGIEVEVVPGITSAIAVPAYAGIPITHRDYASMVTFITGHEDPTKEEGLDWELLARFEGTLVILMGVSMLESNVKELLKHKSIDTPVAVIEKGTRPDQRVTVGTLADIVGLCKQRNVRAPAITVIGDVVKLHREL.............. 243
280 7.000e-97UniRef50_A0A1M6D3I2 Cobalt-precorrin 5A acetaldehyde-lyase n=1 Tax=Lutispora thermophila DSM 19022 TaxID=1122184 RepID=A0A1M6D3I2_9CLOT  ali  28  1MKTAVIAITKKGIELAKRIGGSM-KADVFVKNDTFDKVVEADFKNVMEKLFNDYEALICIMACGIVVRSIAPYLKSKQLDPAVVVVDELGRFAISLISGHIGGANRLAEKVAAAIGAAPVITTATDINRVVAFDELALMNNCAIEN--IGNLKYISSELVNGGKICLLSHCKLKG------VLPNNIELYD-----PEHSYEAAVILSNRETPVIAEKILYLRPKNLIIGIGCKRG-KTRQEIKNAVMDFMTKSGKSLLSVRCIASINLKSEEKGINEFSKEMRIPFFSVDEIKRIEQFFCSDFVRKTTGVGNVAEACAVLAGTDAKLIYPKTVYDGITLA.................................................................................................................................................................................................................................................................. 341
281 7.000e-97UniRef50_A0A1G1PT95 Uroporphyrinogen-III C-methyltransferase n=4 Tax=root TaxID=1 RepID=A0A1G1PT95_9BACT  ali  22  1.........................................................................................................................................................................................................................................................................................................................................................MYRANKSKVYLTGAGPGDPGLITLKAIECLKKAKVVIY-DRLVNPELLKYAPQDAEILYKHSLNQDEINRLIVKKAKEGKTVVRLKGGDPFLFGRGAEEALELAKNKIPFEVIPGVSSAIAVPAYAGIPLTHREFTSSVGIFTGHEDPAKESRIDWEKISTGLGTLVFLMGVENLSFIVKNLLAGRETSSPCCLIQEGTTPRQKTITADLETIVVKARQAKIRPPALLVVGGVVSLRKQLNWLEN---KPLFGK 258
282 7.000e-97UniRef50_D5XFJ7 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=2 Tax=Thermincola TaxID=278993 RepID=D5XFJ7_THEPJ  ali  31  1MKVAVVALTKQGIQKGAEVEKALTKRGHFVPGKYSRSPFRKPLRDLMAELMHEYEAIVCIMALGIVVRLIAPHLQDKRTDPAVVVLDEKGCNVISVLSGHWGGANGLTSELAREMGANPVITTATDVQGLPAIEMMAKEKGWAV--GDFSLVKKVNAAIVNCAPVHLYCDEEI------NTSLPKNVVQFPVYQKPTEDAGALRVVVTNRFLPGNSEDTLFLRPKNLVLGIGCRKGV-SKAALRDAVIDALAKANVVFESVRAIASVDLKAKEPALLELAGEWNIPFYSPGELQKVFSLSRSEFVKEKLGVDGVCEPAALLETGNQ................................................................................................................................................................................................................................................................................. 337
283 8.000e-97UniRef50_UPI000984F3A8 uroporphyrinogen-III C-methyltransferase n=2 Tax=Marinicella TaxID=863253 RepID=UPI000984F3A8  ali  19  162................................................................................................................................................................................................................................................................................................ARQMRQSIKENIPDFNNRRRFWQRFFD----WSHASLSLFKDPHMNPGKEHIDELISEVNQTAGRVSLVGAGPGDPDLLTIKAIKVLQSADVVLH-DHLISSDIMAMIRKDAELIDVHLTKQQVINQLLVEHARQGLHVCRLKGGDPFVFGRGGEEIQQLNKHQIPFEIVPGITAAVGCAAYAGIPLTHRDHAQGLAFITAHCSDSKD-RIDWQFYAKNQQTLAVYMGLIKAEHLVTQLIHGKNPSVPVAIIENGTRHNQRTVTGQLHQLAAMIDEHKINSPALIIIGEVAGYAEQLDWF........... 462
284 8.000e-97UniRef50_A0A2N1U322 Uroporphyrinogen-III C-methyltransferase n=1 Tax=Candidatus Riflebacteria bacterium HGW-Riflebacteria-1 TaxID=2013829 RepID=A0A2N  ali  25  1............................................................................................................................................................................................................................................................................................................................................................MKRPNVYLVGAGPGDPGLITVRGLELVRAADVLIH-DQLGTAEFLGMVKEGCELYDVHKVSQDGINELLVEKARENKLVVRLKGGDPFVFGRGGEEMLYLVEAGIACEVVPGVTSAISAPCYAGIPITQRGYTASLAVVTGHEAEKEGSDIDWSALSKI-GTVVFLMGVKNLPVITRNLIAGRSPQTPVAMIQNGTFPTQKTVCGTLADIVEIAEAAEIKPPAVTVVGEVVALREKLQWF---EKRPLFGK 253
285 9.000e-97UniRef50_A0A2C6MHI6 Cobalamin biosynthesis protein CbiG n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6MHI6_9FIRM  ali  29  8.RVAILALTVGGARLAGTLGRLLGDVQLYIPGRLCDTLYFENWQQAAAEAFHRYNRLIFIMAAGIVVRTLAPLVHSKKTDPAVVVLDEKGRFAVSLLAGHLGGANGLAQKVAGLLRGTAVITTATDVNGVPAVELLARELDCKIYPA--KGITLFNRLLVEGEKISLCSRWPLK---------PEHTTGFAYNEGEESGETGPIVYITNQLVQPVQGPRIILRPRNLVAGVGCRKGV-SREQVVSAVKKACKLGGFSLLSLRSLATVDLKMQEPGLLEAANYFKVPLVTRQQIDSLDGQFPSDFVKDRIGVGGVCEPAAITASAMGQLKVPKQKLGPVTVAIAEAKLWWW......................................................................................................................................................................................................................................................... 353
286 1.000e-96UniRef50_Q2LQU1 Uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase n=42 Tax=Bacteria TaxID=2 RepID=Q2LQU1_SYNAS  ali  25  8...........................................................................................................................................................................................................................................................................................................................................................MSKRGRVYIIGAGPGDPGLMTVKGTKCLAEADVVIY-DHLINPGILHHARETARLVYKHTLSQEEINARLVSEAQQGHVVARLKGGDPFIFGRGGEEAEVLAREGIPFEIVPGVTSAIAVASYAGIPLTHRRHTATLAFVTGHEDPKGQSEIDWKALA-GIGTLVFLMGVRNLSRIAAGLIAGKKPETPAALIRWGTTANQETLVGTLENIADLAEAAGFAPPAILVVGGVVGLRKELNWFET---RPLFGK 262
287 1.000e-96UniRef50_A0A2N6F485 Cobalt-precorrin 5A hydrolase n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6F485_9DELT  ali  31  1MRVAIVAITGPGVQQARDLGNALPESTVYCPERYDEQVFTAPVVELLPELFAEYEGLICVMATGIVFRALAPFLRGKDVDPAVVVMDEKGQYAVSLLSGHLGGANDLARSAARASGGQAVITTATDVNRLPAWDDIARKEGLRVEP--IKNIRKLNSLLLDKQNIVLVDRCKRISEYFSGV---PGVGFFENIGEGMKVSAKGYVFVTHYNINQWQQDVLVLRPRDLVVGIGCNRDTT-ADEIESVVQEEFSRLHLSQHSIACIATIDAKNDEAGLLQFAENLPIEFHSAAALNTIRVPSPSPHAREAVGAQGVCEPAALLSAGCDRMLLGKQKRGNVTIA.................................................................................................................................................................................................................................................................. 344
288 1.000e-96UniRef50_A0A1E7JC65 Uncharacterized protein n=4 Tax=unclassified Desulfobacterales TaxID=1403365 RepID=A0A1E7JC65_9DELT  ali  29  15.KYAVWAITPKGRILAGKIRQRLDSADCHIPGHDDHCVGFENFKAHVLSSFCHYKGHIFIMATGIVIRIITPLIKDKTVDPAVVVLDEKCNHCISLLSGHLGGANELARQVAQIVGAVPVITTATDANDVPSIELIAEELDLVIEN--PAAIKFINMGFLRKETIEVLDPFRFLRDSLPAAMFTRYFRTIHSHPAPERGDAQPLIYVGD-EIKELPPACLVLRPRILVAGIGCNRGTGK-EEINGFLYEVLHKHKLSVMSLCRLATIDIKKDEKALVLLAKELHLPFYSSEELNRVKGQSPSRLVRKHTGVESVCEAAALLGAKTTQLLVAKQVAKNVTVAVARTVCM........................................................................................................................................................................................................................................................... 368
289 1.000e-96UniRef50_S0G3H3 Cobalt-precorrin 5A hydrolase CbiG n=3 Tax=Desulfotignum TaxID=115780 RepID=S0G3H3_9DELT  ali  28  1MNTAIWALTPHGVFLSKKLGAHFSGADLFVSERLDVKKTFTRLGDAVADQFHAYGAHIFIMAAGIAVRVIAPHIRKKTTDPAVVVIDDAGRFCISLLSGHLGGANRLSESAARVINAVPVITTATDANDLPSMDMIARDQNLEIEN--PSAVKTINMMFLKNHPVFMHDPYGLL----------AGKIPARLIRKSAAENPDAPSIIVDDQTRTTGRHDLVLRPRILFAGIGCNRGTEMSE-ISGLLKKVCDKHGLSIHSIRAIATIDLKKDEPGILELAQRLCVPFYDSDTLNQVSTVSESPFAEKYTGAKSVCEAAAILSANPGKLIVTKQKTRQVTIA.................................................................................................................................................................................................................................................................. 338
290 1.000e-96UniRef50_N6WT80 Siroheme synthase n=4 Tax=root TaxID=1 RepID=N6WT80_9ALTE  ali  21  160.......................................................................................................................................................................................................................................................................................................LSDRLTTPHQRRSFWYQLLDGNLVARA----HQMPASDLSDSLESAIRKAASGSGRGEVFLVGAGPGDPDLLTLKALRIIAQADVVLY-DRLVSREILARVRADAEMIHVHTLPQHEINERLVELARKGRTVVRLKGGDPFIFGRGGEEIETLAEAGVAFQVVPGITAASGCSAYAGIPLTHRDYAQSVRFVTGHLKND-TCDLPWKDFVQNNQTLVFYMGLVGLPIIVRELVAHMPADMPVALVSKGTTPEQVVVTGQIDSIVEKVEASEVKAPTLIVIGEVVKLRDKLDW............ 452
291 1.000e-96UniRef50_A0A0F9D2W5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9D2W5_9ZZZZ  ali  26  6.RVIVYYITGGGRELAEKLSEAMPETECVSYTR-----------DSVSRDWQTAKALVFIMASGIAVRSVASFLKDKKEDPAILVMDEKAAHVVSLAGGHEAGANDLAREIASVTGATPVITTGTDSNELTSIDVFARDHGLVIEN--RGYLSHISRRHIRQTLLKVFNETTIELTDDLLGV---------------RDVRKADVIISSRLY---EVDALMFRPRELYLGLGVNSGTG-AEEIEKEVSKFLKDNGFSPASLALIATHEKKKEEAGLKEFAEKMGVRIFTTEELNCVKGVEESPAAMKALGVRAVAEPASLLASGAKELTIKKVKCKNVTLSLSIA----RRGRLDVVGTGPGGLEYITPNAIKAIRESDVVVGFKSYL--DLIKPLLPGKEVVSSAMTQEVKRVQRAVELATDGRKVALVSGGDPGVYAMAGLAYE......................................................................................................................................................... 415
292 1.000e-96UniRef50_A0A2P5K3Y7 Uroporphyrinogen-III C-methyltransferase n=1 Tax=ANME-2 cluster archaeon HR1 TaxID=1968520 RepID=A0A2P5K3Y7_9EURY  ali  27  9.................................................................................................................................................................................................................................................................................................................................................................VYLVGSGPGDPELLTLKAYRLIKEADVIVY-DQLPGEQILASMPQGAQKIDSHTLKQDQINRILVEKAHEGKKVVRLKGGDPYIFGRGGEEAQVLVRAGIEVEVVPGITSAIAAPAYAGIPITHRDHTSMVSFVTGHEDPTKDDSINWEALAMSDGTIVILMGVSMLSNNVKELIKHKDPNTPVALIEKGTRYDQRTTVGTLENIVELANKREVKAPAITVIGDVVQLHDEL.............. 247
293 1.000e-96UniRef50_A0A2V9JX16 Uroporphyrinogen III synthase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JX16_9BACT  ali  22  221..........................................................................................................................................................................................................................................................................IAVRAERATLRHLGGGCQVPI-AAHAVAEGNELRMVGLVASRSADDFPCATNSALEAGARRVTKPPHHLRASTRTPKFRPWTFMSGKVYLVGAGPGDPGLFTLKGKAVLERADCVIY-DRLANEVLLRYARPGCERIFAGRRRQAEINRLLISKAREGRVVARLKGGDPFVFGRGGEEALELVKAGITFEVVPGVSSGFAVPAYAGIPVTHRELTSCVTFVTGHEDPAKSPALDWPSLASGQGTLVFFMGVRNLEGIAAALIQHRDAHTPAAAIHWGTRPMQRVITGTLDGIA--AKGASFQPPALLIVGEVVRLREQLNWF---ERLPLFGK 554
294 1.000e-96UniRef50_A0A1Y6J2T6 Uroporphyrinogen-III C-methyltransferase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y6J2T6_9VIBR  ali  22  1.............................................................................................................................................................................................................................................................................................................................................................MKGKVWLVGAGPGDPTLLTVKALYCIRKAEVIVY-DRLVSKEILQEAPDNCRMVNVHPIPQDDINDCLIQFARQGLNVVRLKGGDPYVFGRGGEEAEALAELGIEFEVIPGISSAIGGLAYAGIPVTHRDCASSFHVVTGHLKQGKDP-LDWTQFSKLDGTLVILMGMSQIKHICQQLIDGKSSNTPAAVVRYASRENQQVVTGTVADIARRVEEAKVTSPALIVIGGVAAKHTTLSFQATCRH...... 249
295 1.000e-96UniRef50_A0A1Y6AXV0 Uroporphyrinogen-III C-methyltransferase n=568 Tax=Bacteria TaxID=2 RepID=A0A1Y6AXV0_BACCE  ali  26  1.............................................................................................................................................................................................................................................................................................................................................................MNGYVYLVGAGPGDEGLITKKAIECLKRADIVLY-DRLLNPFFLSYTKQTCELMYCGKMPQEMINAHLLQFAKEGKIVVRLKGGDPSIFGRVGEEAETLAAANIPYEIVPGITSSIAASSYAGIPLTHRNYSNSVTLLTGHAKGPLTDHGKYNS-SHNSDTIAYYMGIKNLPTICENLRAGKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIVGDVVSLRNQIAW---KERKPLHGK 252
296 1.000e-96UniRef50_A0A2E4PWU5 Uroporphyrinogen-III C-methyltransferase n=23 Tax=Halomonadaceae TaxID=28256 RepID=A0A2E4PWU5_9GAMM  ali  24  152..............................................................................................................................................................................................................................................................................................................................................................QGQVALVSAGPGDPELLTLKALRHLQQADVIIH-DRLVSHEILALANPEARRLYVHSVPQEGINQALVDYARAGHRVVRLKGGDAFXFGRGGXELETLAGAGISFEVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGHLKDGSC-DLDWEALARPAQTLVFYMGLGSLGLICEQLIAGLAASTPIALVEQGTTARQRVHVATLADMPAQIAGQGLKPPTLIIVGDVVKLHDSLKWF........... 394
297 1.000e-96UniRef50_A0A1Y1CN26 Uroporphyrin-III C-methyltransferase n=1 Tax=Marinifilaceae bacterium SPP2 TaxID=1717717 RepID=A0A1Y1CN26_9BACT  ali  25  1..........................................................................................................................................................................................................................................................................................................................................................MNPKRGKVSIVGAGPGDPELITLKSIRAIENADVVLY-DYLVNKELLAYCKSDCEIIYVHTYPQEEINGMLIELGLAGKKIVRLKGGDPFVFGRGAEEILGLKEHDIEFEVIPGITAGFAVPGAAGIPVTLRNVASSVAFFTGHQCDNHKTEIQWDKIATGIDTLVFYMGVTQAARIVRNLMAGRKPETPVAMIRWGTLPEQEVLKGTLGNIVAKMEEHDFKPPAIFIVGEVVAYSEQLS............. 246
298 1.000e-96UniRef50_A0A1M7LWT3 Cobalt-precorrin 5A acetaldehyde-lyase n=21 Tax=Firmicutes TaxID=1239 RepID=A0A1M7LWT3_RUMFL  ali  27  1MNISIFSVTENGRQLSQRVAEMLRGEHCFHKHTDDDSAVFWNMGSMVGRLFQRSDAFIFICACGIAVRAIAPYLGTKADDPAVIVMDDHGKFTIPVLSGHIGGANCLAEVIAEAVGGTAVITTATDVGGKFSPDSFAVANDLIIT--DLKAAKEIAAAVVDDEKIGFSSDYPH-------SSLPDELTAF--------GICRTGVYVGHDMSAKPFEVTLRLVPKNIVLGIGCKKGT-SEDSIEKAVSDALGRYDLDITMISEVCTIDIKKDEEGLCSFCQKYSIPMFTAEELMNVKGNFSSDFVLETTGADNVCERSAVLGSGGKLMIHKT........................................................................................................................................................................................................................................................................... 322
299 2.000e-96UniRef50_A0A2D1SNK5 Uroporphyrinogen-III C-methyltransferase n=25 Tax=Bacillales TaxID=1385 RepID=A0A2D1SNK5_9BACL  ali  27  1.............................................................................................................................................................................................................................................................................................................................................................MSAKVFIVGAGPGDPKLLTIRGLECIQQADVILY-DRLVNPVLLEHAKETVELIYCGKEPQDEIHRVLVEKALAGHTVLRLKGGDPFVFGRGAEEAAVLREENIDYEIVPGITAGIAAPAYAGIPVTHRDYATSFAIVTGHGRAEKKDFLNWGALSHID-TVAFYMSVGNIEHITARLIEHKRSETPVAVIEWGTTDKQRTIIGTLETISKQIEQEVIQNPSMILVGDVVNVRKDIAWFNEKEY...... 250
300 2.000e-96UniRef50_A0A1V5D265 Uroporphyrinogen-III C-methyltransferase n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5D265_9DELT  ali  26  1..............................................................................................................................................................................................................................................................................................................................................................MGKVYLVGAGPGDLKLITLRGLELIQHADVIIY-DNLVDKDLIAFAKKKAELIYAGKKPQEDINALLLKKAAKDNVVVRLKGGDPFIFGRGGEEAEFLVDHGIVCEIVPGVTSAVSVPAYAGIPLTHREYASTVAFITGHEDEKKTTSIRWYELANGPETLVFLMGIKNLDIIVRRLIEGKDPDTPACIIQSGTLPTQKVITGPLKLIGSLAKSAGIKPPGIIIVGHVVSLRNKLAWF---EKRPLFGK 253
301 2.000e-96UniRef50_A1JJS8 Siroheme synthase 1 n=92 Tax=root TaxID=1 RepID=CYSG1_YERE8  ali  24  157...............................................................................................................................................................................................................................................................................................VAGRWRGRVKQHIASMGERRRFWENAFSGRFASLISRGQLAQAEEELQLSLEG------QNRNQGEVALVGAGPGDPGLLTLRGLQVIQQADVVLY-DHLVSPEVLDLVRRDAQRICVHSVAQEETNQLLVTLAQRGKRVVRLKGGDPFIFGRGGEELQVVARAGIPFHIVPGVTAASGATAYAGIPLTHRDYAQSVTFITGHCRADGD-DVDWQALARGRQTLAIYMGTVKAAEISQQLIAHRASTTPVAVIGRGTRADQQVLTGTLAELELLAHQAP--TPALLVIGEVVDLHHQIAWF........... 454
302 2.000e-96UniRef50_A0A1M7LWZ8 Uroporphyrinogen III methyltransferase / synthase n=3 Tax=Halanaerobium congolense TaxID=54121 RepID=A0A1M7LWZ8_9FIRM  ali  25  1.............................................................................................................................................................................................................................................................................................................................................................MEAKVYLTGAGPGDPDLLTLKAKKAIEKADVVLY-DRLANDRFLEYAGSEAEKIYVHHYTQSEIETLMVEKVEAGKTVCRLKGGDPFIYGRGGEEALKLKEAGIDFEIIPGISSSLAVPLYAGIPLTQRHLASSFAVITGHEAADKEESIEIEKIAAAVDTLVVLMGVGKLPQIVERLEAGKSPDTPAALVRWGSRSNQQTLTGTLANIVEKVEAADFKPPAVIVIGKVVNLREKLGWFENKK---LLGK 254
303 2.000e-96UniRef50_A0A2A5WFA8 Siroheme synthase n=12 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5WFA8_9GAMM  ali  20  160..................................................................................................................................................................................................................................................................................................EYRDAVKKRFSGFNERLRFWEELLESELTELVYSGKTDAAKKLIVRYLTT----QKKERISGEVYLVGAGPGDPDLLTLRALRLMHKADVVLY-DRLVSPEVMSKLRPDAEKIHVHIVEQESINHMLVRYAREGKRVLRLKGGDPFIFGRGGEELSSLANAKIPFQIVPGITAASGCASYAGIPLTHRDYAQSVRFLTGHLKDG-ELILDWKNLVQEHETLVFYMGLLGISTICEQLVKHMDASMPIAVVQQGTRRSQRILSAELKTMPALIENSNLKPPTIIIIGRVVDLRAELSW-YNPE....... 461
304 2.000e-96UniRef50_W1J890 Uroporphyrinogen-III C-methyltransferase n=107 Tax=root TaxID=1 RepID=W1J890_9GAMM  ali  27  1............................................................................................................................................................................................................................................................................................................................................................MNKGYVWLVGAGPGDAGLITVKGLHCIQSADVIVH-DRLVNSELIALRPDHCEIIDYHPIPQEEINQILVRHALAGKQVVRLKGGDPYVFGRGGEEAEVLAQHGIKFEIVPGISSSIGGLAYAGIPVTHRDYASSFHVVTGHTSQGNEQ-QNWEILAQLEGTLIILMGMTRLMDICQQLIRGKSPATPAAVIMYASHSKQKSVTGTLETLASKVEAEKLHAPALIVVGDVVNLADTLSF............ 244
305 2.000e-96UniRef50_C0GDW8 Cobalamin (Vitamin B12) biosynthesis CbiG protein n=1 Tax=Dethiobacter alkaliphilus AHT 1 TaxID=555088 RepID=C0GDW8_9FIRM  ali  31  1MNGAVIAVTPGGQKLARRVAKT-TGFSIYLPEPGDGAISYTTLRQAVTDCFRQKEALVLIMACGIAVRILAPLIESKQTDPAVVVMDEAGSFAISLLSGHWGGANELAHSLGELLGATPVITTATDVNGLQAVDTLAREMG--VQPEPFSLIKQFNAAMLKGEAVAVFSDYP--GLRRISCAGLFFYPFSQFAQMAPQYKYRALLTNAAKVLGSHDGD-LYLRPPNLCIGIGCRRGV-PTERILQAIYDVLDKHNLARGSIARLCSIDAKKDELGLLGAAKQLGVPFYSKEEITALKVPYHSSFVHQNMGVGAVCEPTAMLAAGNGRLLVTKQKMEGITVAVAEEEYPW.......................................................................................................................................................................................................................................................... 349
306 2.000e-96UniRef50_UPI000986DD0F uroporphyrinogen-III C-methyltransferase n=1 Tax=Massilimaliae massiliensis TaxID=1852384 RepID=UPI000986DD0F  ali  22  1............................................................................................................................................................................................................................................................................................................................................................MKNGKVWLAGAGPGDPGLLTVKAKRLIETADVIVY-DRLVGDAVLSLIPCGTERIDVHPVPQEEISRILLKEAQKGKKVLRLKGGDPFVFGRGGEEIELLSSHQIPYEIIPGITSAVAVPAYAGIPVTHRDFCSSFHIITAHRKRGDHSLPDFDTLAKLDGTLIFLMGVSALEDICKGLIAGMKAETPAAIIESGTTSRQRRVVAALDTLPERAKEKSVSSPAVIVVGRVCSLENQLAW---AEHRPLHG. 253
307 2.000e-96UniRef50_A0A2G6G6S4 Uroporphyrinogen-III C-methyltransferase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2G6G6S4_9FIRM  ali  23  1............................................................................................................................................................................................................................................................................................................................................................MSRKKVYIVGVGPGDWQLLTLKAERVIKDADVVVY-DRLVSRKVISMINKRTEKIYVHIVPQERINEILIEKAKENKMVVRLKGGDPFVFGRGAEEIYGLVENDIPFEVIPGITSSISVPAYAGIPVTHRNESASFHVFTGHFKEGEPEKLDFETLAKLEGTLIFLMGMKHLSDITKGLIKGKDPLTPVAVIERGTMPSQAQLIGRLEDIAEKAKSGGFKPPAIIVIGDVVSHQETLSWFTN---RPLYGK 255
308 3.000e-96UniRef50_W2BZQ2 Cobalamin biosynthesis protein n=1 Tax=Eubacterium nodatum ATCC 33099 TaxID=1161902 RepID=W2BZQ2_9FIRM  ali  27  2..IGLLAFTRRGEVLSHRISDFFPNESCIFYNREK-----STAREFVNENFNKVDKIIFVGALGIAVRLISAHIVKKDTDPAVICVDEMGKYVISVLSGHMGGGNELASYLADCLEAEPVITTATDLSGVWACDVWAVKNNCRVANTDE--IKTISGALLQGEKVGLKSDFSVTGAMPDGIYMVEEGRCNYAGFDVKKQGLDKGICISHDDEKKPFARTLNLVPVNVVLGVGCRRNTCS-EAFEAFILENLKEHNISVKAVARMASIDLKKDEACIKHFSEKYGIKFFSARELMEIPGEFHSDFVEKTTGADNVCERSAAGIGAKKFILGKKSKDGMTIAMGIKDW............................................................................................................................................................................................................................................................. 356