current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MEKENTNGGSVYVTVDGHFKPVHVSMKGTGEKGFLEFMLEDVEKALKETEMPVIGMMYYNVPDMGIVPHLWEGNNDDYLQRLEKAMDGHGIKLHRYLRLSEVVYCLLast
1 -5.370IDP91498 translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1675 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  10  214LKMSKDEVKREYKEMEGSPE-IKSKRRQLHQELQASNQRENVKRSNVLVTNPTHIAVGLYYKGETPLPVITLMETDAMAKRMIAIAREEGVPVMQKVPLARALY.. 317
2 -5.290IDP91183 gene: yscU; type III secretion system protein [Chlamydia trachomatis D/UW-3/CX] CT091 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  214LKMEKFEVKQEFKDTEGNPE-IKGRRRQIAQEIAYEDTSSQIKHASAVVSNPKDIAVAIGYPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVPLAHQLL.. 317
3 -5.220IDP04703 putative type III secretion apparatus protein [Yersinia pestis CO92] YPO0273 [Yersinia pestis CO92]  ali follow..  10  214LKMSHDEVKREYKDSNGDPH-IKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYPEETPLPIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALH.. 317
4 -4.810IDP91472 putative type III secretion system EscU protein [Vibrio parahaemolyticus RIMD 2210633] VPA1354 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  16  232........................EIKSERKRQMREFAETPITKGRQPTFAPTHILVPVCYPKIERRPVVLKICTESLALEERKRLEAMGIPIIEHIPLARAMY.. 315
5 -4.770IDP00185 hypothetical protein YPO0639 [Yersinia pestis CO92]  ali follow..  346VRRSTADRNLLRKEFDNGVRKKFLKDIANNPEVVKRLDAFDRSVL-AKGVVPDGYQVHHKLPNFDNLVLISTRPEHAAFTTTQKHITK-NLTPTGTNIVQGIIY.. 459
6 -4.540IDP90309 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_702 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  38IEEDDRENGDLLIVLGK----------SILNGAIRQFYISDHNYAYTRGYYQGCWEGWFNIPPKKITTAEYDCDQ--LTTNVEKLIHAPEDFPAQNANLDNIIICM 138
7 -4.370IDP05132 gene: flhB; bifunctional flagellar biosynthesis protein FliR/FlhB [Clostridium difficile 630] CD0262 [Peptoclostridium difficile 630]  ali follow..  11  465LRMTKQEVKDEYKNSEGDPE-VKAKIKQKQRQISSQRTMQAVPSATVIVTNPTHLSIAVRYKGKDQAPVVVAKGADYLAFKIREIAKGNDIPIIENKPIARLLY.. 568
8 -4.160IDP95345 FOG: TPR repeat [Vibrio cholerae AM-19226] EDN17312 [Vibrio cholerae AM-19226]  ali follow..  11  1MKPYPNRITRFVMLLSIMIGLVACKPNPEDDIAFQPFITENINKKSDDPYISSTVKPGDKMYDI--LVNIQHGKWDVAEGGLLSLIDEGN---------PDAMLWY 96
9 -3.920IDP05468 hypothetical protein BA_2103 [Bacillus anthracis str. Ames] BA_2103 [Bacillus anthracis str. Ames]  ali follow..  15  1MKKYYTIVGIISIIL-----VAILLITCPKESDFKLYLEDKYALKCDES......................................................... 44
10 -3.860IDP04643 gene: purM; phosphoribosylaminoimidazole synthetase [Francisella tularensis subsp. tularensis SCHU S4] FTT0893 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  60..........LVQSIDGVGTKTKVAVMCGKFENLYDLFSAATNDIVVMGAKPITFLDYVAHDETAEMPGVYQAGEIDMVGVITGIVDRKRIINGENIKEGDIVFGL 184

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.