current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|29345430|ref|NP_808933.1| hypothetical protein BT_0020 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
1 -6.810IDP91328 ribonuclease G and E [Vibrio vulnificus CMCP6] VV2_0290 [Vibrio vulnificus CMCP6]  ali follow..  20  53............................................VTPSVDKRFETFSAPKYGFRAGARTLRTYQNKH-FAPSNENKK................................................................. 105
3 -6.230IDP02566 gene: adP-2; alkaline d-peptidase [Bacillus anthracis str. `Ames Ancestor`] GBAA3033 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  55MQETIKIGAPGVLAKTSNKGKISSYTAGVADLSTKKPVKSDYRFRIGSVTKATTVLQLVGENRVQLDDSIEKWLPGLIQGNGYDGNQITIRQLLNHTSGIAEYLK------SKDADIMNSKKTYTAEEIVKIGL-ALPSDFSPSNTGYVILG 208
4 -5.900IDP02583 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase/isomerase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5249 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  16  85..........IEAGNLEDDLERLADVDWIIEVVVENLDIKKKLFEKVDRKPGSIVSSNTSGAEGRSDDFQKHFLGTHFFNPPRYLKLLEVIPTKKTDPQVLSFMNRIGTYGLLVTLQEMVKRGYSIGEVDSVTGPLIGRPKSATFRTLDVVG 257
5 -5.880IDP02331 gene: adP-1; alkaline d-peptidase [Bacillus anthracis str. `Ames Ancestor`] GBAA2661 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  57MRDSLQLGYPGILAQISKGGKNWSYAAGIADLRTKKQMKTDFRFRIGSTTKATVLLQLAGENRLNLDDSIEKWLPGVIQGNGYDANQITIRQILNHTSGIAEYLK------SKDYDIMDTKKLYTAEELVKMGI-SLPPDFAPSNTGYVILG 210
7 -5.500IDP95095 beta-lactam binding protein AmpH [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002918033 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  10  53.............LVVIDGNQRVFRSFGETRPGNNQHPQLDSVIRIASLSKSEMLVKLLDQGVVKLNDPLSKYAPPGARVPDWQGKPITLVNLATHTSALPREQPGGAAHR--------PVFVWPTRQQRWNWLSTATLKAAPGSQAFDLLA 192
8 -5.470IDP04252 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1780 [Clostridium perfringens ATCC 13124]  ali follow..  298.......DKALQIAKDLDIKINFFEAPHYTINKAQNESPTGSGSYYVPTPLYYIEGGKENDMLNKIKNMSNTTFAGMFYHPFLEAKLIDFKD----------------------GQDGYPEDNYKKPSIIQKVIDEFE-------RNVSIIS 438
9 -5.390IDP05610 putative lipoprotein [Bacillus anthracis str. Ames] BA_5062 [Bacillus anthracis str. Ames]  ali follow..  15  26...............................................EKANGFVLYGTEEQVTQIADKNKKEVKEKDFYKMKMDGKKVLVMDKKTGEELVKKELLSKVDAKDDTKPLDKLPAVTTEQGVLEKVENATLDRAKLKYEGNTIIG 136
10 -5.380IDP00779 gene: sirR; iron-dependent repressor SACOL0691 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  10LKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGRLEKATKPYKGVRTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEHRISDLFVERLDSLLN............................................... 119

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.