current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|29345426|ref|NP_808929.1| hypothetical protein BT_0016 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKILKDTVLFGLFASYADGVRNGEEKLSAAYDDFATLLATLPTDGTNICAQLRRLFYTKIELRGIQETVSTNGMERHVLFDVYIGKALALLDAEEQMMKEVLRHGGTEAMGLKEEAVCRNGKKGSVTLTWNGTDSDLIELVAALMAAGVIGTAEGRELKVVDVIRVFEEVFHLKINALYTKRGKVFDRCTDTTPFIDSLRRSYNRMLDARLALast
1 -55.400PF09357.10; F4C775_SPHS2/62-280; RteC protein  ali follow..  13  8.IVLGKLIYYKVFRIETACPASNGNIYENYFAMHLRELKKEYTEHVCNSDFYRYYRSGRTDRDEQKINCYDGLNSFVFEIDPKFSTYFDYKVAKIIANELVYNYLTTKLSPEQNP-DVLLQQEETKDFFWTQTKNALIELIYALYACDAISHG---KIGIRKISMVFQILFRVSLNDIHNSFHRMKTRAGSRTLFLDQLKYGLEEYMDRED. 219
2 -7.070PF09743.9; G3TKG3_LOXAF/7-282; E3 UFM1-protein ligase 1  ali follow..  16  1...........................................................................................................EIRRLAADFQRAQFAEATQRL----SERNCIEIVNKLIAQKQLEHVRGGRVNIVDL----QQVINVDLTHIENRIGDIIKSEKQDENYLDRLAEEVNDKLQES.. 128
3 -6.640PF17743.1; E2R6Z9_CANLF/1-547; Family of unknown function (DUF5580 topsan)  ali follow..  15  478.......................................................................................................................................RFRKLENALYLCDLSNTGVLEKERARRLIHNYNLIYNLSLSP--QKIDQALRRNMLLEPALQYLKE........... 546
4 -6.630PF00445.18; W4Z585_STRPU/89-388; Ribonuclease T2 family  ali follow..  218.............................................................................................................................GEHNYFQKTLTLFDIKGMLEASA-IVPSKTNSYDYPTIFNAVKGAIGTDP------TVTCVYDHKTQLVYLSQVEICLDKQFNPVN. 299
5 -6.410PF07750.11; Q6N0I8_RHOPA/48-208; GcrA cell cycle regulator  ali follow..  16  1...............................................................................................................................LTWTDER---VEQLKKLWEGG---------LSASQIAAELGNV-NAVIGKVHRLGLSGRAKSPTSAA.................. 56
6 -6.140PF06511.11; SIPD_SALTY/5-341; Type III secretion systems tip complex components  ali follow..  11  142.......................GDSYLGVYENVVAVYTDFYQAFSDILSKMGGWLLPGKDGNTVKLDVTSLKNDLNSLVNKYNQINSNTVLFPAQSGSGVKVATEAEARQWLSELNLPNSCLKSYGSGYV-DLTPLQKMVQDIDGLGAPGKDSKLEMDNAKY-QAWQSGFKAQEENMKTTLQTLTQKYSNANSLYDNLVKVLSSTISS... 328
7 -6.090PF07097.11; Q9CIA3_LACLA/28-129; Protein of unknown function (DUF1359 topsan)  ali follow..  17  30....................................................................................................................................RQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISL---LKDNIEGNTTIASELVAKLGIEVE.... 102
8 -5.740PF03836.15; I4Y9I7_WALMC/1321-1459; RasGAP C-terminus  ali follow..  1.................................................................................................................................YTEVKATAIEYCLQLEKIGEITRKDHYQGVLNAIAVDVRN--QKELNSMENTLKILDEKKDYLHNQQEAFNSYIETSMQT... 86
9 -5.650PF05649.13; A3QH91_SHELP/60-438; Peptidase family M13  ali follow..  11  140...LPEKDYY--------NEAERFVNIRKAFVAHIEKMFTLAGLPNALETAIASRHWDVVETRDSTKTYNLYQVADLPKLAPDINWNGYLKTLGADKQADIIVNQPSFIEGFNEVLQANDLSVWKTYMTWQTLTHFAGDLSTDLFFSKKLNGQAEQQPRWKRGVSTVNNLLGEVVGKVYVKRHFKPEAKHRMQELVENLRRAYGESIDGLE. 355
10 -5.430PF11340.8; F6AI97_PSEF1/83-282; Protein of unknown function (DUF3142 topsan)  ali follow..  1....................................................................................................................................DGRPVVMVIR-LDGQLPQPDQTQILSRTASLLAEWQAS-GVNLQGVEIDHDCASARLPAYTDLLTALRSALPANLA.... 74

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.